Your browser is old and dusty. Try Google Chrome!

Details for slr0813

ORF slr0813
Accession NP_441441.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -57 -71 16.7159 0.0276
NP_440795.1_7 Forward -355 -348 14.6904 0.0123
NP_440795.1_7 Reverse -348 -355 14.6904 0.0123
NP_440795.1_7 Forward -64 -57 14.6904 0.0123
NP_440795.1_7 Reverse -57 -64 14.6904 0.0123
NP_440795.1_7 Forward -109 -102 7.51227 0.24
NP_441418.1_6 Reverse -56 -75 16.9124 0.0022
NP_441418.1_6 Forward -65 -46 -13.5702 0.0775
NP_441418.1_6 Reverse -347 -366 -28.9099 0.213
NP_441418.1_6 Forward -356 -337 -29.1065 0.216
NP_441418.1_6 Forward -183 -164 -29.4015 0.224
NP_441480.1_8 Forward -195 -176 14.8474 0.264
NP_442291.1_5 Forward -357 -341 -1.51476 0.199
NP_440897.1_9 Reverse -35 -53 10.8348 0.293
NP_441453.1_4 Reverse -347 -355 16.539 0.00633
NP_441453.1_4 Reverse -56 -64 16.539 0.00633
NP_441453.1_4 Forward -356 -348 16.539 0.00633
NP_441453.1_4 Forward -65 -57 16.539 0.00633
NP_442151.1_6 Reverse -347 -361 20.0591 0.0045
NP_442151.1_6 Forward -65 -51 13.4709 0.0512
NP_442151.1_6 Reverse -161 -175 11.701 0.0933
NP_442151.1_6 Reverse -174 -188 9.93102 0.137
NP_441818.1_1 Forward -64 -53 11.4645 0.177
NP_441818.1_1 Forward -278 -267 9.3996 0.246
NP_441818.1_9 Forward -257 -238 -6.09707 0.259
NP_440226.1_1 Forward -356 -337 18.0924 0.0169
NP_440226.1_1 Reverse -347 -366 9.14423 0.0768
NP_440226.1_1 Forward -65 -46 6.98095 0.115
NP_440226.1_1 Reverse -56 -75 6.19431 0.135
NP_441630.1_3 Reverse -48 -67 -0.0988766 0.285
NP_440348.1_8 Forward -51 -32 10.9142 0.295
NP_440996.1_2 Reverse -117 -126 16.126 0.248
NP_442744.1_8 Reverse -347 -366 -4.6221 0.297
NP_442287.1_3 Reverse -237 -254 21.6709 0.0202
NP_442655.1_1 Reverse -342 -361 1.47442 0.238
NP_442173.1_1 Forward -355 -347 15.4574 0.00633
NP_442173.1_1 Forward -64 -56 15.4574 0.00633
NP_442173.1_1 Reverse -348 -356 15.4574 0.00633
NP_442173.1_1 Reverse -57 -65 15.4574 0.00633
NP_442752.1_4 Forward -356 -349 13.8055 0.0199
NP_442752.1_4 Reverse -347 -354 13.8055 0.0199
NP_442752.1_4 Forward -65 -58 13.8055 0.0199
NP_442752.1_4 Reverse -56 -63 13.8055 0.0199
NP_442752.1_4 Forward -400 -393 12.4288 0.0388
NP_443027.1_4 Forward -67 -57 14.828 0.0437
NP_443027.1_4 Reverse -345 -355 13.2547 0.0521
NP_443027.1_4 Reverse -54 -64 6.46988 0.275
NP_443027.1_4 Forward -112 -102 6.27322 0.286
NP_442975.1_10 Forward -69 -55 5.50552 0.219
NP_442975.1_10 Reverse -52 -66 2.8506 0.269
NP_442975.1_10 Forward -360 -346 2.65393 0.269
NP_440784.1_7 Forward -355 -348 15.9687 0.0123
NP_440784.1_7 Reverse -348 -355 15.9687 0.0123
NP_440784.1_7 Forward -64 -57 15.9687 0.0123
NP_440784.1_7 Reverse -57 -64 15.9687 0.0123
NP_442909.1_7 Forward -64 -50 9.83206 0.14
NP_441250.1_4 Forward -395 -376 5.211 0.298
NP_440061.1_9 Forward -67 -53 17.8952 0.0117
NP_440061.1_9 Forward -358 -344 11.5037 0.109
NP_440061.1_9 Reverse -345 -359 10.5204 0.124
NP_440061.1_9 Reverse -103 -117 7.07881 0.219
NP_440061.1_9 Reverse -227 -241 6.98048 0.223
NP_440110.1_8 Reverse -54 -73 2.0644 0.211
NP_441476.1_5 Forward -70 -51 -8.16202 0.296
NP_442062.1_8 Reverse -56 -66 19.4496 0.000558
NP_442062.1_8 Forward -65 -55 17.6796 0.00193
NP_442062.1_8 Reverse -347 -357 17.3846 0.00193
NP_442062.1_8 Forward -238 -228 10.4031 0.0493
NP_442062.1_8 Forward -356 -346 10.3048 0.0493
