Your browser is old and dusty. Try Google Chrome!

Details for slr0845

ORF slr0845
Accession NP_442462.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -362 -348 6.98109 0.11
NP_441061.1_2 Forward -125 -111 0.589577 0.205
NP_441061.1_2 Reverse -355 -369 -2.16369 0.285
NP_440795.1_7 Forward -362 -355 14.6904 0.0123
NP_440795.1_7 Reverse -355 -362 14.6904 0.0123
NP_441418.1_6 Reverse -354 -373 -10.9153 0.0415
NP_441418.1_6 Forward -363 -344 -11.8986 0.0576
NP_440815.1_2 Reverse -263 -277 11.2087 0.265
NP_442291.1_5 Forward -364 -348 3.79511 0.105
NP_442291.1_5 Reverse -353 -369 1.5335 0.144
NP_442291.1_5 Reverse -43 -59 -2.39974 0.215
NP_440897.1_6 Reverse -354 -373 -3.93454 0.259
NP_441453.1_4 Reverse -354 -362 16.539 0.00633
NP_441453.1_4 Forward -363 -355 16.539 0.00633
NP_441453.1_4 Forward -53 -45 3.85433 0.284
NP_441623.1_1 Forward -215 -197 -2.93078 0.25
NP_442151.1_6 Forward -126 -112 8.35772 0.175
NP_442151.1_6 Forward -223 -209 8.16106 0.182
NP_442151.1_6 Forward -228 -214 5.99778 0.253
NP_442182.1_3 Reverse -279 -298 7.47261 0.262
NP_441818.1_1 Forward -362 -351 9.69459 0.232
NP_440226.1_1 Forward -363 -344 6.09597 0.137
NP_440226.1_1 Reverse -354 -373 5.211 0.163
NP_440259.1_4 Reverse -33 -47 11.4317 0.255
NP_443002.1_5 Reverse -322 -340 7.98318 0.299
NP_442173.1_1 Forward -362 -354 15.4574 0.00633
NP_442173.1_1 Reverse -355 -363 15.4574 0.00633
NP_442752.1_4 Forward -363 -356 13.8055 0.0199
NP_442752.1_4 Reverse -354 -361 13.8055 0.0199
NP_443027.1_4 Reverse -352 -362 14.828 0.0437
NP_443027.1_4 Forward -365 -355 5.87989 0.294
NP_441812.1_3 Forward -364 -350 14.9459 0.106
NP_442975.1_10 Reverse -350 -364 13.8636 0.0459
NP_442975.1_10 Forward -367 -353 2.45727 0.274
NP_440784.1_7 Forward -362 -355 15.9687 0.0123
NP_440784.1_7 Reverse -355 -362 15.9687 0.0123
NP_440061.1_9 Forward -121 -107 6.68548 0.235
NP_440061.1_9 Reverse -25 -39 5.01387 0.298
NP_440878.1_9 Forward -136 -117 -3.44213 0.293
NP_442062.1_8 Forward -363 -353 19.4496 0.000558
NP_442062.1_8 Reverse -354 -364 19.4496 0.000558
NP_441859.1_3 Forward -364 -345 10.52 0.12
NP_440304.1_4 Reverse -352 -362 10.8948 0.051
NP_440304.1_4 Reverse -115 -125 3.02829 0.299
NP_440304.1_4 Forward -365 -355 1.84832 0.299
NP_442242.1_4 Forward -362 -355 14.3954 0.0124
NP_442242.1_4 Reverse -355 -362 14.3954 0.0124
NP_440044.1_8 Forward -362 -343 1.17943 0.18
NP_441208.1_9 Forward -366 -352 6.09611 0.253
NP_442276.1_2 Forward -138 -119 2.94938 0.299
NP_441082.1_10 Forward -274 -261 9.65572 0.242
NP_441402.1_4 Reverse -29 -48 14.2574 0.291
NP_441083.1_3 Forward -127 -117 17.4824 0.0636
NP_441083.1_5 Forward -363 -353 11.3864 0.0159
NP_441083.1_5 Reverse -354 -364 11.3864 0.0159
NP_441434.1_7 Reverse -46 -60 1.67122 0.299
NP_441738.1_2 Forward -361 -354 15.28 0.0102
NP_441738.1_2 Reverse -356 -363 15.28 0.0102
NP_441558.1_5 Reverse -352 -371 7.27595 0.185
NP_440209.1_1 Reverse -354 -362 18.1123 0.00295
NP_440209.1_1 Forward -363 -355 18.1123 0.00295
NP_442889.1_1 Forward -316 -297 -4.22878 0.152
NP_442889.1_1 Forward -259 -240 -15.7335 0.298
NP_442889.1_8 Reverse -351 -365 13.1753 0.0588
NP_441770.1_4 Forward -338 -319 -6.98204 0.229
NP_440178.1_5 Forward -357 -348 18.6826 0.137
NP_440178.1_7 Reverse -51 -70 -22.6167 0.268
NP_442570.1_3 Reverse -94 -113 6.58763 0.151
NP_442461.1_2 Reverse -155 -174 17.5024 0.216
NP_442461.1_3 Reverse -134 -148 17.3912 0.284
NP_442461.1_4 Reverse -25 -44 24.0905 0.013
NP_442462.1_1 Forward -209 -190 19.3707 0.0166
NP_442462.1_8 Forward -310 -291 20.059 0.0967
NP_442462.1_9 Forward -271 -252 18.6823 0.197
NP_440538.1_10 Forward -383 -364 15.0441 0.187
NP_441716.1_1 Reverse -354 -368 4.32615 0.256
NP_442111.1_4 Reverse -353 -367 6.48943 0.123
NP_440906.1_5 Forward -362 -355 15.8704 0.0124
NP_440906.1_5 Reverse -355 -362 15.8704 0.0124
NP_440747.1_10 Forward -366 -354 5.44718 0.0137
NP_440747.1_10 Reverse -351 -363 -2.02597 0.0196
NP_441847.1_4 Reverse -170 -189 17.404 0.0701
NP_441130.1_10 Reverse -352 -366 12.3893 0.0957
NP_441486.1_1 Reverse -351 -365 21.2391 0.00239
NP_441486.1_1 Forward -366 -352 18.9775 0.00367
NP_441486.1_1 Forward -56 -42 2.45787 0.0831
NP_441667.1_1 Forward -102 -87 14.303 0.284
