Your browser is old and dusty. Try Google Chrome!

Details for slr0842

ORF slr0842
Accession NP_442457.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -324 -310 1.76955 0.183
NP_441061.1_2 Forward -82 -68 -2.45868 0.293
NP_440295.1_9 Reverse -127 -146 -3.3438 0.216
NP_441453.1_1 Reverse -66 -84 9.06482 0.175
NP_441960.1_7 Forward -178 -159 9.73422 0.235
NP_441818.1_9 Forward -253 -234 -6.1954 0.26
NP_440150.1_6 Forward -247 -228 2.85105 0.265
NP_442752.1_4 Reverse -4 -11 10.5605 0.1
NP_440110.1_8 Forward -369 -350 -0.983855 0.232
NP_441054.1_2 Reverse -1 -20 21.3373 0.0524
NP_441476.1_3 Reverse -339 -358 17.699 0.083
NP_441900.1_1 Forward -174 -155 12.405 0.222
NP_441859.1_3 Forward -194 -175 6.88182 0.171
NP_441859.1_3 Forward -44 -25 2.6536 0.258
NP_441352.1_2 Forward -258 -239 2.94938 0.222
NP_441208.1_9 Reverse -374 -388 5.50613 0.267
NP_441925.1_4 Reverse -202 -221 -6.88445 0.185
NP_440856.1_7 Reverse -152 -171 -9.73531 0.297
NP_441738.1_2 Reverse -347 -354 6.72528 0.236
NP_440056.1_4 Forward -42 -23 20.6222 0.0685
NP_441713.1_1 Reverse -310 -329 -9.93197 0.188
NP_441713.1_1 Forward -337 -318 -13.3736 0.255
NP_441163.1_1 Reverse -186 -203 7.51126 0.242
NP_442848.1_4 Reverse -94 -108 5.60446 0.288
NP_440376.1_1 Forward -203 -194 0.589713 0.267
NP_442687.1_7 Reverse -192 -202 6.37155 0.171
NP_442687.1_7 Forward -368 -358 3.91327 0.278
NP_442191.1_4 Forward -202 -188 10.7992 0.288
NP_442485.1_2 Forward -164 -145 9.14423 0.288
NP_442485.1_3 Reverse -120 -139 -3.3438 0.273
NP_441013.1_2 Reverse -189 -207 -2.53746 0.282
NP_442770.1_10 Reverse -41 -55 16.9137 0.281
NP_441422.1_3 Reverse -26 -45 15.2899 0.244
NP_440667.1_2 Reverse -1 -20 -7.08038 0.273
NP_442198.1_3 Forward -379 -360 3.83436 0.285
NP_440617.1_10 Forward -83 -64 4.22769 0.27
NP_442782.1_2 Reverse -370 -384 0.0979218 0.296
NP_442544.1_2 Forward -361 -347 -1.27871 0.272
NP_442321.1_4 Reverse -100 -119 -6.1954 0.284
NP_441958.1_1 Reverse -82 -101 13.7963 0.27
NP_440203.1_5 Reverse -238 -248 9.12434 0.271
NP_441338.2_9 Forward -384 -365 4.22769 0.283
NP_440858.1_1 Reverse -70 -89 0.982764 0.212
NP_443055.1_6 Reverse -194 -212 -2.53818 0.296
NP_440993.1_4 Forward -280 -263 8.29864 0.216
NP_440934.1_1 Reverse -263 -282 4.62101 0.25
NP_442002.1_1 Forward -362 -344 -7.06068 0.249
NP_442002.1_9 Reverse -121 -128 12.2322 0.185
NP_441294.1_7 Reverse -318 -332 11.9383 0.12