NP_442062.1_8 Forward -379 -369 4.20827 0.228
NP_441859.1_3 Forward -66 -47 13.5683 0.0814
NP_440304.1_4 Reverse -54 -64 17.9746 0.00654
NP_440304.1_4 Forward -67 -57 10.8948 0.051
NP_440304.1_4 Reverse -345 -355 10.8948 0.051
NP_440304.1_4 Forward -172 -162 3.61828 0.295
NP_440304.1_4 Forward -358 -348 1.84832 0.299
NP_442242.1_4 Forward -355 -348 14.3954 0.0124
NP_442242.1_4 Reverse -348 -355 14.3954 0.0124
NP_442242.1_4 Forward -64 -57 14.3954 0.0124
NP_442242.1_4 Reverse -57 -64 14.3954 0.0124
NP_440011.1_1 Forward -95 -76 10.9142 0.293
NP_439918.1_2 Forward -45 -26 6.39097 0.154
NP_439918.1_2 Forward -51 -32 -1.57384 0.24
NP_439918.1_2 Forward -39 -20 -4.42544 0.277
NP_439918.1_3 Reverse -53 -72 3.14605 0.269
NP_441208.1_9 Forward -359 -345 16.5192 0.0647
NP_441208.1_9 Reverse -66 -80 7.37441 0.222
NP_441208.1_9 Reverse -53 -67 6.09611 0.253
NP_441594.1_6 Forward -192 -173 15.3391 0.0984
NP_440370.1_10 Forward -365 -346 19.5673 0.0433
NP_440132.1_1 Reverse -54 -72 13.4905 0.167
NP_442110.1_7 Reverse -347 -361 10.6193 0.0644
NP_442110.1_7 Reverse -56 -70 3.44117 0.21
NP_442110.1_7 Forward -356 -342 2.5562 0.222
NP_441082.1_10 Forward -51 -38 17.2272 0.137
NP_441082.1_10 Forward -389 -376 8.08242 0.289
NP_440300.1_1 Reverse -364 -383 13.47 0.125
NP_441925.1_4 Reverse -230 -249 1.17865 0.155
NP_440856.1_4 Reverse -340 -359 1.96607 0.157
NP_440856.1_4 Forward -72 -53 0.491109 0.167
NP_440856.1_7 Forward -230 -211 0.786102 0.165
NP_440856.1_7 Reverse -53 -72 -0.39387 0.168
NP_440856.1_7 Forward -186 -167 -0.983855 0.182
NP_441083.1_5 Reverse -347 -357 20.3345 0.00053
NP_441083.1_5 Forward -65 -55 19.3512 0.000718
NP_441083.1_5 Reverse -56 -66 11.3864 0.0159
NP_441083.1_5 Forward -356 -346 11.2881 0.0159
NP_439957.1_9 Forward -329 -310 13.2252 0.187
NP_442827.1_8 Reverse -48 -67 11.0117 0.0565
NP_442827.1_8 Forward -73 -54 0.0970122 0.215
NP_442827.1_8 Reverse -379 -398 -1.47628 0.247
NP_442827.1_8 Forward -364 -345 -1.77127 0.256
NP_441434.1_7 Forward -63 -49 22.714 0.0107
NP_441738.1_2 Forward -354 -347 15.28 0.0102
NP_441738.1_2 Reverse -349 -356 15.28 0.0102
NP_441738.1_2 Forward -63 -56 15.28 0.0102
NP_441738.1_2 Reverse -58 -65 15.28 0.0102
NP_441738.1_2 Reverse -389 -396 9.57686 0.166
NP_441738.1_2 Reverse -372 -379 6.52862 0.261
NP_441558.1_5 Reverse -345 -364 14.3558 0.0495
NP_441558.1_5 Forward -67 -48 12.3892 0.0679
NP_441558.1_5 Forward -398 -379 4.62101 0.276
NP_440209.1_1 Reverse -347 -355 18.1123 0.00295
NP_440209.1_1 Reverse -56 -64 18.1123 0.00295
NP_440209.1_1 Forward -356 -348 18.1123 0.00295
NP_440209.1_1 Forward -65 -57 18.1123 0.00295
NP_442889.1_8 Reverse -344 -358 11.307 0.0733
NP_442889.1_8 Reverse -53 -67 7.76712 0.141
NP_442889.1_8 Reverse -242 -256 6.98048 0.167
NP_442889.1_8 Reverse -367 -381 3.73557 0.273
NP_442889.1_8 Reverse -10 -24 3.04726 0.291
NP_440447.1_1 Reverse -342 -360 1.39578 0.3
NP_441713.1_1 Forward -362 -343 -7.08038 0.126
NP_440178.1_7 Reverse -346 -365 -13.6686 0.141
NP_440178.1_7 Forward -66 -47 -19.8634 0.181
NP_442570.1_3 Forward -386 -367 -7.17871 0.268
NP_442570.1_3 Reverse -172 -191 -9.34199 0.298
NP_441716.1_1 Reverse -56 -70 10.226 0.0968
NP_441716.1_1 Reverse -174 -188 5.89945 0.211
NP_441716.1_1 Reverse -347 -361 3.93283 0.259
NP_442111.1_4 Forward -357 -343 20.8458 0.00257