NP_441014.1_10 Forward -201 -182 -3.24622 0.297
NP_442848.1_1 Reverse -44 -58 1.17956 0.245
NP_442848.1_1 Reverse -348 -362 -2.95034 0.263
NP_442848.1_1 Forward -369 -355 -3.04867 0.263
NP_442848.1_9 Reverse -208 -227 1.76941 0.255
NP_443018.1_3 Forward -362 -355 14.8871 0.0123
NP_443018.1_3 Reverse -355 -362 14.8871 0.0123
NP_443018.1_3 Forward -110 -103 7.6106 0.156
NP_443018.1_3 Reverse -45 -52 4.26735 0.267
NP_443018.1_3 Forward -52 -45 4.07068 0.299
NP_441634.1_8 Reverse -352 -366 3.14618 0.155
NP_441634.1_8 Reverse -367 -381 0.786239 0.217
NP_441634.1_8 Forward -365 -351 -4.4253 0.295
NP_440376.1_1 Forward -363 -354 19.4693 0.000692
NP_440376.1_1 Reverse -354 -363 19.4693 0.000692
NP_440376.1_1 Forward -38 -29 3.93297 0.188
NP_441588.1_4 Reverse -46 -56 8.4365 0.145
NP_441588.1_4 Reverse -356 -366 7.25653 0.178
NP_441588.1_4 Forward -361 -351 6.96153 0.178
NP_442687.1_7 Forward -364 -354 15.8113 0.0125
NP_442687.1_7 Reverse -353 -363 15.8113 0.0125
NP_442589.1_10 Forward -63 -44 14.4533 0.299
NP_442485.1_2 Reverse -114 -133 10.3242 0.288
NP_442485.1_3 Reverse -319 -338 -4.42544 0.28
NP_442530.1_2 Reverse -130 -140 12.7631 0.276
NP_441013.1_2 Forward -74 -56 -4.79907 0.299
NP_442296.1_9 Reverse -355 -374 -1.08219 0.197
NP_440360.1_5 Reverse -321 -340 -0.590531 0.297
NP_442658.1_1 Reverse -352 -362 15.9091 0.00966
NP_442658.1_1 Forward -365 -355 15.9091 0.00966
NP_440141.1_8 Forward -339 -320 8.75091 0.23
NP_440141.1_8 Reverse -102 -121 4.12936 0.293
NP_441971.1_5 Reverse -354 -373 8.06259 0.288
NP_440656.1_8 Reverse -343 -362 5.99764 0.0835
NP_441414.1_9 Reverse -354 -373 13.2741 0.0145
NP_441414.1_9 Forward -363 -344 -7.4737 0.219
NP_442321.1_1 Forward -243 -224 -6.88371 0.246
NP_441958.1_5 Forward -364 -354 12.2714 0.00183
NP_441958.1_5 Reverse -353 -363 12.2714 0.00183
NP_441127.1_1 Forward -228 -214 9.5377 0.272
NP_441127.1_1 Forward -333 -319 8.06273 0.3
NP_442690.1_1 Reverse -83 -102 -7.17871 0.174
NP_442911.1_2 Reverse -344 -363 9.3409 0.0179
NP_442911.1_2 Forward -373 -354 7.96426 0.0225
NP_440153.1_5 Reverse -355 -369 1.96621 0.241
NP_442119.1_9 Reverse -353 -372 14.6508 0.214
NP_442064.1_4 Reverse -92 -111 11.7 0.174
NP_442051.1_5 Reverse -114 -133 9.93088 0.29
NP_443055.1_3 Forward -339 -320 11.3136 0.26
NP_440602.1_8 Forward -363 -349 15.9292 0.115
NP_442995.1_5 Reverse -349 -368 15.3391 0.183
NP_442002.1_9 Forward -364 -357 10.7572 0.185
NP_442002.1_9 Reverse -353 -360 10.7572 0.185
NP_442598.1_2 Reverse -84 -93 14.2577 0.252
NP_441294.1_7 Forward -367 -353 12.9942 0.0767
NP_441646.1_1 Forward -370 -351 7.66927 0.156
NP_441646.1_1 Reverse -22 -41 3.44104 0.207
NP_442438.1_10 Forward -368 -354 5.21113 0.137
NP_442438.1_10 Reverse -349 -363 1.76955 0.188
NP_441000.1_6 Forward -364 -350 13.2743 0.0396
NP_441000.1_6 Reverse -353 -367 12.9793 0.0396
NP_440147.1_4 Forward -365 -352 11.3273 0.0326
NP_440147.1_4 Reverse -352 -365 2.18257 0.209
NP_441175.1_7 Forward -321 -302 8.25926 0.211
NP_441550.1_8 Forward -365 -355 8.3377 0.124
NP_441550.1_8 Reverse -352 -362 6.0761 0.214
NP_441916.1_7 Forward -363 -353 18.4663 0.00144
NP_441916.1_7 Reverse -354 -364 18.4663 0.00144
NP_441916.1_10 Reverse -109 -128 16.5191 0.0888
NP_441916.1_10 Forward -338 -319 2.94938 0.236
NP_441041.1_4 Reverse -354 -373 2.16274 0.0752
NP_441041.1_7 Reverse -351 -363 10.916 0.0864
NP_441041.1_7 Forward -366 -354 9.65268 0.108
NP_442396.1_5 Forward -367 -354 8.47575 0.153
NP_441725.1_5 Forward -362 -352 11.2881 0.0247
NP_441725.1_5 Reverse -355 -365 2.04498 0.115
NP_439966.1_7 Reverse -352 -362 18.4657 0.00473
NP_439966.1_7 Forward -365 -355 9.91099 0.0968
NP_439966.1_9 Reverse -352 -361 0.983037 0.253
NP_439966.1_9 Forward -365 -356 0.884706 0.253
NP_440736.1_3 Reverse -352 -371 0.58944 0.282
NP_442941.1_3 Forward -362 -352 11.4848 0.0116
NP_442941.1_3 Reverse -355 -365 2.63497 0.14
NP_440289.1_2 Reverse -351 -364 14.6706 0.0107
NP_440289.1_2 Forward -366 -353 -3.52063 0.267
NP_440983.1_9 Reverse -303 -322 3.44104 0.285
NP_442281.1_1 Reverse -349 -363 20.7467 0.00192
NP_442281.1_1 Forward -368 -354 4.52221 0.192
NP_441087.1_6 Forward -126 -108 7.19654 0.233
NP_441556.1_4 Forward -375 -356 12.9937 0.201
NP_440498.1_1 Forward -372 -354 13.6872 0.0445