NP_441294.1_7 Forward -329 -315 9.25063 0.256
NP_441646.1_1 Reverse -338 -357 3.14605 0.208
NP_442438.1_10 Reverse -353 -367 0.491246 0.225
NP_442431.1_10 Forward -256 -238 5.72234 0.197
NP_441398.1_5 Reverse -351 -370 8.55425 0.258
NP_440260.1_8 Reverse -262 -280 5.03403 0.154
NP_440260.1_8 Reverse -142 -160 -5.29072 0.273
NP_441678.1_9 Reverse -131 -150 -5.70374 0.299
NP_440437.1_1 Reverse -326 -345 -4.13045 0.251
NP_442029.1_6 Reverse -12 -31 6.98095 0.231
NP_442029.1_6 Forward -253 -234 4.42435 0.268
NP_442075.1_1 Reverse -350 -369 7.7676 0.264
NP_443009.1_5 Forward -83 -72 6.74468 0.15
NP_440357.1_3 Reverse -150 -169 1.37609 0.275
NP_441448.1_2 Reverse -340 -359 2.45694 0.195
NP_440777.1_8 Forward -268 -249 15.2408 0.182
NP_441015.1_10 Reverse -359 -378 -11.3086 0.294
NP_441244.1_8 Forward -397 -378 2.85105 0.237
NP_441876.1_9 Forward -137 -127 12.0743 0.267
NP_441876.1_9 Reverse -157 -167 11.2876 0.278
NP_441330.1_1 Forward -31 -12 -15.0452 0.259
NP_442719.1_2 Reverse -376 -394 -6.4714 0.225
NP_442719.1_2 Forward -89 -71 -11.6829 0.294
NP_442227.1_2 Reverse -247 -266 0.392778 0.252
NP_440789.1_8 Forward -163 -144 17.0107 0.172
NP_442808.1_1 Reverse -343 -353 3.12618 0.248
NP_442718.1_2 Forward -274 -255 -1.7705 0.266
NP_442542.1_2 Reverse -192 -205 4.64084 0.299
NP_442542.1_9 Reverse -351 -365 9.83206 0.128
NP_442113.1_10 Reverse -205 -224 -9.44032 0.295
NP_442050.1_1 Reverse -351 -370 9.63589 0.247
NP_442342.1_9 Forward -211 -195 2.32015 0.29
NP_441114.1_3 Reverse -346 -355 7.27622 0.247
NP_441878.1_6 Forward -204 -194 -7.68978 0.255
NP_441590.1_4 Reverse -246 -265 2.55527 0.293
NP_442962.1_5 Reverse -4 -23 9.53756 0.191
NP_440738.1_5 Forward -315 -296 0.0977854 0.297
NP_442830.1_5 Reverse -343 -357 6.29216 0.216
NP_442347.1_2 Forward -284 -275 3.93297 0.284
NP_442594.1_8 Forward -256 -237 9.24257 0.199
NP_440256.1_1 Forward -370 -351 -10.0303 0.293
NP_441559.1_8 Reverse -340 -354 -3.44199 0.203
NP_441270.1_5 Forward -367 -348 11.7256 0.273
NP_440915.1_6 Reverse -312 -326 -0.590395 0.202
NP_442866.1_1 Reverse -260 -279 -4.91709 0.237
NP_441417.1_2 Reverse -144 -163 4.62101 0.162
NP_442993.1_1 Reverse -4 -20 -11.0529 0.233
NP_442993.1_1 Reverse -369 -385 -13.9045 0.295
NP_441134.1_6 Reverse -349 -367 8.47483 0.276
NP_440586.1_8 Reverse -18 -25 8.88855 0.205
NP_442959.1_7 Forward -20 -1 -5.50708 0.299
NP_439937.1_9 Forward -32 -15 -5.66502 0.157
