Your browser is old and dusty. Try Google Chrome!

Details for slr0815

ORF slr0815
Accession NP_441444.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440815.1_5 Forward -234 -215 3.93269 0.286
NP_441453.1_4 Forward -335 -327 4.14932 0.264
NP_441453.1_7 Forward -118 -111 14.1988 0.175
NP_001035873.1_8 Reverse -215 -234 8.35759 0.224
NP_442975.1_10 Reverse -242 -256 4.52221 0.245
NP_442062.1_8 Forward -335 -325 12.6647 0.0292
NP_440304.1_4 Reverse -324 -334 14.0414 0.051
NP_441581.1_1 Forward -76 -59 15.9685 0.157
NP_440518.1_3 Reverse -279 -298 10.2251 0.196
NP_442110.1_7 Reverse -1 -15 2.2612 0.222
NP_441925.1_4 Forward -326 -307 -17.3075 0.293
NP_441083.1_5 Reverse -326 -336 -0.118297 0.256
NP_441083.1_5 Forward -335 -325 -0.314959 0.265
NP_441444.1_1 Forward -131 -112 30.1871 0.000263
NP_441444.1_3 Forward -179 -160 27.2371 0.00281
NP_441444.1_4 Forward -226 -208 20.6678 0.237
NP_441444.1_5 Forward -155 -136 20.7473 0.235
NP_442059.1_10 Reverse -117 -136 13.7658 0.172
NP_441792.1_1 Forward -84 -65 8.16093 0.172
NP_441792.1_5 Forward -320 -304 11.8583 0.19
NP_440842.1_10 Reverse -323 -337 14.9459 0.251
NP_441014.1_8 Forward -76 -57 -3.44213 0.242
NP_443018.1_3 Forward -334 -327 10.7572 0.0907
NP_443018.1_3 Reverse -327 -334 4.56234 0.241
NP_440376.1_1 Reverse -326 -335 6.48957 0.0963
NP_440376.1_1 Forward -335 -326 6.19458 0.109
NP_440376.1_1 Reverse -310 -319 -0.295266 0.286
NP_442687.1_7 Reverse -325 -335 9.12481 0.0994
NP_442687.1_7 Forward -336 -326 7.35486 0.134
NP_440642.1_10 Forward -120 -106 1.5723 0.29
NP_441950.1_7 Forward -174 -155 -8.752 0.287
NP_442658.1_1 Reverse -324 -334 15.2208 0.0156
NP_441855.2_4 Forward -343 -324 9.71588 0.275
NP_442782.1_2 Reverse -225 -239 0.392915 0.29
NP_441256.1_8 Reverse -311 -330 13.2741 0.143
NP_442937.1_5 Forward -340 -321 6.4893 0.278
NP_441958.1_5 Reverse -325 -335 1.06167 0.116
NP_441958.1_5 Forward -336 -326 0.865012 0.12
NP_440651.1_1 Reverse -52 -71 6.78429 0.282
NP_440950.1_8 Reverse -119 -138 14.7599 0.148
NP_441162.1_3 Forward -316 -297 11.7992 0.198
NP_441162.1_3 Forward -83 -64 10.5209 0.211
NP_443055.1_6 Reverse -318 -336 3.06666 0.2
NP_441646.1_1 Reverse -74 -93 1.96607 0.224
NP_441674.1_6 Reverse -101 -120 10.7175 0.171
NP_440147.1_4 Forward -337 -324 10.8357 0.0353
NP_441550.1_8 Forward -337 -327 4.69947 0.291
NP_441916.1_7 Reverse -326 -336 4.40493 0.178
NP_441916.1_10 Reverse -115 -134 1.76941 0.262
NP_441916.1_10 Reverse -324 -343 1.37609 0.264
NP_440345.1_3 Reverse -246 -260 10.1338 0.29
NP_441725.1_5 Forward -334 -324 14.6313 0.0247
NP_440289.1_2 Reverse -323 -336 -4.9956 0.294
NP_442281.1_1 Reverse -321 -335 4.91554 0.176
NP_441334.1_7 Forward -87 -68 -16.3235 0.275