NP_440375.1_8 Reverse -355 -374 9.53756 0.138
NP_441644.1_6 Forward -363 -353 10.1076 0.0628
NP_441644.1_6 Reverse -354 -364 10.1076 0.0628
NP_441644.1_6 Forward -111 -101 6.27276 0.163
NP_441644.1_6 Forward -185 -175 4.50281 0.235
NP_442215.1_2 Forward -365 -349 -1.71142 0.187
NP_440253.1_2 Forward -363 -345 17.1287 0.0115
NP_440929.1_8 Forward -363 -354 19.2726 0.000701
NP_440929.1_8 Reverse -354 -363 19.2726 0.000701
NP_442933.1_10 Forward -363 -354 17.601 0.00325
NP_442933.1_10 Reverse -354 -363 17.601 0.00325
NP_442933.1_10 Reverse -44 -53 4.81794 0.212
NP_442933.1_10 Forward -53 -44 4.12963 0.28
NP_441751.2_8 Forward -362 -348 -2.55701 0.132
NP_442554.1_8 Forward -362 -352 13.8447 0.0145
NP_442554.1_8 Reverse -355 -365 13.2547 0.0187
NP_442554.1_8 Forward -184 -174 3.02829 0.245
NP_442554.1_8 Forward -215 -205 2.63497 0.265
NP_441762.1_7 Reverse -353 -365 19.3118 0.00342
NP_441762.1_7 Forward -364 -352 12.0354 0.0142
NP_441762.1_7 Forward -340 -328 -6.45087 0.284
NP_442142.1_4 Reverse -351 -364 18.4065 0.0255
NP_442142.1_4 Forward -366 -353 7.2952 0.143
NP_442292.1_1 Forward -362 -353 9.63616 0.0183
NP_442292.1_1 Reverse -355 -364 9.63616 0.0183
NP_441525.1_1 Reverse -172 -185 11.6223 0.291
NP_442476.1_6 Reverse -355 -369 2.35953 0.186
NP_442381.1_8 Reverse -351 -370 -14.3569 0.28
NP_442381.1_8 Forward -366 -347 -14.3569 0.28
NP_443009.1_5 Reverse -353 -364 11.6612 0.0602
NP_443009.1_5 Forward -364 -353 11.6612 0.0602
NP_442408.2_1 Forward -363 -344 -3.83545 0.25
NP_441715.1_4 Forward -362 -352 16.303 0.0117
NP_441715.1_4 Reverse -355 -365 9.41981 0.097
NP_441715.1_4 Forward -62 -52 4.69992 0.254
NP_440357.1_3 Reverse -114 -133 -0.590531 0.296
NP_440183.1_9 Reverse -308 -327 -12.7836 0.26
NP_441468.1_1 Forward -362 -355 15.8704 0.0124
NP_441468.1_1 Reverse -355 -362 15.8704 0.0124
NP_441468.1_1 Reverse -45 -52 4.07068 0.263
NP_441618.1_7 Reverse -172 -191 12.626 0.295
NP_441020.2_6 Forward -365 -348 17.7384 0.0169
NP_441020.2_6 Reverse -352 -369 11.7402 0.112
NP_441020.2_6 Forward -63 -46 8.7903 0.188
NP_441673.1_1 Forward -363 -354 20.8459 0.000698
NP_441673.1_1 Reverse -354 -363 20.8459 0.000698
NP_441826.1_2 Reverse -348 -362 1.27789 0.157
NP_441826.1_2 Forward -369 -355 -1.18038 0.238
NP_442490.1_9 Forward -191 -172 -6.39206 0.273
NP_442868.1_6 Reverse -115 -125 5.09324 0.158
NP_442868.1_6 Reverse -352 -362 0.963343 0.205
NP_442868.1_6 Forward -365 -355 0.865012 0.205
NP_442719.1_2 Forward -126 -108 -11.8796 0.297
NP_442227.1_4 Forward -260 -241 10.52 0.287
NP_442361.1_3 Reverse -348 -361 7.88576 0.285
NP_441944.1_3 Reverse -218 -237 14.0608 0.149
NP_442808.1_1 Forward -364 -354 18.4657 0.00201
NP_442808.1_1 Reverse -353 -363 18.4657 0.00201
NP_442808.1_1 Forward -322 -312 5.19112 0.168
NP_440145.1_3 Reverse -107 -126 -6.1954 0.292
NP_442113.1_10 Reverse -350 -369 -8.752 0.289
NP_442050.1_5 Reverse -352 -362 9.12434 0.193
NP_440038.1_8 Forward -369 -350 15.3382 0.238
NP_440558.1_2 Forward -129 -110 -0.787193 0.204
NP_440558.1_2 Reverse -107 -126 -5.01543 0.251
NP_440558.1_2 Reverse -318 -337 -6.09707 0.271
NP_440558.1_2 Forward -334 -315 -7.67036 0.298
NP_441518.1_3 Reverse -344 -363 -12.7836 0.263
NP_441878.1_6 Forward -364 -354 10.4031 0.0176
NP_441878.1_6 Reverse -353 -363 10.4031 0.0176
NP_441036.1_8 Forward -364 -354 17.7779 0.000554
NP_441036.1_8 Reverse -353 -363 17.7779 0.000554
NP_442650.1_2 Reverse -111 -125 3.04785 0.225
NP_441557.1_5 Forward -363 -354 19.9609 0.000699
NP_441557.1_5 Reverse -354 -363 19.9609 0.000699
NP_441445.1_1 Forward -397 -378 12.8808 0.0621
NP_441445.1_1 Reverse -345 -364 7.86593 0.124
NP_441433.1_8 Reverse -97 -116 -2.75381 0.27
NP_442956.1_1 Forward -37 -18 11.9958 0.238
NP_441308.1_8 Reverse -352 -362 10.1081 0.22
NP_442192.1_7 Reverse -360 -378 13.8838 0.299
NP_442183.1_1 Forward -363 -349 19.4691 0.00583
NP_440190.1_5 Forward -373 -355 17.0304 0.254
NP_440979.1_3 Reverse -355 -373 11.6222 0.234
NP_441574.1_1 Forward -228 -209 -5.40875 0.26
NP_441574.1_1 Forward -197 -178 -7.76869 0.293
NP_442347.1_2 Forward -362 -353 11.1111 0.056
NP_442347.1_2 Reverse -355 -364 11.1111 0.056
NP_442645.1_2 Forward -371 -352 -11.8986 0.144
NP_441037.1_4 Forward -365 -355 14.7245 0.028
