Your browser is old and dusty. Try Google Chrome!

Details for slr0839

ORF slr0839
Accession NP_442453.1
Symbol hemH, scpA
Category Cobalamin, heme, phycobilin and porphyrin
Definition ferrochelatase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -360 -346 1.67122 0.183
NP_441061.1_2 Reverse -347 -361 1.47456 0.188
NP_441061.1_2 Forward -333 -319 -0.688726 0.237
NP_440795.1_7 Reverse -276 -283 6.92228 0.26
NP_441418.1_3 Reverse -16 -35 10.265 0.272
NP_442291.1_7 Reverse -342 -356 9.14437 0.291
NP_441453.1_8 Reverse -51 -68 8.00365 0.25
NP_442151.1_6 Forward -118 -104 7.9644 0.184
NP_442151.1_6 Reverse -319 -333 5.30946 0.284
NP_441818.1_9 Reverse -256 -275 -2.45882 0.203
NP_441818.1_9 Reverse -313 -332 -8.94866 0.285
NP_442744.1_9 Reverse -229 -243 13.0292 0.282
NP_442655.1_10 Reverse -316 -335 -19.7651 0.289
NP_442173.1_5 Reverse -212 -222 15.4389 0.287
NP_001035873.1_1 Forward -52 -33 18.4829 0.174
NP_441812.1_3 Reverse -324 -338 7.86607 0.259
NP_440061.1_9 Forward -287 -273 8.3571 0.177
NP_442062.1_8 Forward -222 -212 5.38824 0.172
NP_441781.1_7 Reverse -275 -294 2.45773 0.206
NP_442097.1_2 Forward -36 -17 1.27776 0.259
NP_440011.1_1 Forward -357 -338 11.7008 0.27
NP_440916.1_1 Forward -368 -354 9.34103 0.236
NP_442276.1_2 Forward -360 -341 13.5691 0.264
NP_442367.1_10 Reverse -193 -207 8.75105 0.279
NP_441925.1_4 Forward -283 -264 -14.6526 0.263
NP_441925.1_4 Forward -294 -275 -16.5208 0.284
NP_441925.1_4 Forward -338 -319 -17.0125 0.287
NP_441955.1_8 Forward -228 -211 6.82368 0.281
NP_441713.1_8 Forward -359 -341 13.5888 0.171
NP_442570.1_3 Forward -358 -339 -5.9004 0.25
NP_441624.1_7 Reverse -340 -354 9.83269 0.217
NP_440747.1_10 Forward -287 -275 -4.48425 0.101
NP_440747.1_10 Forward -358 -346 -12.2524 0.254
NP_441130.1_10 Forward -93 -79 4.71948 0.27
NP_442634.1_4 Reverse -254 -268 -5.01529 0.228
NP_440403.1_10 Reverse -337 -356 3.83436 0.27
NP_441012.1_4 Forward -326 -313 10.639 0.262
NP_440376.1_1 Reverse -275 -284 4.52295 0.156
NP_440580.1_5 Reverse -328 -342 13.3726 0.272
NP_441846.1_10 Reverse -312 -331 -23.4033 0.285
NP_440642.1_10 Forward -70 -56 9.93039 0.175
NP_441013.1_2 Forward -360 -342 1.29745 0.251
NP_442205.1_9 Reverse -194 -210 -2.30141 0.268
NP_440318.1_1 Reverse -207 -226 1.37609 0.284
NP_439905.1_3 Reverse -271 -290 11.6025 0.274
NP_441097.1_2 Reverse -315 -332 4.75873 0.276
NP_441580.1_6 Forward -329 -310 -3.44213 0.235
NP_443055.1_3 Reverse -374 -393 10.7406 0.28
NP_443055.1_6 Reverse -332 -350 -1.84987 0.284
NP_440993.1_4 Reverse -346 -363 8.00365 0.216