NP_442500.1_8 Reverse -122 -136 11.6245 0.257
NP_442982.1_5 Reverse -113 -132 2.3594 0.218
NP_443030.1_4 Reverse -152 -171 2.75272 0.205
NP_441644.1_6 Forward -335 -325 10.0093 0.0649
NP_441644.1_6 Reverse -326 -336 4.69947 0.228
NP_441644.1_6 Forward -327 -317 3.8145 0.261
NP_442215.1_2 Reverse -182 -198 -5.34967 0.249
NP_442933.1_10 Reverse -326 -335 4.52295 0.24
NP_442554.1_8 Forward -334 -324 6.66654 0.111
NP_442554.1_8 Reverse -327 -337 4.0116 0.2
NP_443009.1_5 Forward -336 -325 12.0545 0.0561
NP_443009.1_5 Reverse -325 -336 7.43299 0.129
NP_440730.1_4 Reverse -60 -79 -5.11376 0.298
NP_441198.1_8 Reverse -324 -334 13.2713 0.108
NP_441468.1_1 Reverse -327 -334 4.07068 0.263
NP_440742.1_10 Forward -340 -321 17.3057 0.0749
NP_441015.1_10 Reverse -307 -326 -8.85033 0.277
NP_441673.1_1 Reverse -326 -335 1.37636 0.114
NP_441673.1_1 Forward -335 -326 1.1797 0.163
NP_441637.1_9 Reverse -245 -263 -2.14413 0.292
NP_442868.1_6 Reverse -324 -334 3.81494 0.192
NP_442227.1_2 Forward -325 -306 -3.73712 0.295
NP_442427.1_8 Forward -344 -325 11.3075 0.152
NP_441911.1_10 Reverse -116 -135 8.07696 0.271
NP_441911.1_10 Reverse -37 -56 7.88415 0.274
NP_442808.1_1 Forward -159 -149 4.60114 0.195
NP_441101.1_4 Forward -219 -200 9.63589 0.191
NP_440145.1_3 Reverse -316 -335 -1.27885 0.15
NP_442542.1_2 Reverse -324 -337 9.75405 0.131
NP_442542.1_9 Reverse -64 -78 6.39049 0.239
NP_442113.1_10 Forward -81 -62 -6.88371 0.265
NP_441114.1_3 Forward -333 -324 7.57121 0.231
NP_440558.1_2 Forward -324 -305 -4.22878 0.243
NP_440558.1_2 Reverse -323 -342 -6.88371 0.283
NP_440558.1_2 Forward -171 -152 -7.17871 0.289
NP_441878.1_6 Reverse -325 -335 12.0747 0.013
NP_441878.1_6 Forward -336 -326 10.9931 0.0176
NP_441557.1_5 Reverse -326 -335 0.491382 0.144
NP_441557.1_5 Forward -335 -326 0.29472 0.174
NP_441557.1_8 Forward -318 -308 15.8108 0.18
NP_441445.1_1 Forward -344 -325 0.58944 0.272
NP_441433.1_8 Forward -101 -82 -4.72043 0.294
NP_441224.1_2 Reverse -6 -24 15.5554 0.134
NP_442183.1_1 Forward -335 -321 5.70279 0.206
NP_442397.1_1 Forward -194 -180 17.2881 0.209
NP_441819.1_5 Forward -360 -341 10.5514 0.261
NP_441574.1_1 Reverse -306 -325 -6.09707 0.273
NP_441037.1_4 Reverse -324 -334 7.9999 0.237
NP_442594.1_8 Reverse -309 -328 7.47261 0.213
NP_442594.1_8 Reverse -310 -329 3.44104 0.282
NP_441633.1_3 Forward -337 -324 -5.78224 0.236
NP_442590.1_10 Reverse -218 -237 4.42435 0.276
NP_440899.1_8 Forward -223 -204 -11.0136 0.295
NP_441007.1_5 Reverse -307 -326 10.6192 0.215
NP_442334.1_2 Reverse -316 -333 -13.8258 0.297
NP_441559.1_2 Forward -350 -331 15.6341 0.237
NP_440915.1_6 Reverse -322 -336 2.75286 0.112
NP_441464.1_1 Forward -319 -300 8.75091 0.253
NP_441464.1_8 Forward -335 -321 8.35772 0.198