NP_441037.1_4 Reverse -352 -362 7.02532 0.237
NP_441633.1_3 Forward -365 -352 10.7374 0.0286
NP_441633.1_3 Reverse -352 -365 3.65753 0.0699
NP_441633.1_3 Forward -300 -287 -7.06055 0.288
NP_440136.1_2 Forward -362 -355 15.9687 0.0123
NP_440136.1_2 Reverse -355 -362 15.9687 0.0123
NP_442998.1_10 Forward -361 -354 15.5754 0.0102
NP_442998.1_10 Reverse -356 -363 15.5754 0.0102
NP_440899.1_8 Reverse -86 -105 -9.63698 0.267
NP_440299.1_1 Forward -367 -354 14.08 0.0259
NP_440299.1_1 Forward -124 -111 3.16532 0.256
NP_440299.1_1 Reverse -350 -363 2.28034 0.292
NP_441799.1_1 Forward -367 -353 19.8618 0.00596
NP_441799.1_1 Reverse -350 -364 11.307 0.0591
NP_442333.2_5 Reverse -221 -240 -6.98204 0.227
NP_440256.1_1 Forward -366 -347 3.24438 0.0553
NP_440256.1_1 Reverse -351 -370 -2.75381 0.122
NP_441957.1_7 Forward -320 -301 13.8641 0.25
NP_441559.1_8 Forward -368 -354 0.196253 0.169
NP_441559.1_8 Forward -303 -289 -5.01529 0.245
NP_441559.1_8 Forward -335 -321 -7.37523 0.291
NP_440915.1_6 Reverse -350 -364 -3.147 0.29
NP_441296.1_6 Forward -385 -366 7.47261 0.299
NP_440717.1_2 Forward -78 -59 -10.9153 0.259
NP_442785.1_7 Reverse -352 -366 10.0294 0.231
NP_441866.1_4 Reverse -86 -99 11.9805 0.299
NP_442866.1_1 Forward -368 -349 -6.39206 0.255
NP_441464.1_8 Reverse -354 -368 4.52282 0.269
NP_441464.1_10 Forward -230 -216 12.1926 0.201
NP_441939.1_3 Reverse -355 -374 6.58763 0.231
NP_442993.1_1 Forward -363 -347 1.73016 0.0502
NP_442386.1_9 Reverse -353 -362 15.7322 0.0144
NP_442386.1_9 Forward -364 -355 15.7322 0.0144
NP_441340.1_5 Forward -362 -355 15.6737 0.0124
NP_441340.1_5 Reverse -355 -362 15.6737 0.0124
NP_441340.1_5 Forward -52 -45 3.97235 0.274
NP_442791.1_5 Forward -371 -352 -8.45701 0.279
NP_442240.1_1 Forward -127 -108 6.48849 0.256
NP_442240.1_2 Forward -320 -301 -20.1584 0.295
NP_440161.1_3 Forward -365 -346 11.8975 0.196
NP_442714.1_5 Reverse -118 -137 5.01433 0.238
NP_440586.1_1 Reverse -107 -126 -2.36049 0.251
NP_440586.1_8 Forward -362 -355 13.2151 0.026
NP_440586.1_8 Reverse -355 -362 13.2151 0.026
NP_440586.1_8 Forward -52 -45 9.57686 0.146
NP_440586.1_8 Forward -184 -177 5.8403 0.283
NP_442251.1_6 Forward -362 -355 15.2804 0.0124
NP_442251.1_6 Reverse -355 -362 15.2804 0.0124
NP_442959.1_8 Reverse -306 -325 13.9214 0.294
NP_440684.1_9 Reverse -348 -362 8.94771 0.221
NP_440684.1_9 Forward -369 -355 8.55439 0.226
NP_441262.1_1 Forward -330 -312 17.4237 0.199
NP_441262.1_3 Reverse -354 -361 14.7888 0.0223
NP_441262.1_3 Forward -363 -356 14.7888 0.0223
NP_443051.1_1 Reverse -353 -362 10.4228 0.00754
NP_443051.1_1 Forward -364 -355 10.4228 0.00754
NP_443038.1_1 Reverse -29 -48 4.22769 0.22
NP_439937.1_8 Forward -338 -319 -3.83545 0.273
NP_439937.1_9 Reverse -353 -370 -8.41828 0.176
NP_440626.1_1 Reverse -355 -374 10.2251 0.247
NP_440439.1_1 Forward -366 -353 10.8357 0.0339
NP_440439.1_1 Reverse -351 -364 8.37742 0.0537
NP_440372.1_2 Forward -362 -355 16.3621 0.0124
NP_440372.1_2 Reverse -355 -362 16.3621 0.0124
NP_440819.1_5 Reverse -298 -306 7.8859 0.266
NP_440316.1_10 Forward -229 -219 6.76487 0.253
NP_440139.1_1 Reverse -348 -367 6.29183 0.143
NP_440139.1_1 Forward -369 -350 4.91521 0.17
NP_441572.1_1 Forward -365 -346 -1.18052 0.212
NP_441572.1_7 Reverse -348 -367 -2.36049 0.193
NP_440267.1_2 Reverse -349 -363 9.43874 0.156
NP_442384.1_10 Reverse -354 -367 16.3422 0.00854
NP_440364.1_2 Forward -125 -106 13.8369 0.288
NP_440364.1_6 Forward -200 -187 13.195 0.29
NP_441877.1_5 Forward -266 -247 5.50599 0.195
NP_441018.1_3 Forward -136 -117 11.995 0.286
NP_442262.1_10 Forward -362 -355 14.1988 0.0123
NP_442262.1_10 Reverse -355 -362 14.1988 0.0123
NP_442262.1_10 Forward -110 -103 8.8889 0.219
NP_441689.1_5 Reverse -352 -362 8.53436 0.132
NP_440163.1_10 Reverse -351 -361 15.2213 0.0762
NP_440344.1_10 Reverse -347 -364 16.9518 0.00338
NP_440344.1_10 Forward -370 -353 -3.20608 0.0802
NP_440075.1_2 Reverse -98 -117 10.8159 0.188
NP_440531.1_6 Reverse -36 -55 -2.85214 0.258
NP_442123.1_3 Forward -363 -344 11.1109 0.258
NP_440562.1_1 Reverse -293 -312 10.2251 0.296
NP_440562.1_5 Forward -149 -130 4.52268 0.261
NP_441965.1_10 Reverse -351 -367 7.2367 0.151
NP_441640.1_8 Forward -81 -62 -1.18052 0.208