NP_442111.1_4 Reverse -55 -69 17.2075 0.0109
NP_442111.1_4 Reverse -346 -360 9.34103 0.0609
NP_442111.1_4 Forward -66 -52 2.5562 0.271
NP_440906.1_5 Forward -355 -348 15.8704 0.0124
NP_440906.1_5 Reverse -348 -355 15.8704 0.0124
NP_440906.1_5 Forward -64 -57 15.8704 0.0124
NP_440906.1_5 Reverse -57 -64 15.8704 0.0124
NP_440012.1_6 Forward -194 -175 15.6341 0.117
NP_440747.1_10 Forward -359 -347 24.7201 0.00036
NP_440747.1_10 Reverse -344 -356 17.1486 0.000663
NP_440747.1_10 Forward -68 -56 7.70879 0.00236
NP_440747.1_10 Reverse -53 -65 -2.02597 0.0196
NP_440747.1_10 Forward -186 -174 -12.1541 0.227
NP_440747.1_10 Reverse -171 -183 -12.2524 0.254
NP_440747.1_10 Reverse -215 -227 -12.4491 0.282
NP_441130.1_10 Forward -67 -53 12.0943 0.1
NP_441486.1_1 Forward -68 -54 4.71948 0.0415
NP_441486.1_1 Forward -359 -345 -2.45868 0.175
NP_441486.1_1 Reverse -344 -358 -2.55701 0.175
NP_441486.1_1 Reverse -28 -42 -4.7203 0.205
NP_441486.1_1 Reverse -53 -67 -6.29359 0.288
NP_442634.1_4 Reverse -54 -68 14.0609 0.0209
NP_442634.1_4 Reverse -345 -359 7.86607 0.0479
NP_442634.1_4 Forward -358 -344 -1.27871 0.149
NP_441265.1_3 Reverse -341 -355 4.52282 0.181
NP_440403.1_4 Reverse -209 -228 -0.885524 0.173
NP_440403.1_10 Reverse -338 -357 2.55606 0.279
NP_441014.1_5 Forward -361 -343 11.5239 0.258
NP_441014.1_8 Forward -70 -51 -7.08038 0.276
NP_442848.1_1 Forward -362 -348 -0.393733 0.263
NP_442848.1_1 Forward -71 -57 -1.5737 0.263
NP_442848.1_1 Reverse -50 -64 -2.65535 0.263
NP_442848.1_1 Reverse -25 -39 -3.34366 0.265
NP_442848.1_5 Reverse -245 -263 -0.275845 0.276
NP_441012.1_4 Forward -69 -56 7.19745 0.272
NP_443018.1_3 Forward -355 -348 14.8871 0.0123
NP_443018.1_3 Reverse -348 -355 14.8871 0.0123
NP_443018.1_3 Forward -64 -57 14.8871 0.0123
NP_443018.1_3 Reverse -57 -64 14.8871 0.0123
NP_441316.1_7 Forward -67 -52 -3.36336 0.273
NP_441634.1_8 Forward -89 -75 4.42448 0.127
NP_441634.1_8 Reverse -159 -173 1.96621 0.175
NP_441634.1_8 Reverse -99 -113 -2.06536 0.295
NP_441634.1_9 Forward -388 -369 8.55343 0.294
NP_440376.1_1 Forward -356 -347 19.4693 0.000692
NP_440376.1_1 Reverse -347 -356 19.4693 0.000692
NP_440376.1_1 Forward -65 -56 19.4693 0.000692
NP_440376.1_1 Reverse -56 -65 19.4693 0.000692
NP_440376.1_1 Forward -39 -30 -0.196935 0.285
NP_441857.1_5 Reverse -49 -67 2.77242 0.263
NP_441588.1_4 Reverse -349 -359 9.02648 0.14
NP_442730.1_8 Forward -364 -345 4.22689 0.273
NP_443065.1_7 Forward -181 -162 18.8781 0.136
NP_440580.1_2 Reverse -372 -390 12.0155 0.0786
NP_442687.1_7 Reverse -55 -65 18.5646 0.0028
NP_442687.1_7 Forward -66 -56 15.8113 0.0125
NP_442687.1_7 Reverse -346 -356 9.02648 0.0994
NP_442687.1_7 Forward -357 -347 8.92815 0.0994
NP_442191.1_4 Forward -355 -341 14.9684 0.073
NP_442485.1_3 Forward -76 -57 2.55606 0.209
NP_440642.1_1 Reverse -190 -209 9.0459 0.239
NP_441013.1_2 Reverse -169 -187 -4.40575 0.298
NP_441013.1_2 Reverse -259 -277 -4.60241 0.299
NP_440042.1_2 Reverse -227 -246 5.70265 0.191
NP_441422.1_7 Reverse -345 -362 -0.747806 0.168
NP_441422.1_7 Forward -67 -50 -0.846137 0.169
NP_440533.1_9 Forward -356 -337 2.85105 0.261
NP_441950.1_7 Forward -266 -247 -7.08038 0.278
NP_442296.1_9 Forward -362 -343 -0.0988766 0.197
NP_441763.1_10 Forward -76 -57 16.7149 0.0875
NP_442658.1_1 Reverse -54 -64 17.6791 0.00565