NP_439937.1_9 Forward -204 -187 -11.9582 0.269
NP_441789.1_7 Forward -377 -358 0.195343 0.248
NP_440267.1_2 Forward -18 -4 7.27547 0.202
NP_440267.1_2 Forward -154 -140 6.78381 0.221
NP_440267.1_2 Forward -31 -17 4.8172 0.292
NP_441018.1_7 Forward -258 -239 7.17762 0.276
NP_440163.1_10 Reverse -355 -365 13.4514 0.125
NP_441060.1_1 Reverse -1 -20 17.0511 0.168
NP_441060.1_1 Forward -212 -193 11.9863 0.294
NP_442280.1_10 Forward -134 -116 10.8114 0.217
NP_440700.1_8 Reverse -131 -145 17.4042 0.223
NP_440999.1_9 Reverse -244 -258 -2.26202 0.264
NP_440888.1_2 Forward -203 -189 5.30886 0.284
NP_442454.1_2 Reverse -43 -62 9.88299 0.291
NP_442277.1_2 Reverse -151 -165 13.4709 0.222
NP_442315.1_2 Forward -216 -204 9.28209 0.291
NP_443062.1_1 Forward -50 -32 4.93815 0.244
NP_442204.1_5 Forward -251 -232 -0.197208 0.28
NP_440516.1_2 Reverse -339 -357 3.75572 0.145
NP_440673.1_3 Forward -48 -41 9.08556 0.202
NP_441052.1_2 Forward -325 -315 5.87989 0.0998
NP_441052.1_2 Reverse -322 -332 5.78156 0.103
NP_441052.1_2 Reverse -235 -245 1.455 0.244
NP_442219.1_9 Reverse -323 -332 2.16301 0.284
NP_441004.1_1 Forward -359 -340 -3.44213 0.159
NP_441004.1_4 Reverse -349 -359 9.7148 0.259
NP_441004.1_5 Forward -357 -343 18.4858 0.14
NP_439949.1_7 Forward -46 -32 12.7826 0.259
NP_439949.1_7 Reverse -27 -41 11.2093 0.291
NP_442694.1_4 Reverse -145 -154 14.2577 0.188
NP_441668.1_4 Forward -115 -96 3.24438 0.187
NP_440593.1_3 Forward -285 -266 -1.27885 0.211
NP_440593.1_3 Forward -182 -163 -7.57203 0.297
NP_441982.1_6 Reverse -78 -87 14.3952 0.274
NP_440338.1_4 Reverse -206 -225 5.11187 0.298
NP_440940.1_1 Reverse -1 -20 19.2723 0.0828
NP_441124.1_5 Reverse -79 -89 13.7721 0.215
NP_442450.1_5 Forward -52 -42 5.48657 0.242
NP_442006.1_2 Forward -170 -153 -18.3491 0.29
NP_440793.1_1 Reverse -149 -163 19.8618 0.147
NP_440526.1_3 Forward -81 -70 2.31981 0.267
NP_440526.1_3 Forward -324 -313 0.943182 0.267
NP_441432.1_5 Forward -40 -26 7.37441 0.271
NP_440497.1_6 Forward -208 -189 -5.11376 0.264
NP_441057.1_3 Forward -139 -120 -11.6036 0.237
NP_442727.1_1 Reverse -264 -278 12.0943 0.277
NP_441452.1_1 Reverse -343 -362 18.7807 0.112
NP_441452.1_9 Forward -253 -234 14.1591 0.263
NP_441022.1_1 Reverse -82 -91 12.6973 0.232
NP_441800.1_7 Reverse -236 -254 1.19912 0.21
NP_441856.1_7 Forward -253 -234 10.4225 0.276
NP_441923.1_6 Forward -169 -155 9.04604 0.278