NP_440602.1_8 Forward -84 -70 12.291 0.21
NP_443044.1_1 Reverse -358 -377 2.26107 0.296
NP_441099.1_5 Reverse -342 -361 -11.0136 0.27
NP_442431.1_10 Reverse -313 -331 -0.275845 0.287
NP_442231.1_5 Forward -327 -308 14.3558 0.267
NP_440206.1_4 Forward -360 -341 1.96529 0.289
NP_440206.1_4 Reverse -342 -361 1.96529 0.289
NP_441041.1_4 Reverse -275 -294 -5.01543 0.146
NP_441041.1_4 Forward -349 -330 -11.3086 0.244
NP_441041.1_7 Forward -247 -235 4.89098 0.289
NP_440569.1_6 Forward -358 -339 18.7807 0.0255
NP_442004.1_6 Reverse -329 -343 10.6193 0.14
NP_442004.1_6 Reverse -275 -289 3.73617 0.232
NP_439966.1_8 Reverse -329 -348 6.88262 0.255
NP_001035871.2_7 Forward -353 -343 14.533 0.187
NP_442012.1_1 Forward -290 -271 1.86774 0.21
NP_439983.1_1 Forward -205 -187 16.1446 0.203
NP_441644.1_6 Forward -355 -345 5.87944 0.174
NP_441644.1_6 Reverse -275 -285 3.32285 0.288
NP_441071.1_3 Forward -337 -318 12.585 0.196
NP_442215.1_2 Forward -364 -348 -1.21977 0.181
NP_442215.1_2 Reverse -338 -354 -4.36636 0.232
NP_442029.1_6 Forward -360 -341 8.06259 0.211
NP_442029.1_10 Reverse -156 -175 5.70265 0.284
NP_442926.1_1 Reverse -307 -326 -6.09707 0.278
NP_442554.1_8 Reverse -347 -357 2.14332 0.281
NP_442142.1_4 Forward -358 -345 2.87033 0.273
NP_440919.1_7 Forward -367 -349 15.8629 0.142
NP_442476.1_6 Forward -283 -269 2.16287 0.191
NP_443009.1_5 Forward -285 -274 5.46638 0.202
NP_440183.1_1 Reverse -335 -354 9.0459 0.244
NP_441198.1_8 Reverse -67 -77 10.8298 0.239
NP_440379.1_5 Reverse -337 -356 -3.54046 0.204
NP_441468.1_2 Reverse -302 -316 17.0108 0.252
NP_441015.1_10 Forward -360 -341 -3.63879 0.19
NP_441015.1_10 Reverse -347 -366 -11.7019 0.3
NP_441673.1_1 Reverse -275 -284 -8.06341 0.254
NP_441826.1_2 Forward -355 -341 -4.81863 0.3
NP_441826.1_6 Reverse -54 -68 14.6509 0.194
NP_442719.1_2 Reverse -204 -222 -3.71814 0.201
NP_442719.1_2 Reverse -228 -246 -8.04469 0.241
NP_442227.1_2 Forward -332 -313 -3.14714 0.289
NP_442361.1_3 Reverse -48 -61 7.49244 0.3
NP_440789.1_1 Forward -52 -33 16.6165 0.149
NP_442808.1_1 Reverse -339 -349 6.37109 0.116
NP_440568.1_6 Reverse -341 -360 22.0256 0.0336
NP_441849.1_2 Reverse -19 -38 0.811258 0.268
NP_442542.1_9 Reverse -75 -89 6.29216 0.243
NP_442903.1_2 Forward -45 -26 12.5568 0.16
NP_440558.1_2 Forward -293 -274 3.83436 0.153
NP_440558.1_2 Reverse -277 -296 -7.08038 0.287
NP_442789.1_4 Reverse -179 -198 -8.45701 0.299
NP_441878.1_6 Reverse -345 -355 0.0783647 0.152
NP_441878.1_6 Reverse -274 -284 -7.19813 0.21
NP_441036.1_8 Reverse -274 -284 5.78156 0.258