NP_441464.1_8 Reverse -326 -340 5.40779 0.255
NP_440306.1_5 Reverse -36 -55 16.9124 0.0626
NP_441939.1_3 Forward -180 -161 7.37428 0.204
NP_441199.1_5 Forward -76 -57 10.9142 0.259
NP_442993.1_1 Forward -31 -15 -13.0195 0.283
NP_441340.1_5 Forward -334 -327 3.97235 0.274
NP_442791.1_5 Forward -116 -97 -10.522 0.279
NP_440168.1_4 Forward -331 -312 -0.39387 0.24
NP_439996.1_6 Reverse -58 -77 6.1641 0.298
NP_439937.1_9 Forward -336 -319 -8.71327 0.177
NP_439937.1_9 Forward -169 -152 -12.0565 0.269
NP_440408.1_7 Reverse -87 -106 9.73422 0.255
NP_441789.1_7 Forward -328 -309 -3.24622 0.27
NP_440819.1_5 Reverse -206 -214 7.98423 0.228
NP_440316.1_10 Reverse -317 -327 7.15819 0.251
NP_440316.1_10 Reverse -325 -335 6.8632 0.251
NP_442663.1_1 Reverse -244 -263 1.76863 0.244
NP_439977.1_5 Reverse -88 -107 -2.16383 0.272
NP_441018.1_7 Reverse -302 -321 7.27595 0.273
NP_442262.1_10 Forward -334 -327 9.87221 0.164
NP_441060.1_3 Forward -312 -293 8.55425 0.24
NP_440297.1_9 Forward -334 -324 7.25653 0.136
NP_440297.1_9 Reverse -327 -337 0.865012 0.282
NP_440350.1_5 Forward -140 -121 11.7008 0.134
NP_440350.1_5 Forward -134 -115 -4.13045 0.273
NP_440888.1_2 Forward -335 -321 5.40719 0.28
NP_442147.1_7 Reverse -71 -90 10.9142 0.243
NP_442277.1_7 Reverse -120 -136 -1.33008 0.268
NP_442033.1_10 Forward -337 -318 -14.0619 0.296
NP_441469.1_8 Reverse -325 -334 9.63616 0.227
NP_442337.1_8 Reverse -299 -318 3.6377 0.216
NP_440071.1_4 Forward -315 -296 13.8641 0.234
NP_441462.1_2 Reverse -326 -336 0.668351 0.135
NP_441462.1_2 Forward -335 -325 0.471689 0.148
NP_441351.1_8 Reverse -71 -90 0.786102 0.285
NP_442428.1_5 Reverse -327 -334 4.46401 0.267
NP_441443.1_2 Forward -343 -324 16.2241 0.0272
NP_441790.1_3 Reverse -63 -82 -3.54046 0.291
NP_441867.1_2 Reverse -309 -328 -15.8318 0.291
NP_440673.1_3 Forward -333 -326 8.98723 0.203
NP_440718.1_2 Reverse -197 -216 14.7491 0.197
NP_440436.1_4 Forward -334 -325 9.73406 0.0871
NP_440314.1_9 Forward -334 -315 2.0644 0.0862
NP_441004.1_1 Reverse -64 -83 -9.53865 0.209
NP_441004.1_1 Reverse -306 -325 -14.5535 0.268
NP_441004.1_1 Reverse -10 -29 -14.8485 0.271
NP_441004.1_1 Reverse -312 -331 -16.8151 0.287
NP_441004.1_2 Reverse -307 -326 10.5209 0.145
NP_441004.1_2 Reverse -301 -320 -4.72043 0.296
NP_441004.1_4 Reverse -323 -333 19.7446 0.0335
NP_441004.1_4 Reverse -315 -325 8.92815 0.262
NP_442176.1_1 Reverse -311 -330 2.0644 0.294
NP_440129.1_7 Forward -15 -1 17.7975 0.287
NP_443054.1_2 Reverse -324 -338 2.16287 0.245
NP_441851.1_10 Reverse -325 -335 6.27322 0.178
NP_441851.1_10 Forward -336 -326 5.97822 0.19
NP_442208.1_5 Reverse -55 -74 -9.44032 0.295
NP_440682.1_2 Forward -76 -57 -16.8151 0.299
NP_442515.1_1 Forward -336 -322 5.40779 0.107