NP_440297.1_9 Forward -362 -352 9.32148 0.0917
NP_440297.1_9 Reverse -355 -365 -0.118297 0.282
NP_440650.1_6 Reverse -294 -313 11.2092 0.207
NP_443036.1_3 Forward -124 -107 12.2319 0.299
NP_442067.1_4 Forward -196 -177 3.04771 0.289
NP_440888.1_2 Forward -363 -349 14.5519 0.0168
NP_440888.1_2 Reverse -354 -368 8.3571 0.163
NP_440600.1_4 Reverse -36 -54 4.54237 0.112
NP_441949.1_2 Forward -373 -354 5.89931 0.261
NP_441543.1_2 Forward -362 -353 18.486 0.00236
NP_441543.1_2 Reverse -355 -364 18.486 0.00236
NP_441469.1_8 Reverse -353 -362 16.126 0.00797
NP_441469.1_8 Forward -364 -355 16.126 0.00797
NP_441469.1_8 Reverse -110 -119 5.99792 0.241
NP_442578.1_7 Forward -362 -355 14.5921 0.026
NP_442578.1_7 Reverse -355 -362 14.5921 0.026
NP_440220.1_4 Forward -147 -128 -1.96793 0.265
NP_441462.1_2 Forward -363 -353 11.5831 0.00406
NP_441462.1_2 Reverse -354 -364 11.5831 0.00406
NP_441621.1_3 Reverse -174 -192 12.1139 0.254
NP_441621.1_7 Reverse -352 -366 -3.63866 0.192
NP_441621.1_7 Forward -365 -351 -3.83532 0.195
NP_443062.1_1 Forward -363 -345 8.2534 0.157
NP_443062.1_1 Reverse -354 -372 7.76586 0.168
NP_443062.1_6 Forward -371 -352 17.5024 0.0578
NP_443062.1_6 Reverse -346 -365 3.34271 0.239
NP_441410.1_3 Reverse -345 -364 9.93088 0.191
NP_442204.1_5 Reverse -344 -363 4.71934 0.165
NP_440516.1_8 Forward -363 -354 16.9127 0.00442
NP_440516.1_8 Reverse -354 -363 16.9127 0.00442
NP_441785.1_1 Forward -363 -349 14.3866 0.161
NP_441033.1_2 Reverse -344 -363 2.55606 0.135
NP_442428.1_5 Forward -362 -355 15.8704 0.0124
NP_442428.1_5 Reverse -355 -362 15.8704 0.0124
NP_442428.1_5 Reverse -45 -52 4.46401 0.267
NP_441443.1_1 Reverse -285 -304 -2.75381 0.271
NP_442120.1_10 Reverse -111 -130 -11.8003 0.265
NP_440673.1_2 Forward -277 -258 9.90183 0.228
NP_440673.1_3 Forward -361 -354 12.4288 0.0426
NP_440673.1_3 Reverse -356 -363 12.4288 0.0426
NP_440673.1_3 Reverse -332 -339 10.4622 0.139
NP_440673.1_3 Forward -124 -117 6.23397 0.283
NP_440673.1_3 Forward -80 -73 5.54565 0.288
NP_441714.1_3 Forward -370 -352 13.1947 0.248
NP_441052.1_2 Forward -363 -353 10.5014 0.0285
NP_441052.1_2 Reverse -354 -364 10.5014 0.0285
NP_442219.1_8 Forward -130 -111 7.29741 0.271
NP_442219.1_9 Forward -362 -353 8.35786 0.0681
NP_442219.1_9 Reverse -355 -364 8.35786 0.0681
NP_440592.1_2 Forward -375 -356 4.916 0.177
NP_440436.1_4 Forward -362 -353 18.1905 0.00233
NP_440436.1_4 Reverse -355 -364 18.1905 0.00233
NP_440436.1_4 Forward -52 -43 9.73406 0.0871
NP_441884.1_8 Reverse -353 -372 -10.7186 0.268
NP_441884.1_9 Reverse -351 -370 -14.0619 0.138
NP_441719.1_4 Forward -362 -355 16.3621 0.0124
NP_441719.1_4 Reverse -355 -362 16.3621 0.0124
NP_441733.1_10 Reverse -351 -364 10.2457 0.106
NP_441004.1_2 Reverse -106 -125 -0.688862 0.259
NP_442366.1_3 Forward -364 -346 24.5036 0.00586
NP_442366.1_3 Reverse -353 -371 -1.06249 0.204
NP_442366.1_5 Forward -366 -356 15.2208 0.0375
NP_440129.1_10 Reverse -347 -361 13.2743 0.0557
NP_442206.1_1 Forward -120 -101 -11.6036 0.22
NP_443054.1_2 Reverse -352 -366 11.2093 0.0761
NP_443054.1_2 Forward -365 -351 3.53951 0.24
NP_442308.1_4 Reverse -348 -367 -0.590531 0.295
NP_441851.1_10 Forward -364 -354 16.008 0.00552
NP_441851.1_10 Reverse -353 -363 16.008 0.00552
NP_442515.1_1 Reverse -116 -130 9.14437 0.066
NP_441046.1_2 Reverse -310 -329 -1.86883 0.292
NP_442689.1_8 Reverse -87 -104 -3.5994 0.251
NP_440940.1_7 Reverse -344 -362 7.29487 0.205
NP_440940.1_7 Forward -373 -355 6.01657 0.225
NP_441349.1_10 Reverse -344 -363 1.17943 0.0845
NP_440432.1_9 Forward -362 -347 0.471552 0.159
NP_442843.1_1 Reverse -103 -122 0.196116 0.17
NP_440474.1_8 Forward -362 -348 14.7486 0.0595
NP_440474.1_8 Reverse -355 -369 5.99717 0.235
NP_442450.1_5 Reverse -352 -362 9.32148 0.115
NP_442450.1_5 Forward -365 -355 7.55152 0.13
NP_440588.1_2 Forward -372 -353 0.982764 0.141
NP_440195.1_5 Forward -337 -318 2.0644 0.276
NP_442006.1_2 Reverse -102 -119 -8.71262 0.197
NP_441570.1_1 Reverse -354 -372 -6.96235 0.0829
NP_441570.1_1 Forward -363 -345 -9.32229 0.134
NP_441078.1_4 Forward -363 -354 19.6659 0.0007
NP_441078.1_4 Reverse -354 -363 19.6659 0.0007
NP_440539.1_9 Forward -256 -237 -5.99873 0.286
NP_442443.1_1 Forward -338 -319 2.94938 0.177