NP_441520.1_5 Forward -130 -111 12.8808 0.184
NP_441433.1_8 Forward -354 -335 8.16093 0.161
NP_441433.1_8 Reverse -347 -366 3.14605 0.208
NP_441433.1_8 Forward -117 -98 -4.6221 0.294
NP_441458.1_10 Forward -364 -345 3.04771 0.256
NP_442830.1_5 Reverse -339 -353 5.89884 0.225
NP_442183.1_1 Reverse -204 -218 6.3911 0.176
NP_441459.1_3 Reverse -197 -216 10.2621 0.296
NP_441549.1_9 Forward -359 -341 -10.7973 0.288
NP_441467.1_9 Reverse -317 -331 18.4858 0.142
NP_440540.1_7 Forward -360 -341 20.5506 0.132
NP_442965.1_2 Forward -180 -161 -3.54046 0.255
NP_442594.1_8 Reverse -188 -207 1.67108 0.298
NP_442998.1_5 Reverse -247 -257 8.63316 0.261
NP_440731.1_1 Forward -141 -122 12.4875 0.296
NP_440899.1_8 Reverse -23 -42 0.687771 0.177
NP_440299.1_1 Forward -288 -275 4.24695 0.213
NP_441007.1_10 Reverse -270 -283 1.9859 0.202
NP_440256.1_1 Reverse -376 -395 -9.53865 0.281
NP_440256.1_1 Reverse -283 -302 -10.0303 0.293
NP_440709.1_1 Reverse -32 -51 6.58682 0.148
NP_441179.1_9 Forward -324 -314 9.321 0.28
NP_441866.1_6 Reverse -24 -43 10.0284 0.227
NP_441704.1_8 Forward -233 -214 8.4551 0.208
NP_441464.1_8 Forward -284 -270 7.07942 0.219
NP_440702.1_2 Reverse -317 -336 -4.72043 0.257
NP_442453.1_1 Forward -52 -33 32.0554 0.00000921
NP_442453.1_4 Forward -153 -134 28.8104 0.000411
NP_442993.1_1 Reverse -325 -341 -9.38124 0.185
NP_442993.1_1 Reverse -197 -213 -12.3312 0.27
NP_442386.1_9 Reverse -339 -348 8.2591 0.205
NP_442386.1_9 Reverse -280 -289 5.50585 0.25
NP_442386.1_9 Forward -229 -220 4.81753 0.282
NP_442386.1_10 Forward -384 -371 5.42749 0.262
NP_440570.1_5 Reverse -342 -361 10.9142 0.138
NP_440570.1_5 Forward -353 -334 7.27595 0.174
NP_442054.1_4 Reverse -201 -220 7.37428 0.299
NP_441750.1_1 Reverse -181 -200 -5.60541 0.214
NP_441750.1_7 Reverse -319 -329 14.4347 0.254
NP_442484.1_2 Forward -72 -53 -1.27885 0.288
NP_439976.1_4 Forward -325 -306 10.6184 0.278
NP_442240.1_2 Forward -387 -368 -13.4719 0.169
NP_440192.1_4 Forward -354 -335 9.00952 0.287
NP_439937.1_8 Reverse -308 -327 -3.54046 0.27
NP_439937.1_9 Forward -207 -190 -1.53514 0.124
NP_441595.1_5 Reverse -326 -344 6.11567 0.229
NP_440836.1_6 Reverse -328 -342 9.73436 0.257
NP_441167.1_1 Forward -54 -35 5.40766 0.237
NP_440171.1_3 Forward -353 -334 1.57275 0.294
NP_440316.1_10 Forward -350 -340 9.81313 0.235
NP_440316.1_10 Reverse -345 -355 7.15819 0.251
NP_440267.1_2 Forward -270 -256 6.78381 0.221
NP_441877.1_9 Reverse -23 -40 1.71047 0.297
NP_440163.1_10 Reverse -316 -326 8.63316 0.266
NP_440344.1_10 Reverse -81 -98 -13.5308 0.287