NP_442658.1_1 Forward -67 -57 15.9091 0.00966
NP_442658.1_1 Reverse -345 -355 14.2375 0.0237
NP_442658.1_1 Reverse -368 -378 8.23937 0.199
NP_442658.1_1 Reverse -227 -237 7.35439 0.214
NP_442658.1_1 Forward -358 -348 6.76441 0.214
NP_440141.1_4 Reverse -59 -78 -4.81876 0.296
NP_440141.1_8 Forward -179 -160 17.699 0.115
NP_440141.1_8 Reverse -47 -66 6.78429 0.252
NP_441855.2_4 Forward -73 -54 12.7045 0.182
NP_442782.1_2 Forward -356 -342 10.7177 0.173
NP_442782.1_2 Forward -211 -197 9.5377 0.198
NP_442782.1_2 Reverse -56 -70 0.88457 0.282
NP_442205.1_9 Reverse -50 -66 -1.80975 0.264
NP_442544.1_2 Forward -386 -372 -0.787057 0.25
NP_441414.1_9 Reverse -347 -366 -1.57384 0.102
NP_440800.1_2 Reverse -204 -223 19.6235 0.0967
NP_441487.1_9 Forward -357 -338 -0.295539 0.254
NP_441256.1_8 Forward -245 -226 5.50599 0.272
NP_442937.1_5 Reverse -51 -70 12.9791 0.0966
NP_442321.1_1 Reverse -345 -364 -6.98204 0.246
NP_441958.1_5 Reverse -346 -356 21.2195 0.000805
NP_441958.1_5 Reverse -55 -65 20.5312 0.000966
NP_441958.1_5 Forward -357 -347 12.2714 0.00183
NP_441958.1_5 Forward -66 -56 12.2714 0.00183
NP_441127.1_1 Reverse -270 -284 8.45605 0.295
NP_440203.1_5 Reverse -350 -360 14.2375 0.0886
NP_440203.1_5 Reverse -231 -241 9.12434 0.271
NP_441441.1_5 Forward -186 -167 26.1555 0.0034
NP_439905.1_1 Forward -64 -51 7.09911 0.268
NP_440984.1_7 Forward -347 -333 13.3726 0.113
NP_440984.1_7 Reverse -342 -356 10.1277 0.126
NP_440984.1_7 Forward -361 -347 9.34103 0.127
NP_440984.1_7 Reverse -51 -65 8.55439 0.142
NP_439990.1_5 Forward -361 -348 11.229 0.128
NP_442911.1_2 Forward -75 -56 15.8307 0.0103
NP_442911.1_2 Reverse -46 -65 -3.14714 0.109
NP_442911.1_2 Forward -366 -347 -4.81876 0.142
NP_442911.1_2 Reverse -337 -356 -10.0303 0.268
NP_441580.1_6 Reverse -45 -64 -9.24366 0.29
NP_440153.1_5 Forward -355 -341 5.30946 0.191
NP_440153.1_5 Reverse -348 -362 2.85119 0.219
NP_440153.1_8 Reverse -161 -174 2.18257 0.22
NP_440153.1_8 Reverse -105 -118 -2.83231 0.266
NP_442064.1_1 Forward -361 -342 -3.93378 0.178
NP_443055.1_6 Reverse -48 -66 13.4897 0.0955
NP_443055.1_6 Forward -104 -86 -2.34152 0.294
NP_440993.1_2 Forward -70 -54 10.0883 0.106
NP_440993.1_2 Reverse -342 -358 3.30346 0.259
NP_440993.1_3 Reverse -337 -356 -2.16459 0.297
NP_440602.1_2 Forward -361 -342 9.3409 0.195
NP_441099.1_5 Forward -75 -56 -8.16202 0.189
NP_441099.1_5 Reverse -46 -65 -11.6036 0.287
NP_442002.1_9 Reverse -55 -62 14.1004 0.074
NP_442002.1_9 Forward -397 -390 11.6422 0.185
NP_442002.1_9 Forward -66 -59 10.7572 0.185
NP_441294.1_7 Reverse -343 -357 10.4985 0.185
NP_441294.1_7 Forward -81 -67 9.73057 0.229
NP_441294.1_7 Reverse -241 -255 8.57871 0.294
NP_440411.1_10 Forward -306 -287 11.9207 0.26
NP_442438.1_10 Forward -70 -56 10.9143 0.0478
NP_442438.1_10 Forward -361 -347 9.04604 0.0692
NP_442438.1_10 Reverse -342 -356 4.71948 0.142
NP_441398.1_5 Forward -190 -171 9.0459 0.258
NP_441292.1_2 Forward -363 -344 3.14605 0.194
NP_441563.1_5 Forward -180 -161 21.0423 0.156
NP_441000.1_6 Reverse -55 -69 -3.04867 0.221
NP_441000.1_6 Forward -357 -343 -3.54032 0.224
NP_441000.1_6 Forward -66 -52 -5.40861 0.275
NP_442771.1_1 Reverse -54 -72 12.1139 0.0174
NP_442771.1_1 Forward -67 -49 -6.96235 0.169
NP_440484.1_3 Reverse -345 -359 10.7177 0.242
NP_440147.1_4 Forward -358 -345 18.4072 0.00407