NP_442443.1_1 Forward -304 -285 -6.78538 0.298
NP_440526.1_3 Forward -362 -351 1.92649 0.267
NP_440526.1_3 Forward -125 -114 0.746521 0.271
NP_441432.1_8 Reverse -353 -362 8.25953 0.0755
NP_441432.1_8 Forward -364 -355 8.25953 0.0755
NP_441432.1_8 Reverse -116 -125 5.50626 0.151
NP_441432.1_8 Forward -331 -322 2.55633 0.298
NP_443024.1_3 Forward -333 -323 17.4829 0.251
NP_442320.1_8 Reverse -348 -362 12.8809 0.016
NP_441732.1_2 Reverse -350 -366 -16.1661 0.165
NP_441732.1_2 Forward -367 -351 -17.346 0.253
NP_441732.1_2 Forward -67 -51 -17.7394 0.292
NP_440199.1_10 Reverse -351 -361 14.533 0.0861
NP_441057.1_4 Forward -135 -117 -3.42244 0.29
NP_442400.1_1 Forward -366 -347 -3.54046 0.243
NP_442489.1_7 Forward -363 -354 20.1576 0.000695
NP_442489.1_7 Reverse -354 -363 20.1576 0.000695
NP_440386.1_6 Forward -192 -173 12.585 0.0835
NP_440559.1_1 Reverse -355 -364 8.75118 0.0586
NP_440559.1_1 Forward -362 -353 8.75118 0.0586
NP_440559.1_1 Reverse -45 -54 4.52295 0.26
NP_441659.2_8 Forward -363 -353 11.9764 0.0147
NP_441659.2_8 Reverse -354 -364 11.9764 0.0147
NP_441659.2_8 Forward -53 -43 0.865012 0.256
NP_440860.1_8 Forward -310 -291 16.2241 0.209
NP_442913.1_10 Reverse -363 -382 3.24438 0.112
NP_441040.1_2 Forward -127 -108 -14.2585 0.285
NP_441040.1_2 Forward -134 -115 -16.2252 0.294
NP_440779.1_5 Forward -363 -346 3.28376 0.0808
NP_442346.1_5 Forward -54 -44 11.4848 0.0663
NP_442346.1_5 Forward -364 -354 9.02648 0.118
NP_442346.1_5 Reverse -353 -363 9.02648 0.118
NP_442346.1_5 Reverse -116 -126 8.04317 0.149
NP_442346.1_10 Forward -122 -103 -2.45882 0.294
NP_440545.1_3 Forward -124 -107 -1.43612 0.168
NP_440545.1_3 Forward -367 -350 -3.79607 0.212
NP_440025.1_1 Forward -367 -348 12.0942 0.147
NP_440025.1_3 Reverse -318 -332 10.9012 0.29
NP_441629.1_1 Forward -371 -352 8.35759 0.235
NP_440004.1_5 Reverse -349 -368 22.2223 0.0502
NP_441653.1_2 Forward -342 -323 2.37001 0.294
NP_442551.1_4 Reverse -108 -123 -3.65835 0.292
NP_440847.1_3 Reverse -323 -337 17.2068 0.115
NP_440847.1_3 Forward -118 -104 16.9119 0.115
NP_441888.1_7 Forward -368 -354 3.8345 0.225
NP_441888.1_7 Reverse -349 -363 2.35953 0.225
NP_441948.1_4 Reverse -347 -365 6.60732 0.0633
NP_441948.1_4 Forward -370 -352 2.57575 0.122
NP_441833.1_4 Forward -362 -355 15.9687 0.0124
NP_441833.1_4 Reverse -355 -362 15.9687 0.0124
NP_442162.1_9 Forward -362 -355 16.2637 0.0124
NP_442162.1_9 Reverse -355 -362 16.2637 0.0124
NP_440671.1_4 Reverse -348 -362 8.55439 0.195
NP_440772.1_8 Reverse -348 -367 7.07928 0.296
NP_442045.1_4 Reverse -313 -326 21.6521 0.156
NP_442546.1_4 Reverse -104 -122 11.4255 0.227
NP_442199.1_5 Reverse -346 -365 7.37428 0.0719
NP_442140.1_3 Reverse -355 -365 16.2046 0.0255
NP_442140.1_3 Forward -362 -352 8.33817 0.119
NP_442140.1_3 Forward -184 -174 8.23984 0.122
NP_442140.1_3 Forward -52 -42 6.66654 0.159
NP_442140.1_3 Reverse -177 -187 3.71661 0.283
NP_441609.1_1 Reverse -238 -257 9.73422 0.117
NP_441671.1_10 Forward -326 -307 3.04771 0.238
NP_440875.1_9 Forward -361 -351 8.37203 0.233
NP_441813.1_3 Reverse -288 -307 14.6251 0.242
NP_441813.1_5 Reverse -352 -362 17.188 0.00979
NP_441813.1_5 Forward -365 -355 9.91146 0.021
NP_441813.1_7 Forward -381 -367 9.14375 0.262
NP_440590.1_4 Reverse -355 -368 3.26421 0.0749
NP_440590.1_4 Forward -362 -349 -3.81562 0.255
NP_440567.1_1 Reverse -355 -369 16.9125 0.0164
NP_440567.1_1 Forward -362 -348 5.80112 0.0959
NP_442497.1_10 Forward -362 -353 10.4228 0.0087
NP_442497.1_10 Reverse -355 -364 10.4228 0.0087
NP_440821.1_4 Reverse -352 -362 19.0562 0.00399
NP_440821.1_4 Forward -365 -355 10.2065 0.0163
NP_441239.1_9 Reverse -352 -364 15.8703 0.0178
NP_441239.1_9 Forward -365 -353 14.887 0.0247
NP_441239.1_9 Reverse -217 -229 3.77555 0.276
NP_441892.1_1 Reverse -345 -362 -2.91109 0.23
NP_441874.1_1 Reverse -99 -113 11.701 0.24
NP_440212.1_5 Forward -137 -118 13.6675 0.273
NP_442138.1_10 Forward -363 -344 -7.27704 0.286
NP_440546.1_4 Forward -363 -353 11.8882 0.0679
NP_440546.1_4 Reverse -354 -364 11.8882 0.0679
NP_440546.1_4 Forward -53 -43 8.78555 0.171
NP_440675.1_3 Reverse -354 -373 18.584 0.0975
NP_440462.1_6 Reverse -352 -362 15.418 0.0142
NP_440462.1_6 Forward -365 -355 9.02648 0.0498