NP_440282.1_10 Reverse -336 -355 -8.65367 0.263
NP_440531.1_6 Reverse -339 -358 -4.81876 0.287
NP_440562.1_10 Forward -238 -220 7.09898 0.284
NP_441965.1_10 Reverse -272 -288 4.58176 0.237
NP_442693.1_6 Forward -335 -316 0.196116 0.278
NP_440297.1_9 Reverse -282 -292 6.37155 0.193
NP_440297.1_9 Reverse -341 -351 6.07655 0.206
NP_442280.1_10 Forward -365 -347 14.4153 0.128
NP_442280.1_10 Reverse -210 -228 4.87002 0.292
NP_441592.1_4 Forward -361 -342 -3.73712 0.288
NP_441592.1_4 Reverse -346 -365 -4.22878 0.297
NP_441896.1_1 Forward -52 -33 11.6017 0.203
NP_441896.1_5 Forward -290 -283 12.2322 0.273
NP_440937.1_5 Forward -54 -35 8.65258 0.278
NP_440888.1_2 Forward -284 -270 11.012 0.0783
NP_441543.1_2 Forward -117 -108 7.57121 0.113
NP_442845.1_2 Reverse -319 -333 6.58777 0.207
NP_442845.1_2 Reverse -275 -289 5.21113 0.24
NP_441178.1_6 Reverse -337 -356 3.04693 0.269
NP_440071.1_5 Reverse -316 -335 7.57094 0.285
NP_442286.1_1 Forward -78 -59 12.8808 0.139
NP_442204.1_1 Reverse -375 -386 1.92696 0.266
NP_442204.1_1 Reverse -342 -353 0.845319 0.281
NP_442872.1_1 Forward -198 -179 -9.34199 0.241
NP_442612.1_1 Forward -105 -90 16.7945 0.214
NP_440673.1_2 Reverse -303 -322 8.92631 0.26
NP_441052.1_2 Forward -361 -351 2.92996 0.187
NP_441052.1_2 Reverse -109 -119 1.55333 0.238
NP_442219.1_8 Forward -239 -220 10.293 0.209
NP_442414.1_9 Forward -328 -309 16.0274 0.227
NP_441004.1_1 Reverse -307 -326 -4.32711 0.169
NP_441004.1_1 Reverse -263 -282 -17.7985 0.294
NP_442813.1_4 Forward -230 -211 -2.65548 0.279
NP_442366.1_5 Forward -287 -277 10.0093 0.292
NP_442139.1_7 Reverse -264 -283 8.06259 0.278
NP_440129.1_7 Forward -263 -249 19.5675 0.287
NP_441851.1_6 Reverse -33 -52 14.2373 0.218
NP_441851.1_10 Forward -343 -333 7.55152 0.137
NP_442515.1_1 Forward -285 -271 -2.85201 0.281
NP_440593.1_9 Forward -287 -273 10.1277 0.24
NP_442843.1_1 Reverse -220 -239 -7.17871 0.245
NP_439960.1_6 Forward -290 -271 14.5524 0.176
NP_441124.1_5 Reverse -224 -234 12.0532 0.239
NP_442168.1_5 Reverse -276 -295 3.14605 0.232
NP_442168.1_5 Reverse -330 -349 -2.16383 0.264
NP_440588.1_2 Forward -293 -274 -6.09707 0.269
NP_440040.1_8 Reverse -37 -56 12.1748 0.172
NP_441003.1_9 Reverse -337 -356 15.3391 0.207
NP_440483.1_1 Forward -355 -336 -2.0655 0.208
NP_441570.1_1 Reverse -137 -155 -17.5821 0.283
NP_441078.1_4 Reverse -275 -284 -1.77023 0.266
NP_441078.1_4 Forward -284 -275 -1.77023 0.266
NP_442443.1_1 Forward -357 -338 -4.52377 0.272
NP_442443.1_4 Reverse -55 -65 15.3192 0.179