NP_442515.1_1 Reverse -325 -339 3.04785 0.125
NP_440593.1_3 Forward -326 -307 -3.73712 0.241
NP_440432.1_9 Forward -334 -319 4.69978 0.0652
NP_440588.1_2 Forward -89 -70 -6.09707 0.269
NP_439950.1_1 Forward -297 -288 13.2744 0.277
NP_442006.1_2 Reverse -317 -334 -9.59759 0.197
NP_441078.1_4 Reverse -326 -335 8.1612 0.039
NP_441078.1_4 Forward -335 -326 0.983037 0.151
NP_442443.1_1 Reverse -310 -329 -1.7705 0.243
NP_440526.1_3 Forward -334 -323 1.6315 0.267
NP_441432.1_8 Reverse -325 -334 6.5879 0.112
NP_442320.1_8 Reverse -320 -334 -4.91696 0.192
NP_441732.1_2 Reverse -155 -171 -8.10294 0.116
NP_442815.1_2 Reverse -307 -325 17.3254 0.0672
NP_440760.1_1 Reverse -326 -345 -21.6334 0.24
NP_440131.1_2 Reverse -61 -80 7.47261 0.279
NP_440578.1_10 Forward -254 -235 9.73422 0.282
NP_442489.1_7 Reverse -326 -335 8.1612 0.0294
NP_442489.1_7 Forward -335 -326 7.76787 0.0518
NP_440941.1_1 Reverse -309 -319 16.2046 0.252
NP_440559.1_1 Reverse -327 -336 4.32629 0.288
NP_441659.2_8 Forward -335 -325 7.45319 0.0601
NP_441659.2_8 Reverse -326 -336 0.176696 0.271
NP_439956.1_7 Reverse -300 -319 1.96607 0.276
NP_440335.1_9 Reverse -37 -55 8.96727 0.298
NP_442346.1_5 Reverse -325 -335 14.4347 0.0134
NP_442346.1_5 Forward -336 -326 7.64985 0.162
NP_440025.1_3 Forward -338 -324 20.0016 0.0481
NP_440831.1_3 Reverse -309 -328 12.503 0.139
NP_440250.1_4 Forward -307 -288 10.1267 0.213
NP_442551.1_4 Reverse -324 -339 -3.36336 0.287
NP_441358.1_2 Reverse -306 -325 5.80098 0.275
NP_441329.1_6 Reverse -117 -136 2.43462 0.227
NP_442497.1_10 Reverse -327 -336 0.393051 0.175
NP_442497.1_10 Forward -334 -325 0.196389 0.208
NP_440821.1_4 Reverse -324 -334 0.0783647 0.205
NP_441239.1_9 Reverse -324 -336 15.6736 0.0186
NP_441239.1_9 Forward -337 -325 5.84051 0.206
NP_441727.1_3 Forward -342 -323 13.3725 0.117
NP_442052.1_8 Reverse -324 -334 12.7631 0.253
NP_442052.1_8 Forward -337 -327 12.7631 0.253
NP_441848.1_4 Reverse -42 -58 9.93796 0.267
NP_442829.1_2 Reverse -270 -286 9.3007 0.287
NP_440825.1_6 Forward -62 -43 11.0125 0.282
NP_442360.1_1 Forward -144 -126 13.4905 0.291
NP_441701.1_3 Reverse -302 -319 7.02034 0.27
NP_441252.1_6 Reverse -323 -330 11.9372 0.25
NP_442532.1_4 Forward -306 -288 7.77101 0.29
NP_442533.1_1 Reverse -53 -72 -13.7669 0.238
NP_442533.1_6 Forward -335 -326 8.25953 0.0776
NP_442533.1_6 Reverse -326 -335 7.66954 0.0897
NP_442541.1_10 Forward -335 -321 6.48882 0.248
NP_442322.1_4 Forward -321 -304 5.053 0.187
NP_442202.1_6 Reverse -246 -265 0.196116 0.265
NP_441527.1_4 Reverse -121 -140 -2.14899 0.154
NP_441527.1_4 Reverse -118 -137 -3.86785 0.175
NP_441527.1_4 Reverse -123 -142 -5.30023 0.198
NP_441527.1_4 Reverse -109 -128 -8.83343 0.251