NP_442340.1_3 Forward -192 -173 1.57275 0.144
NP_442340.1_3 Forward -80 -61 -6.49039 0.223
NP_440868.1_4 Forward -367 -355 18.3285 0.0124
NP_440868.1_4 Reverse -350 -362 8.49544 0.0602
NP_442479.1_9 Forward -332 -313 -6.1954 0.266
NP_441582.1_5 Reverse -352 -371 11.0117 0.154
NP_441474.1_4 Forward -246 -227 18.289 0.198
NP_442840.1_7 Reverse -299 -318 7.47261 0.204
NP_440341.1_7 Forward -263 -249 15.6342 0.2
NP_442402.1_4 Forward -270 -251 -4.62285 0.228
NP_442039.1_4 Forward -362 -355 15.1821 0.0124
NP_442039.1_4 Reverse -355 -362 15.1821 0.0124
NP_442039.1_7 Reverse -178 -188 13.1564 0.212
NP_442039.1_7 Reverse -104 -114 10.0098 0.257
NP_441811.1_8 Forward -15 -1 10.0294 0.22
NP_442679.1_1 Reverse -184 -203 -5.21209 0.29
NP_440825.1_7 Reverse -355 -365 12.4217 0.155
NP_442837.1_3 Forward -362 -355 15.7721 0.0124
NP_442837.1_3 Reverse -355 -362 15.7721 0.0124
NP_442053.1_1 Forward -363 -354 18.3876 0.0007
NP_442053.1_1 Reverse -354 -363 18.3876 0.0007
NP_440505.1_3 Reverse -352 -362 13.8447 0.0247
NP_440505.1_3 Forward -365 -355 6.76487 0.169
NP_441203.1_1 Forward -362 -343 -20.65 0.298
NP_440914.1_1 Forward -363 -353 8.6151 0.186
NP_440914.1_1 Reverse -354 -364 8.6151 0.186
NP_441011.1_8 Forward -362 -353 16.9127 0.00602
NP_441011.1_8 Reverse -355 -364 16.9127 0.00602
NP_442533.1_6 Forward -363 -354 17.2076 0.00137
NP_442533.1_6 Reverse -354 -363 17.2076 0.00137
NP_442541.1_10 Forward -126 -112 3.34225 0.254
NP_442229.1_1 Forward -365 -351 10.8154 0.18
NP_441482.1_7 Reverse -348 -362 -10.9151 0.222
NP_439944.1_9 Forward -362 -352 10.3048 0.0887
NP_440816.1_7 Reverse -350 -369 9.53756 0.252
NP_441028.1_6 Forward -292 -282 9.02601 0.216
NP_441527.1_7 Reverse -49 -68 9.83173 0.282
NP_439965.1_1 Reverse -345 -364 -6.98204 0.218
NP_441059.1_2 Reverse -98 -117 -5.01543 0.245
NP_440608.1_1 Forward -107 -88 12.3342 0.182
NP_441106.1_1 Reverse -353 -362 18.191 0.0028
NP_441106.1_1 Forward -364 -355 18.191 0.0028
NP_441106.1_1 Reverse -43 -52 2.26134 0.293
NP_442306.1_10 Forward -368 -349 -20.8467 0.231
NP_441286.1_1 Forward -364 -352 4.95553 0.027
NP_441286.1_1 Reverse -353 -365 -3.50094 0.145
NP_440670.1_8 Forward -363 -354 18.3876 0.000699
NP_440670.1_8 Reverse -354 -363 18.3876 0.000699
NP_440886.1_7 Forward -364 -354 17.7774 0.0011
NP_440886.1_7 Reverse -353 -363 17.7774 0.0011
NP_440828.1_4 Forward -127 -108 6.29183 0.124
NP_442382.1_9 Forward -124 -105 7.66846 0.29
NP_442072.1_9 Reverse -353 -371 -12.7639 0.091
NP_441753.1_10 Forward -372 -353 16.2241 0.0654
NP_440907.2_8 Reverse -355 -365 14.2375 0.0312
NP_440907.2_8 Forward -362 -352 7.84605 0.117
NP_441021.1_8 Forward -368 -350 20.5703 0.0592
NP_441021.1_8 Reverse -349 -367 10.4422 0.125
NP_441463.1_3 Forward -373 -354 9.3409 0.0481
NP_441463.1_3 Reverse -344 -363 1.86774 0.123
NP_441626.1_2 Forward -362 -355 15.7721 0.0124
NP_441626.1_2 Reverse -355 -362 15.7721 0.0124
NP_442615.1_1 Reverse -345 -363 -1.35749 0.128
NP_442615.1_1 Forward -372 -354 -6.07737 0.233
NP_441962.1_4 Reverse -112 -131 7.7676 0.0686
NP_441962.1_4 Reverse -68 -87 -4.13045 0.156
NP_441962.1_4 Forward -125 -106 -8.16202 0.196
NP_440387.1_1 Reverse -354 -370 23.8546 0.00136
NP_440387.1_1 Forward -363 -347 -1.12144 0.142
NP_441431.1_2 Reverse -351 -365 9.93039 0.172
NP_441431.1_2 Forward -366 -352 7.86545 0.231
NP_441836.1_10 Forward -333 -314 7.66927 0.213
NP_440814.1_8 Forward -64 -45 -0.295539 0.277
NP_440114.1_10 Forward -363 -349 15.7325 0.0234
NP_440114.1_10 Reverse -354 -368 11.996 0.0955
NP_442437.1_9 Reverse -49 -63 18.5841 0.268
NP_441510.2_7 Reverse -348 -362 12.3887 0.28
NP_440287.1_6 Reverse -352 -371 5.60432 0.181
NP_441720.1_2 Reverse -350 -369 4.52188 0.231
NP_440293.1_3 Forward -317 -298 1.37609 0.207
NP_440766.1_4 Reverse -350 -364 8.35772 0.0871
NP_439988.1_7 Reverse -356 -370 13.8636 0.292
NP_442635.1_9 Reverse -49 -68 13.2486 0.262
NP_439910.1_2 Reverse -346 -363 -11.8592 0.0788
NP_439910.1_2 Forward -371 -354 -21.2006 0.183
NP_440457.1_1 Forward -367 -355 2.69391 0.205
NP_440457.1_1 Reverse -350 -362 0.0389777 0.25
NP_440798.1_6 Reverse -355 -368 14.2773 0.0423
NP_441981.1_3 Reverse -287 -301 18.008 0.268
NP_440942.1_9 Reverse -236 -255 8.65176 0.211