NP_441432.1_8 Reverse -108 -117 2.94966 0.28
NP_441432.1_9 Reverse -111 -124 12.4766 0.207
NP_443024.1_3 Forward -246 -236 16.4996 0.255
NP_441333.1_1 Reverse -24 -34 13.4965 0.217
NP_442344.1_7 Reverse -220 -239 -9.53865 0.257
NP_440759.1_9 Forward -41 -22 8.65258 0.224
NP_442797.1_1 Reverse -75 -94 -4.52377 0.286
NP_442797.1_7 Reverse -273 -291 4.05072 0.234
NP_440913.1_1 Forward -357 -339 10.1472 0.175
NP_442489.1_7 Reverse -275 -284 -1.27858 0.185
NP_440757.1_7 Reverse -314 -332 -3.02911 0.284
NP_440565.1_3 Forward -198 -179 14.516 0.264
NP_442008.1_2 Reverse -343 -362 8.94757 0.191
NP_440708.1_6 Forward -365 -346 -7.96535 0.255
NP_442346.1_1 Reverse -261 -280 10.8159 0.27
NP_442346.1_5 Reverse -108 -118 6.07655 0.216
NP_440352.1_5 Reverse -215 -234 12.2664 0.229
NP_440352.1_5 Forward -116 -97 12.169 0.235
NP_440352.1_5 Forward -386 -367 10.125 0.278
NP_440545.1_3 Forward -288 -271 -1.63279 0.171
NP_440555.1_4 Forward -301 -282 5.40766 0.287
NP_441923.1_6 Reverse -314 -328 14.3559 0.179
NP_440459.1_2 Reverse -211 -228 10.8552 0.189
NP_440459.1_2 Reverse -338 -355 8.39697 0.264
NP_442828.1_2 Reverse -16 -35 15.8035 0.239
NP_442060.1_10 Forward -363 -344 8.75091 0.269
NP_441112.1_6 Forward -113 -94 -2.85214 0.296
NP_442699.1_8 Reverse -350 -369 -10.6203 0.238
NP_440671.1_4 Reverse -313 -327 13.9626 0.0723
NP_440671.1_5 Reverse -335 -349 13.5686 0.293
NP_440224.1_1 Forward -233 -214 -3.3438 0.26
NP_440875.1_9 Reverse -343 -353 7.30133 0.269
NP_440875.1_9 Reverse -349 -359 6.81464 0.297
NP_440594.1_6 Forward -340 -321 12.3883 0.169
NP_441239.1_9 Reverse -338 -350 4.95553 0.234
NP_441239.1_9 Forward -230 -218 4.5622 0.251
NP_442691.1_7 Forward -280 -261 6.68515 0.286
NP_442568.1_8 Forward -38 -24 7.66941 0.296
NP_441892.1_1 Forward -358 -341 -3.20608 0.235
NP_442270.1_9 Forward -198 -179 -12.1936 0.291
NP_441874.1_1 Reverse -183 -197 9.14437 0.277
NP_441541.1_1 Reverse -34 -52 -2.86277 0.264
NP_441526.1_6 Reverse -317 -336 8.25926 0.258
NP_440462.1_4 Reverse -318 -332 11.7993 0.205
NP_442499.1_4 Forward -231 -217 11.3077 0.226
NP_441474.1_1 Forward -332 -313 7.17681 0.212
NP_442402.1_10 Reverse -335 -345 13.8442 0.182
NP_442258.1_2 Reverse -342 -361 -3.3438 0.234
NP_441084.1_6 Forward -400 -386 9.44108 0.282
NP_442039.1_7 Forward -347 -337 11.3864 0.257
NP_442039.1_7 Reverse -54 -64 9.51814 0.257
NP_439994.1_4 Forward -363 -344 8.84924 0.291
NP_442360.1_5 Forward -348 -338 13.353 0.279
NP_441959.1_5 Forward -294 -275 6.88262 0.26
NP_442456.1_4 Forward -243 -224 14.6499 0.253