NP_441527.1_4 Reverse -198 -217 -11.2207 0.278
NP_441527.1_4 Reverse -117 -136 -11.3162 0.281
NP_001035870.1_3 Forward -234 -215 -5.11376 0.278
NP_441286.1_1 Forward -336 -324 -4.87757 0.18
NP_442674.1_3 Forward -311 -292 8.16011 0.205
NP_440670.1_8 Forward -335 -326 5.3096 0.167
NP_441930.1_2 Reverse -325 -335 15.9097 0.19
NP_440404.1_9 Reverse -114 -133 13.7982 0.195
NP_440841.1_4 Reverse -324 -343 10.3242 0.0564
NP_442615.1_1 Forward -344 -326 -3.32411 0.159
NP_441962.1_4 Forward -340 -321 -12.0953 0.252
NP_441962.1_4 Reverse -14 -33 -14.6519 0.291
NP_440855.1_1 Reverse -294 -313 5.11266 0.162
NP_441993.1_1 Forward -341 -322 13.2517 0.0868
NP_440358.1_8 Forward -354 -335 10.9142 0.112
NP_440114.1_10 Reverse -326 -340 12.586 0.0783
NP_440114.1_10 Forward -335 -321 7.07942 0.246
NP_442087.1_2 Forward -194 -175 12.4373 0.298
NP_440293.1_3 Reverse -61 -80 -3.44213 0.244
NP_439988.1_3 Reverse -225 -239 4.12949 0.295
NP_441237.1_9 Forward -334 -324 14.1397 0.0488
NP_440457.1_1 Reverse -306 -318 1.41561 0.239
NP_442680.1_5 Reverse -117 -136 -1.10006 0.299
NP_440473.1_9 Reverse -315 -334 -7.67036 0.238
NP_442514.1_5 Forward -323 -304 -9.53937 0.296
NP_440628.1_1 Reverse -118 -128 13.4873 0.279
NP_441173.1_9 Reverse -181 -189 11.0321 0.228
NP_440409.1_10 Forward -47 -28 7.96426 0.29
NP_440750.1_5 Reverse -200 -214 5.80112 0.238
NP_443046.1_7 Forward -211 -192 17.5024 0.141
NP_441105.1_3 Forward -346 -327 9.43923 0.0458
NP_440216.1_9 Reverse -111 -120 10.1278 0.286
NP_440172.1_1 Reverse -326 -336 10.3048 0.0524
NP_440172.1_1 Forward -335 -325 3.61828 0.222
NP_443052.1_8 Reverse -316 -335 -13.8652 0.299
NP_442154.1_1 Reverse -307 -325 -8.24065 0.158
NP_440261.1_7 Reverse -62 -81 -3.93378 0.209
NP_440988.1_10 Forward -79 -65 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCATTTCTGTAGATAATAAATTCCTTCCTTGCTTTAGCAGGCAAGATTGGTTCACAATTTGATTGGGCCATTGCCCCATTACCCTAACCCCCGCCAGGATTATGGAAGATTTATTAGGTTTGCTACTTTCTGAAACCGGTTTATTGGCGATAATTTATCTAGGCCTAAGCCTAGCCTATCTATTGGTTTTTCCAGCCCTTTTGTATTGGTATTTGCAAAAGCGTTGGTACGTGGCTAGTTCCGTCGAAAGACTAGTCATGTATTTTTTGGTCTTTCTCTTCTTCCCTGGGTTACTAGTGCTCAGTCCGGTGCTGAATCTACGACCCCGCCGCCAGGCTGCCTAGATTTTGCTTTTGTTTAGTCTCTAACTGAGTCGGCTGTTACTCCAGACCCAGTTGCC

CDS

GTGTTTTTTTGTTGCCCATTGTTCCCATTTGTCATCCCAGGAAAAACCACCATGCGACGCATTGATGCTTTGGCCATTGCCCTGGGTTTTTTCCTTTTGGGCGGAGTAGTTTACGCCGGATTGCAGGGTTTTGGCATCGAAGCTCAGCAGGCTGGCATTTGGACCCAAGCGGTGCTAGTGGGGGGCCTAATCATTTGGCTCCTTTCCTATGTCACTAGGGTATTTACCCACGACATGACCTATCACCAACAGATTAAAGAGTATGAAGATAAAATGATCGAACTCCGCTGGGCGAATATGACCCCAGAGGAACGGGAAAAACTCCAGGCCGAAGTGGTGGAAGAAAAGGATACATCCAGTACCTAA

Protein

MFFCCPLFPFVIPGKTTMRRIDALAIALGFFLLGGVVYAGLQGFGIEAQQAGIWTQAVLVGGLIIWLLSYVTRVFTHDMTYHQQIKEYEDKMIELRWANMTPEEREKLQAEVVEEKDTSST