NP_441923.1_8 Forward -142 -128 18.0925 0.15
NP_440486.1_6 Forward -368 -349 6.78429 0.278
NP_440459.1_2 Forward -362 -345 7.217 0.299
NP_442828.1_5 Reverse -45 -64 10.4217 0.29
NP_441585.1_5 Forward -296 -277 4.32522 0.243
NP_441047.1_2 Forward -398 -379 -3.04881 0.285
NP_441895.1_10 Reverse -76 -95 -9.83364 0.281
NP_442404.1_9 Reverse -335 -349 14.1586 0.263
NP_442404.1_9 Reverse -187 -201 8.45543 0.296
NP_442140.1_3 Reverse -162 -172 7.55152 0.135
NP_440590.1_4 Forward -324 -311 -5.19226 0.277
NP_440590.1_4 Reverse -352 -365 -5.58558 0.283
NP_440590.1_4 Forward -202 -189 -5.58558 0.283
NP_442810.1_7 Forward -322 -303 4.22769 0.221
NP_441239.1_2 Forward -358 -339 16.6174 0.252
NP_441239.1_9 Reverse -192 -204 6.52882 0.185
NP_441239.1_9 Forward -15 -3 4.26721 0.256
NP_441239.1_9 Reverse -159 -171 3.18557 0.292
NP_440400.1_1 Forward -328 -309 -2.75457 0.287
NP_440665.1_2 Forward -170 -151 -5.80207 0.247
NP_442592.1_2 Forward -347 -328 9.24257 0.212
NP_442402.1_4 Forward -137 -118 -8.85106 0.284
NP_442402.1_4 Forward -138 -119 -9.14605 0.285
NP_442402.1_9 Reverse -143 -162 8.84924 0.278
NP_442023.1_2 Forward -75 -56 6.4893 0.275
NP_442039.1_7 Forward -168 -158 9.7148 0.257
NP_441811.1_8 Forward -56 -42 9.73436 0.225
NP_440825.1_7 Forward -49 -39 14.2759 0.152
NP_442053.1_1 Reverse -316 -325 8.84951 0.072
NP_441252.1_6 Forward -356 -349 11.6422 0.288
NP_442533.1_6 Forward -13 -4 2.16301 0.27
NP_441028.1_6 Reverse -156 -166 10.3043 0.203
NP_441028.1_6 Reverse -379 -389 7.35439 0.229
NP_440007.1_9 Forward -364 -350 4.52282 0.267
NP_441106.1_3 Forward -98 -79 11.7008 0.217
NP_442717.1_3 Reverse -339 -358 6.39097 0.0972
NP_439899.1_1 Reverse -76 -94 6.62074 0.205
NP_441463.1_3 Reverse -334 -353 -6.09707 0.239
NP_441431.1_2 Reverse -190 -204 5.89884 0.284
NP_442352.1_1 Reverse -155 -168 17.7993 0.137
NP_440114.1_10 Reverse -4 -18 6.6861 0.26
NP_442698.1_10 Forward -397 -378 -1.47551 0.299
NP_440287.1_5 Forward -139 -120 6.48849 0.292
NP_440293.1_10 Forward -369 -350 -2.26216 0.271
NP_440766.1_5 Reverse -129 -141 8.13325 0.286
NP_442743.1_4 Reverse -349 -368 -5.21209 0.257
NP_442942.1_5 Forward -274 -255 9.24257 0.249
NP_440502.1_3 Reverse -388 -398 13.8873 0.289
NP_440473.1_8 Reverse -161 -175 19.5675 0.234
NP_440524.1_2 Reverse -353 -372 -1.7705 0.27
NP_440524.1_2 Forward -365 -346 -5.40875 0.294
NP_442862.1_3 Reverse -12 -29 11.1502 0.202
NP_441428.1_7 Forward -93 -74 5.80098 0.254