NP_440207.2_2 Forward -342 -323 15.58 0.28
NP_442009.1_9 Reverse -83 -102 11.6025 0.226
NP_442533.1_1 Reverse -316 -335 -5.01543 0.155
NP_442533.1_1 Reverse -187 -206 -15.8318 0.257
NP_442533.1_6 Forward -355 -346 10.9145 0.0503
NP_442533.1_6 Forward -284 -275 7.47288 0.0898
NP_442533.1_6 Reverse -275 -284 3.83464 0.202
NP_442541.1_10 Forward -290 -276 3.93223 0.252
NP_442322.1_4 Reverse -338 -355 4.85634 0.187
NP_441697.1_5 Forward -37 -18 -9.31089 0.268
NP_440816.1_2 Reverse -56 -75 8.17758 0.257
NP_441028.1_6 Forward -66 -56 5.19112 0.265
NP_441028.1_6 Reverse -336 -346 4.10949 0.278
NP_442664.1_10 Forward -136 -117 17.0107 0.188
NP_441602.1_3 Reverse -320 -339 -5.11376 0.278
NP_441170.1_2 Reverse -102 -121 -0.787193 0.295
NP_441106.1_3 Forward -54 -35 10.9142 0.24
NP_442588.1_6 Forward -358 -339 2.16274 0.23
NP_441479.1_9 Reverse -339 -357 13.6872 0.277
NP_440886.1_7 Forward -329 -319 4.89613 0.213
NP_440886.1_7 Forward -285 -275 4.01116 0.255
NP_442614.1_2 Reverse -275 -289 9.04604 0.242
NP_442213.1_5 Reverse -265 -284 3.24438 0.231
NP_442264.1_2 Reverse -209 -226 6.23369 0.265
NP_440841.1_4 Reverse -344 -363 -8.55534 0.25
NP_441463.1_6 Forward -105 -91 6.3193 0.274
NP_440107.1_5 Forward -332 -313 -1.67217 0.178
NP_442794.1_1 Forward -71 -59 3.77555 0.286
NP_441962.1_4 Forward -289 -270 -0.0988766 0.117
NP_441962.1_5 Reverse -335 -354 10.8159 0.186
NP_440855.1_5 Forward -286 -267 3.04693 0.287
NP_441431.1_3 Reverse -313 -332 8.16093 0.236
NP_441836.1_2 Reverse -269 -288 -2.95047 0.232
NP_440143.1_1 Forward -165 -146 13.4708 0.284
NP_440814.1_8 Reverse -275 -294 4.81767 0.269
NP_440754.1_3 Reverse -270 -288 18.112 0.0704
NP_440293.1_3 Reverse -317 -336 -2.16383 0.239
NP_440293.1_10 Reverse -310 -329 19.3707 0.0171
NP_439988.1_3 Forward -353 -339 5.50613 0.283
NP_442743.1_1 Reverse -330 -349 10.4217 0.241
NP_441531.1_6 Forward -328 -315 10.7374 0.254
NP_441984.1_3 Reverse -209 -227 7.00065 0.259
NP_442514.1_5 Forward -363 -344 2.35861 0.17
NP_442514.1_10 Reverse -290 -309 4.62101 0.299
NP_442862.1_3 Reverse -251 -268 4.26707 0.29
NP_442341.1_5 Forward -333 -314 16.7157 0.182
NP_441756.1_5 Forward -358 -339 -0.885524 0.25
NP_441173.1_9 Reverse -337 -345 11.3271 0.226
NP_440119.1_1 Forward -331 -315 10.3833 0.111
NP_442395.2_4 Reverse -339 -358 0.0970122 0.279
NP_440191.1_4 Reverse -124 -134 13.6329 0.282
NP_440679.1_10 Reverse -318 -337 -12.4886 0.198
NP_442495.1_4 Reverse -345 -355 15.2213 0.143
NP_442495.1_4 Forward -184 -174 11.2881 0.28
NP_442214.1_1 Reverse -250 -269 8.65258 0.298