NP_440147.1_4 Forward -67 -54 13.0973 0.0326
NP_440147.1_4 Reverse -345 -358 10.344 0.0355
NP_440147.1_4 Reverse -54 -67 2.67422 0.203
NP_441175.1_7 Reverse -347 -366 15.6341 0.0803
NP_441550.1_8 Reverse -54 -64 19.8424 0.00352
NP_441550.1_8 Reverse -345 -355 15.8108 0.0132
NP_441550.1_8 Forward -358 -348 14.6309 0.0132
NP_441550.1_8 Forward -67 -57 6.0761 0.214
NP_441916.1_7 Forward -356 -346 18.9579 0.00144
NP_441916.1_7 Reverse -56 -66 18.4663 0.00144
NP_441916.1_7 Forward -65 -55 16.893 0.00407
NP_441916.1_7 Reverse -347 -357 10.3048 0.0261
NP_441916.1_10 Reverse -339 -358 10.5209 0.148
NP_440465.1_4 Forward -380 -361 11.1109 0.245
NP_441041.1_4 Reverse -56 -75 3.53937 0.0646
NP_441041.1_4 Reverse -347 -366 3.04771 0.0679
NP_441041.1_7 Reverse -344 -356 13.3454 0.0485
NP_441041.1_7 Reverse -53 -65 12.4708 0.0611
NP_441041.1_7 Forward -359 -347 8.58373 0.133
NP_441041.1_7 Forward -68 -56 7.61196 0.162
NP_440569.1_6 Reverse -60 -79 8.16093 0.219
NP_442004.1_6 Reverse -347 -361 5.80112 0.181
NP_442004.1_6 Forward -189 -175 4.62115 0.208
NP_441725.1_4 Reverse -342 -356 4.03056 0.278
NP_441725.1_4 Forward -70 -56 3.63724 0.278
NP_441725.1_5 Forward -64 -54 18.7612 0.0119
NP_441725.1_5 Reverse -57 -67 11.2881 0.0247
NP_441725.1_5 Reverse -348 -358 2.04498 0.115
NP_441725.1_5 Forward -355 -345 1.94665 0.115
NP_441725.1_5 Forward -378 -368 -1.29827 0.299
NP_439966.1_7 Forward -67 -57 18.4657 0.00473
NP_439966.1_7 Reverse -345 -355 14.3359 0.0203
NP_439966.1_7 Forward -281 -271 11.091 0.0741
NP_439966.1_7 Reverse -368 -378 9.51767 0.109
NP_439966.1_7 Reverse -54 -64 8.14104 0.14
NP_439966.1_7 Forward -358 -348 7.25606 0.15
NP_439966.1_9 Forward -67 -58 0.983037 0.253
NP_439966.1_9 Reverse -54 -63 0.983037 0.253
NP_442941.1_3 Forward -355 -345 19.2529 0.00262
NP_442941.1_3 Reverse -57 -67 11.4848 0.0116
NP_442941.1_3 Reverse -348 -358 11.0914 0.0116
NP_442941.1_3 Forward -64 -54 2.43831 0.14
NP_440674.1_3 Forward -194 -175 3.6377 0.26
NP_440674.1_3 Forward -393 -374 1.86774 0.273
NP_440289.1_2 Forward -68 -55 14.6706 0.0107
NP_440289.1_2 Reverse -53 -66 4.73917 0.0649
NP_440289.1_2 Reverse -344 -357 3.16588 0.0811
NP_440260.1_8 Forward -192 -174 4.54237 0.154
NP_440260.1_8 Reverse -338 -356 -3.32411 0.251
NP_440260.1_8 Forward -365 -347 -4.8974 0.273
NP_440260.1_8 Forward -37 -19 -7.45401 0.295
NP_442281.1_1 Forward -70 -56 20.4518 0.00192
NP_442281.1_1 Forward -361 -347 17.6002 0.00542
NP_442281.1_1 Reverse -51 -65 8.75042 0.0764
NP_442281.1_1 Reverse -342 -356 8.55376 0.0798
NP_442281.1_1 Forward -141 -127 7.96378 0.089
NP_442281.1_1 Reverse -224 -238 3.93223 0.213
NP_442281.1_1 Reverse -365 -379 2.45727 0.266
NP_441334.1_7 Forward -358 -339 -4.6221 0.12
NP_441334.1_7 Reverse -345 -364 -20.65 0.277
NP_442575.1_8 Forward -176 -157 -2.75381 0.242
NP_442256.1_2 Reverse -54 -72 1.69077 0.107
NP_442256.1_2 Reverse -345 -363 -6.56903 0.214
NP_440437.1_1 Forward -71 -52 8.45592 0.0559
NP_440437.1_1 Reverse -341 -360 -2.16383 0.212
NP_440647.1_9 Forward -358 -340 3.16574 0.281
NP_442012.1_1 Forward -84 -65 18.7807 0.0354
NP_442012.1_1 Forward -71 -52 11.4058 0.0742
NP_442012.1_1 Reverse -341 -360 2.65439 0.196
NP_442012.1_1 Reverse -156 -175 0.58944 0.235
NP_441556.1_10 Forward -361 -347 14.018 0.178
NP_440498.1_1 Reverse -338 -356 7.68896 0.0827