NP_442341.1_7 Forward -245 -231 3.34284 0.227
NP_440804.1_7 Reverse -43 -60 5.83964 0.291
NP_441852.1_6 Reverse -159 -178 18.584 0.0569
NP_441226.1_7 Reverse -352 -359 6.52862 0.253
NP_441135.1_1 Forward -229 -210 18.9773 0.261
NP_440261.1_5 Reverse -359 -372 -4.50394 0.151
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGCATGGGACAGAGGGGAAAAGCTCTCCTCCGGTTCACCGCCGTTGGGGAATGGAGGCGTCAATCCATGTGGAACGCGAACCACACTGACCAGACTAGAATTCCAACAAAGAGAACTGTTCCCAACACAAAGGCGGCATTATGGAGGCTGTTGGTGTCGATGAGCGTCATACAATCAAGGAGGTGTTAGGGTTTAGGGCCTTTGGCGCCGATTAAATCCGTTAACCTTCAACCATGGGGGCAAAGCAACAAGCCCTCCAAGTTTAGCCCCTGTTTGCCCAGGAATATTAACTTGGCAGAGGAACAGTCACAATTTTTGACAATTGCACCGTCAGAAGGAGTTAATTTAGCTTGATTGCTGATTAATCCCACCATTTCATCGCAAAATCCCATCACCGCC

CDS

ATGAATCCCTCCAATGCCCAACTTACCGCTCGTCGTTACCGAGCCGGTGATCCCATTTTCAGTGAAGGAGATCAAGGTAATTTTGCCTATATTATCGAGGAAGGGCAGGTGGAAATCTGGACAGAACTCAATGGCGATCGCCGGGTGCTGAATGTGCTCCAACCGGGCAGTTTATTTGGGGAATTGGCCCTGGTGGATGCCAAACCTCGTTCCGCTTCCGCTTCCGCCCTCACGGATTGCATTCTTTCCCTGGTTACTCCCGATCAAGTTAACCAACGCATCGACACGGCCGACCCGATTTTGCGCCTACTATTGTTGGTGGTAATCGGCCATTTTCGTTCTGAAAGCAATAATTTTCGTGGCACCACTGAGCCAGCTTTGGTCCTAGATGCGGCCCTAACTAAAACTAAACTTTCCCTCAAAGAACGCATCACCGATGCAGTGGACATGATCCGTTTAGAGGGGGAAATGAAAGAGGCGATCGCCAAAGAGCAATTCCATTTGGTGTACCAGCCCATTGTCTTCATGGACGACCTCCGCATCGAAGGATTTGAAGCTCTAATCCGTTGGCAAAGTCCTAAGCGGGGCTTTGTCCGCCCTGATCGTTTTATCGAAGTGGCGGAGGCAACAGACCTAATCATTCCCATCGGTCAATGGGTAATTGAACAAGGATTAAAAGATTTAAAAACTTTCCAGACAAAATTTAACCCCCATTTGTTGATGAGTTTTAATATTGTTGGTCGGCAAACCAACAGTGAAGATTTTGTTCCCTGGCTACTAGAAAAAGTAGACCACTATGGGTTAACCCCCGATAAGGTAAAACTGGAAATCATCGAGCGTACCCTTTTTAGCGGTGAAAGTTCCGCCCCCTGGATTGAAAACTGTCGTTCCCAAGGCTTTGCGTTAGTGTTGGACGATTTTGGTACGGGTTATTCTAGCTTGCAATATCTGAATGAGTACAAAATTGACCGGGTAAAAATTGATAAATCCTTTGTGGATGGCTTGGGCACCAATCAAAACAGTGAAAGTATTTGCTCTGCCATTTTGCAACTCTCCCACGCCCTGGGCATGACAGTGGTGGCGGAAGGCATTGAAACCCAAGCACAATTGGAGATTTTGCAATCCCTCGGTTGTGACTATGGTCAAGGTTATCTATTTTCTCGACCTCTACGCTTTGACCAAGTAATGGTCTTGGATCAAGATGCTTTCCGTTAG

Protein

MNPSNAQLTARRYRAGDPIFSEGDQGNFAYIIEEGQVEIWTELNGDRRVLNVLQPGSLFGELALVDAKPRSASASALTDCILSLVTPDQVNQRIDTADPILRLLLLVVIGHFRSESNNFRGTTEPALVLDAALTKTKLSLKERITDAVDMIRLEGEMKEAIAKEQFHLVYQPIVFMDDLRIEGFEALIRWQSPKRGFVRPDRFIEVAEATDLIIPIGQWVIEQGLKDLKTFQTKFNPHLLMSFNIVGRQTNSEDFVPWLLEKVDHYGLTPDKVKLEIIERTLFSGESSAPWIENCRSQGFALVLDDFGTGYSSLQYLNEYKIDRVKIDKSFVDGLGTNQNSESICSAILQLSHALGMTVVAEGIETQAQLEILQSLGCDYGQGYLFSRPLRFDQVMVLDQDAFR