NP_441984.1_3 Forward -374 -356 7.29564 0.253
NP_440054.1_4 Reverse -346 -365 21.4356 0.118
NP_442509.1_9 Forward -363 -353 16.2041 0.00739
NP_442509.1_9 Reverse -354 -364 16.2041 0.00739
NP_442514.1_5 Forward -119 -100 -6.19614 0.264
NP_441159.1_2 Reverse -51 -70 4.42435 0.223
NP_440554.1_4 Forward -362 -352 14.6313 0.02
NP_440554.1_4 Reverse -355 -365 7.35486 0.103
NP_442862.1_3 Reverse -86 -103 5.9387 0.267
NP_442737.1_5 Forward -54 -35 13.1698 0.239
NP_441885.1_5 Forward -363 -353 11.4848 0.00668
NP_441885.1_5 Reverse -354 -364 11.4848 0.00668
NP_441885.1_5 Reverse -29 -39 -1.59326 0.273
NP_440478.1_10 Reverse -328 -342 6.19444 0.294
NP_441428.1_8 Reverse -177 -196 4.62101 0.237
NP_442310.1_1 Reverse -46 -65 10.3242 0.284
NP_442341.1_7 Forward -364 -350 10.0294 0.0682
NP_442341.1_7 Reverse -353 -367 9.63603 0.0726
NP_442341.1_7 Reverse -378 -392 1.86788 0.278
NP_442341.1_9 Forward -365 -351 7.76712 0.187
NP_442341.1_9 Reverse -352 -366 5.1122 0.279
NP_440750.1_5 Reverse -134 -148 8.65272 0.212
NP_443000.1_7 Reverse -352 -362 8.73149 0.0437
NP_443000.1_7 Forward -365 -355 1.94665 0.226
NP_440507.2_3 Reverse -345 -364 7.07848 0.29
NP_441842.1_10 Reverse -347 -361 15.0442 0.0474
NP_441842.1_10 Forward -370 -356 9.2427 0.195
NP_440275.1_3 Reverse -352 -362 8.4365 0.0602
NP_440275.1_3 Forward -365 -355 8.33817 0.0602
NP_442932.1_9 Forward -336 -317 16.4207 0.14
NP_440560.1_7 Reverse -81 -100 4.22689 0.292
NP_440091.1_1 Reverse -350 -362 18.3285 0.0114
NP_440091.1_1 Forward -367 -355 10.1671 0.0498
NP_441902.1_3 Reverse -196 -206 11.8156 0.288
NP_443010.1_10 Reverse -351 -368 5.3799 0.205
NP_441122.1_1 Reverse -98 -113 4.20813 0.28
NP_440149.1_8 Forward -363 -344 -5.70374 0.231
NP_441105.1_3 Forward -252 -233 -7.76869 0.259
NP_441105.1_3 Reverse -343 -362 -8.45701 0.272
NP_440216.1_1 Reverse -354 -368 7.9644 0.00737
NP_440216.1_1 Forward -363 -349 6.29277 0.0156
NP_440216.1_9 Forward -109 -100 15.0444 0.161
NP_440216.1_9 Reverse -74 -83 10.0295 0.286
NP_440216.1_9 Reverse -127 -136 6.98123 0.289
NP_440172.1_1 Forward -363 -353 8.73149 0.0586
NP_440172.1_1 Reverse -354 -364 8.73149 0.0586
NP_440167.1_3 Reverse -107 -126 15.1424 0.15
NP_442015.1_10 Forward -367 -354 10.8357 0.0391
NP_442015.1_10 Reverse -350 -363 0.904263 0.216
NP_441226.1_7 Forward -362 -355 14.4934 0.0123
NP_441226.1_7 Reverse -355 -362 14.4934 0.0123
NP_441111.1_7 Forward -362 -354 18.7023 0.00294
NP_441111.1_7 Reverse -355 -363 18.7023 0.00294
NP_442379.1_10 Forward -370 -353 -2.12444 0.224
NP_441766.1_2 Forward -363 -354 17.5026 0.00297
NP_441766.1_2 Reverse -354 -363 17.5026 0.00297
NP_442252.1_3 Reverse -347 -365 18.2104 0.0602
NP_440416.1_9 Reverse -347 -366 -4.52377 0.0776
NP_440416.1_9 Forward -370 -351 -16.7168 0.22
NP_443052.1_8 Reverse -344 -363 5.80098 0.0348
NP_443052.1_8 Forward -373 -354 2.45773 0.0551
NP_442046.1_2 Reverse -80 -93 16.0076 0.211
NP_440261.1_5 Reverse -355 -368 -12.0754 0.27
NP_440988.1_10 Reverse -115 -129 8.77134 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGAGCACTAAACGCTGATTGGCCTGCATCAACAGGTCGGCGATCGCCGTTTTGAATCTTAGAGCGACGGAGGAATTGGCCAAGAAAGCCTGGGCTTGTTCCCGGTATTCTGCCCCCTGTAACGTTTCTGCTTGGTCTAGGGTTTCCAAAGCTTGGCAGAGGTCATTAATCTGGGCGGTGTGGTCAGACATGGTCTTATTTCTCCAATGCTGTTTCCGCCATGGTAACCCAGCTAACTAAAAACAGAACCTTGCTTCATGAAACTTTTGCCTTGTTGCCGTTGCCACTTCCCCCATTGCAAAGCTAAGCAAAAAATAGTTTTCGTTGCTACCGAACAAGGCGAGAACTAGCCATCGTTAAAATGGGGTAAGCCGAGATTCTAACCAGGAGGTGTTGATTCC

CDS

GTGTCCGGTAAAAAAAATGATTACGATGCTCTCTTAGCAGATTTCACCGATCGGGAAGGGGCGATCGCCCTACTGCGCCAACATCGACCCTACCTAGAAAAGCTACCCAGTTTGCGGCGGCCAGAACGAAGCATTATCACCATCCCCCTGCCCATTGTCCGTTTGCGCCATCTTCCCCTCAACGATGCTGACCAAGGGGGCCGACAAACCACTCCCTTGGCCAAGGTAATTCCCTGTGACCTGGCAATTTTGATGTGTGACCCAGAATGGCAGGTGAAATTAGGCTCGGAAATTTTGGTCTTTATCCACCGCCCAGAGGAAAACTTTTCTGATCTACTCAGTCGTTGGCGTCGGAGTCAAATTTATCTGGACCAAGACTATGAATGGTTGATGCCCCCCCAGGAAAAACATATGTTTAGTGAAGCGGCGGAGGAAATCTGTCCCCTATTCATTATTTTTGAGCAAACTCCCCACCATATCCAAAAGGGTCTGGCCGGAGCCGGGTTGCCCTTTGTGCTCCACAGTGAAGGCAATTTAACAATGGCGGAAACCCTAGAACTAATTTCTGAATAA

Protein

MSGKKNDYDALLADFTDREGAIALLRQHRPYLEKLPSLRRPERSIITIPLPIVRLRHLPLNDADQGGRQTTPLAKVIPCDLAILMCDPEWQVKLGSEILVFIHRPEENFSDLLSRWRRSQIYLDQDYEWLMPPQEKHMFSEAAEEICPLFIIFEQTPHHIQKGLAGAGLPFVLHSEGNLTMAETLELISE