NP_442982.1_5 Reverse -337 -356 7.07928 0.135
NP_441644.1_6 Forward -356 -346 19.0557 0.000803
NP_441644.1_6 Reverse -347 -357 17.3841 0.00127
NP_441644.1_6 Forward -65 -55 15.7125 0.0048
NP_441644.1_6 Reverse -56 -66 10.1076 0.0628
NP_441644.1_6 Forward -279 -269 3.22451 0.293
NP_442215.1_2 Reverse -345 -361 7.63002 0.0678
NP_442215.1_2 Forward -358 -342 6.05672 0.074
NP_442215.1_2 Reverse -54 -70 -4.85801 0.24
NP_442177.1_5 Forward -49 -35 11.701 0.22
NP_442029.1_6 Forward -361 -342 18.289 0.0759
NP_442029.1_6 Reverse -51 -70 7.57094 0.223
NP_442029.1_6 Reverse -342 -361 6.39097 0.238
NP_442029.1_10 Forward -359 -340 4.42435 0.292
NP_440253.1_2 Reverse -56 -74 4.44404 0.104
NP_440253.1_2 Forward -65 -47 1.59244 0.157
NP_440929.1_8 Forward -356 -347 19.2726 0.000701
NP_440929.1_8 Reverse -347 -356 19.2726 0.000701
NP_440929.1_8 Forward -65 -56 19.2726 0.000701
NP_440929.1_8 Reverse -56 -65 19.2726 0.000701
NP_442933.1_10 Forward -356 -347 17.601 0.00325
NP_442933.1_10 Reverse -347 -356 17.601 0.00325
NP_442933.1_10 Forward -65 -56 17.601 0.00325
NP_442933.1_10 Reverse -56 -65 17.601 0.00325
NP_441751.2_8 Forward -355 -341 7.27608 0.0339
NP_441751.2_8 Reverse -57 -71 -0.197071 0.125
NP_441751.2_8 Forward -64 -50 -5.21195 0.199
NP_440096.1_5 Forward -377 -358 7.66927 0.259
NP_442554.1_4 Forward -218 -199 11.4058 0.25
NP_442554.1_8 Forward -355 -345 17.2863 0.00543
NP_442554.1_8 Forward -64 -54 16.9913 0.0065
NP_442554.1_8 Reverse -348 -358 15.3197 0.00882
NP_442554.1_8 Reverse -57 -67 13.8447 0.0145
NP_441762.1_7 Forward -66 -54 11.7404 0.0142
NP_441762.1_7 Reverse -55 -67 11.4454 0.0142
NP_441762.1_7 Reverse -346 -358 0.530633 0.0747
NP_441762.1_7 Forward -397 -385 -4.68091 0.181
NP_441762.1_7 Forward -357 -345 -6.84419 0.284
NP_442313.1_4 Reverse -202 -221 6.78429 0.288
NP_442142.1_4 Reverse -344 -357 12.9 0.0406
NP_442142.1_4 Forward -359 -346 12.8017 0.0409
NP_442142.1_4 Forward -68 -55 10.4418 0.0724
NP_442142.1_4 Reverse -53 -66 6.50855 0.163
NP_442292.1_1 Reverse -348 -357 18.486 0.00229
NP_442292.1_1 Forward -355 -346 17.5026 0.00435
NP_442292.1_1 Reverse -57 -66 9.63616 0.0183
NP_442292.1_1 Forward -64 -55 9.53783 0.0183
NP_442292.1_5 Forward -82 -63 0.491109 0.257
NP_442476.1_6 Forward -64 -50 8.75105 0.098
NP_442476.1_6 Forward -355 -341 1.27789 0.223
NP_442476.1_6 Reverse -348 -362 0.786239 0.244
NP_442476.1_6 Reverse -230 -244 -0.197071 0.29
NP_442381.1_8 Forward -68 -49 -14.3569 0.28
NP_441711.1_8 Reverse -184 -201 19.1151 0.174
NP_443009.1_5 Reverse -55 -66 20.6093 0.001
NP_443009.1_5 Forward -357 -346 14.5128 0.02
NP_443009.1_5 Forward -239 -228 11.6612 0.0602
NP_443009.1_5 Reverse -346 -357 10.1862 0.0792
NP_443009.1_5 Forward -66 -55 9.10461 0.0965
NP_442301.1_2 Forward -72 -53 3.73524 0.288
NP_442408.2_1 Reverse -56 -75 -0.983855 0.234
NP_441715.1_4 Forward -355 -345 16.7946 0.0106
NP_441715.1_4 Reverse -57 -67 16.303 0.0117
NP_441715.1_4 Reverse -348 -358 7.94484 0.107
NP_441448.1_1 Reverse -169 -188 6.19431 0.251
NP_441198.1_8 Reverse -54 -64 15.2245 0.0427
NP_441198.1_8 Forward -240 -230 11.8064 0.183
NP_440464.1_10 Reverse -348 -358 13.0082 0.169
NP_441468.1_1 Forward -355 -348 15.8704 0.0124
NP_441468.1_1 Reverse -348 -355 15.8704 0.0124
NP_441468.1_1 Forward -64 -57 15.8704 0.0124