NP_441105.1_3 Forward -361 -342 -8.752 0.278
NP_441105.1_3 Reverse -341 -360 -9.63698 0.292
NP_442015.1_3 Forward -286 -267 15.5349 0.172
NP_440416.1_9 Reverse -339 -358 -18.5851 0.26
NP_440416.1_9 Forward -362 -343 -18.7818 0.264
NP_440416.1_9 Forward -291 -272 -21.9284 0.298
NP_443052.1_9 Forward -335 -316 -4.13045 0.254
NP_443052.1_9 Forward -327 -308 -5.40875 0.27
NP_442154.1_1 Reverse -317 -335 5.23069 0.0591
NP_442154.1_1 Reverse -314 -332 -7.84733 0.148
NP_442154.1_1 Reverse -179 -197 -17.6804 0.262
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAAACCCTGAACATAGGTCGCCTGGGGTACATTAATTTTCGCCCTGCCCAGGGCCTTGGGGGAAGCATCCAGCCCCACCACCGTGGCTCCAGATTGAGCTAGGTAAACAGTGGCTTGGCCACCCCCGCAACACAAATCCAGCACCTTCTGTCCCGGTGAAATTGCTAAATTCTCCAATGGCAATTGATGGAAACGCTCTTCTCCCCCCACATTCAAAGTCGCTAGGCGGGAAACTAGGGCGTAAACCCACGGATACTGATAACTCCAAGTGCGGAAAATAGTTGCCATAACCTAGAAAGAAATTGGGACGCCGTTTGTAGGTTGGGATTCTTTCCTTTTCGCCATCTATTGTTACACTTGGTAAAGAAACTGAAAAATCATTCTACTAAGCTTAACAATT

CDS

ATGGGTCGTGTTGGGGTCTTACTGCTAAATCTTGGCGGACCGGAGAAGTTAGAGGATGTACGCCCCTTCCTTTTTAACCTGTTTGCGGATCCGGAAATCATTCGTCTCCCTTTTCCTTGGTTGCAAAAACCCCTGGCATGGCTGATTTCTACCCTACGGGCGAAAAAATCCCAGGCCAACTACGCCGAAATCGGTGGTGGTTCCCCCCTGTTGCAGATTACCGAAGCCCAAGCCTCCGCCCTCACGACCCGTCTGGAACGCCTTGGCCAGGATGCAAAAGTGTACATTGGCATGCGCTACTGGCACCCCTTTACGGAGGAAGCCGTCGAAAAAATTAAAGGCGATCGCCTGCAACGGCTGGTGATTTTGCCTCTATATCCCCATTTTTCCATTAGCACTAGCGGCTCCAGTTTCCGGGTGTTGGAGGAAATGTGGCATAACGACCCCAGTTTGCGGCAATTGGACTATAGCCTGATCCCCTCTTGGTACGACCATCCGGGCTATCTCCAGGCCATGGCGGATTTGATTGCTCAAGAATTAAAGAAATTCCCCAATCCAGACCAAGCCCATATTTTCTTCAGTGCCCACGGTGTGCCCCAAAGCTATGTGGATGAAGCGGGAGACCCCTACCAGGCAGAAATTGAAGCCTGTACCCGTTTGATAATGCGGACTCTCGATCGTCCGAACCAATACACGTTGGCCTACCAAAGTCGGGTGGGGCCAGTGGAATGGCTCAAGCCCTACACGGAAGAAGCTCTGCAAAAACTGGGGGCGGAGGGCATTGACGATCTATTGGTGGTGCCCATTAGCTTTGTGTCAGAACATATTGAAACCCTCCAGGAAATTGACATCGAGTATCGGGAAATTGCCGAAGAAGCCGGCATTGATAATTTTCAGCGGGTACCGGCCCTAAACACCCATCCAGTTTTCATCGACGCCTTGGCCCAGATGGTGATGGATTCCCTCAACGATCCTCCCTGCACCTTTGAAACGGTGCCCCATCCCAAAAAGAACATGAAAATGTATCCCCAGGAAAGATGGGAATGGGGTTTGACTACGGCGGCGGAAGTATGGAATGGTCGCCTCGCCATGTTGGGTTTCATTGCCCTGTTGGTGGAGTTGATCAGCGGCCAGGGCCCGTTGCATTTTGTCGGCTTGCTTTAG

Protein

MGRVGVLLLNLGGPEKLEDVRPFLFNLFADPEIIRLPFPWLQKPLAWLISTLRAKKSQANYAEIGGGSPLLQITEAQASALTTRLERLGQDAKVYIGMRYWHPFTEEAVEKIKGDRLQRLVILPLYPHFSISTSGSSFRVLEEMWHNDPSLRQLDYSLIPSWYDHPGYLQAMADLIAQELKKFPNPDQAHIFFSAHGVPQSYVDEAGDPYQAEIEACTRLIMRTLDRPNQYTLAYQSRVGPVEWLKPYTEEALQKLGAEGIDDLLVVPISFVSEHIETLQEIDIEYREIAEEAGIDNFQRVPALNTHPVFIDALAQMVMDSLNDPPCTFETVPHPKKNMKMYPQERWEWGLTTAAEVWNGRLAMLGFIALLVELISGQGPLHFVGLL