NP_441468.1_1 Reverse -57 -64 15.8704 0.0124
NP_441020.2_6 Reverse -54 -71 25.0149 0.000186
NP_441020.2_6 Forward -67 -50 16.7551 0.025
NP_441020.2_6 Forward -358 -341 9.87194 0.159
NP_441015.1_10 Reverse -51 -70 -3.3438 0.189
NP_441015.1_10 Forward -188 -169 -3.73712 0.191
NP_441015.1_10 Forward -361 -342 -5.01543 0.215
NP_441015.1_10 Reverse -342 -361 -6.68705 0.253
NP_441015.1_10 Reverse -175 -194 -11.0136 0.29
NP_441673.1_1 Forward -356 -347 20.8459 0.000698
NP_441673.1_1 Reverse -347 -356 20.8459 0.000698
NP_441673.1_1 Forward -65 -56 20.8459 0.000698
NP_441673.1_1 Reverse -56 -65 20.8459 0.000698
NP_441731.1_3 Forward -73 -54 -5.01543 0.284
NP_441956.1_9 Forward -363 -344 4.42435 0.277
NP_441426.1_4 Reverse -269 -288 2.3594 0.29
NP_441826.1_2 Forward -362 -348 14.5526 0.0196
NP_441826.1_2 Forward -71 -57 10.521 0.0471
NP_441826.1_2 Reverse -381 -395 0.196253 0.194
NP_441826.1_2 Reverse -341 -355 -3.34366 0.284
NP_441330.1_1 Reverse -342 -361 5.211 0.0304
NP_441330.1_1 Reverse -51 -70 -13.2752 0.183
NP_442490.1_9 Forward -195 -176 -3.83545 0.247
NP_442868.1_6 Reverse -54 -64 16.7946 0.0131
NP_442868.1_6 Reverse -345 -355 10.4031 0.038
NP_442868.1_6 Forward -358 -348 9.81313 0.038
NP_442868.1_6 Forward -67 -57 0.963343 0.205
NP_441056.1_1 Reverse -56 -75 -5.40875 0.26
NP_441612.1_2 Reverse -347 -357 8.54929 0.21
NP_441612.1_2 Reverse -174 -184 7.67797 0.249
NP_442361.1_3 Forward -71 -58 17.1289 0.0481
NP_442361.1_3 Forward -362 -349 14.0806 0.129
NP_442427.1_8 Reverse -47 -66 15.9291 0.078
NP_442808.1_1 Forward -66 -56 18.4657 0.00201
NP_442808.1_1 Reverse -346 -356 8.73102 0.0481
NP_442808.1_1 Reverse -55 -65 8.73102 0.0481
NP_442808.1_1 Forward -357 -347 8.63269 0.0481
NP_442808.1_1 Forward -280 -270 7.94438 0.0634
NP_442808.1_1 Reverse -77 -87 2.43787 0.266
NP_442808.1_1 Forward -79 -69 2.04455 0.279
NP_441101.1_1 Reverse -54 -72 17.1287 0.226
NP_442775.1_6 Reverse -57 -76 16.1257 0.236
NP_440145.1_3 Forward -366 -347 18.9773 0.00887
NP_440145.1_3 Reverse -337 -356 11.8975 0.0334
NP_442542.1_2 Reverse -54 -67 13.9823 0.114
NP_442050.1_5 Reverse -345 -355 15.9091 0.0091
NP_442050.1_5 Reverse -54 -64 14.9258 0.0175
NP_442050.1_5 Forward -67 -57 9.12434 0.193
NP_442050.1_5 Forward -358 -348 7.64939 0.243
NP_442342.1_9 Reverse -54 -70 5.17175 0.241
NP_441114.1_3 Reverse -230 -239 7.57121 0.231
NP_440558.1_2 Reverse -338 -357 6.68596 0.13
NP_440558.1_2 Forward -37 -18 -3.63879 0.237
NP_440558.1_2 Reverse -102 -121 -5.31042 0.256
NP_442789.1_4 Reverse -172 -191 0.687771 0.189
NP_442789.1_4 Reverse -54 -73 -1.37718 0.219
NP_441518.1_4 Reverse -154 -173 0.588665 0.299
NP_441878.1_6 Reverse -55 -65 20.2362 0.0046
NP_441878.1_6 Reverse -346 -356 10.5014 0.0176
NP_441878.1_6 Forward -357 -347 10.4031 0.0176
NP_441878.1_6 Forward -66 -56 10.4031 0.0176
NP_441878.1_6 Reverse -68 -78 -7.59145 0.245
NP_441878.1_6 Forward -171 -161 -7.78811 0.266
NP_441036.1_8 Forward -66 -56 17.7779 0.000554
NP_441036.1_8 Reverse -346 -356 15.713 0.00724
NP_441036.1_8 Reverse -55 -65 8.4365 0.174
NP_441036.1_8 Forward -357 -347 8.33817 0.174
NP_442650.1_2 Reverse -347 -361 8.25939 0.13
NP_441557.1_5 Forward -356 -347 19.9609 0.000699
NP_441557.1_5 Reverse -347 -356 19.9609 0.000699
NP_441557.1_5 Forward -65 -56 19.9609 0.000699
NP_441557.1_5 Reverse -56 -65 19.9609 0.000699
NP_441445.1_1 Reverse -47 -66 5.70265 0.165
NP_441445.1_1 Forward -37 -18 1.86774 0.247
NP_441445.1_1 Forward -236 -217 1.17943 0.259
NP_442066.2_4 Reverse -347 -366 -6.39206 0.253
NP_442419.1_2 Forward -70 -51 0.884433 0.238
NP_442419.1_2 Reverse -51 -70 -0.688862 0.246
NP_441308.1_8 Forward -67 -57 10.1081 0.22
NP_440101.1_3 Reverse -342 -361 16.6174 0.0483
NP_440101.1_3 Reverse -169 -188 6.88262 0.181
NP_442183.1_1 Reverse -56 -70 19.1741 0.0065
NP_442183.1_1 Forward -65 -51 16.0275 0.0167
NP_442183.1_9 Reverse -273 -283 10.7964 0.268
NP_442166.1_7 Forward -355 -341 10.6193 0.19
NP_440440.1_2 Reverse -226 -245 13.8633 0.282
NP_442135.1_8 Reverse -359 -377 9.26226 0.264
NP_441574.1_1 Reverse -56 -75 -7.17871 0.286
NP_441549.1_9 Forward -360 -342 -4.01242 0.198
NP_442347.1_2 Reverse -348 -357 12.4878 0.056
NP_442347.1_2 Reverse -57 -66 11.1111 0.056
NP_442347.1_2 Reverse -102 -111 4.42462 0.284
NP_442347.1_2 Reverse -371 -380 3.63797 0.284
NP_442347.1_2 Forward -355 -346 3.34298 0.284
NP_442347.1_2 Forward -64 -55 3.34298 0.284
NP_442645.1_2 Reverse -339 -358 -12.4886 0.144
NP_442645.1_2 Forward -364 -345 -13.7669 0.164
NP_442645.1_2 Reverse -48 -67 -20.5517 0.288
NP_441037.1_4 Reverse -54 -64 18.9151 0.00351
NP_441037.1_4 Forward -172 -162 11.3134 0.156
NP_441037.1_4 Forward -358 -348 7.9999 0.237
NP_441037.1_4 Reverse -345 -355 7.22024 0.237
NP_441037.1_4 Forward -67 -57 7.02532 0.237
NP_442594.1_7 Forward -76 -57 5.30853 0.244
NP_442317.1_6 Forward -70 -51 6.39097 0.238
NP_441633.1_3 Forward -67 -54 15.4572 0.0103
NP_441633.1_3 Reverse -227 -240 4.24752 0.0699
NP_441633.1_3 Forward -358 -345 1.10092 0.109
NP_441633.1_3 Reverse -345 -358 -3.71729 0.177
NP_441633.1_3 Reverse -159 -172 -3.71729 0.177
NP_441633.1_3 Reverse -54 -67 -5.88057 0.236
NP_441633.1_8 Forward -189 -170 15.4374 0.235
NP_440136.1_2 Forward -355 -348 15.9687 0.0123
NP_440136.1_2 Reverse -348 -355 15.9687 0.0123
NP_440136.1_2 Forward -64 -57 15.9687 0.0123
NP_440136.1_2 Reverse -57 -64 15.9687 0.0123
NP_440136.1_2 Forward -378 -371 11.1505 0.0519
NP_442590.1_10 Reverse -340 -359 5.70265 0.258
NP_442998.1_5 Reverse -384 -394 10.6981 0.206
NP_442998.1_10 Forward -354 -347 15.5754 0.0102
NP_442998.1_10 Reverse -349 -356 15.5754 0.0102
NP_442998.1_10 Forward -63 -56 15.5754 0.0102
NP_442998.1_10 Reverse -58 -65 15.5754 0.0102
NP_440299.1_1 Forward -360 -347 22.3398 0.000547
NP_440299.1_1 Forward -69 -56 20.1765 0.00128
NP_440299.1_1 Reverse -52 -65 9.36014 0.0728
NP_440299.1_1 Reverse -343 -356 7.39353 0.113
NP_441799.1_1 Reverse -343 -357 15.6336 0.0172
NP_441799.1_1 Reverse -52 -66 13.8636 0.0293
NP_441799.1_1 Forward -360 -346 9.83206 0.0838
NP_441799.1_4 Reverse -246 -265 14.0608 0.0349
NP_441007.1_10 Reverse -51 -64 11.229 0.0646
NP_441007.1_10 Reverse -342 -355 1.39592 0.203
NP_441007.1_10 Forward -361 -348 -0.669033 0.287
NP_442201.1_2 Forward -199 -180 19.0887 0.142
NP_442201.1_10 Forward -367 -348 -4.52377 0.152
NP_440256.1_1 Forward -359 -340 8.06259 0.0239
NP_440256.1_1 Forward -68 -49 -0.885524 0.0979
NP_440256.1_1 Reverse -344 -363 -3.04881 0.126
NP_440256.1_1 Forward -127 -108 -9.24366 0.275
NP_440256.1_1 Reverse -267 -286 -9.34199 0.278
NP_440256.1_1 Forward -186 -167 -9.93197 0.291
NP_441512.1_4 Reverse -343 -362 9.53756 0.239
NP_441559.1_8 Reverse -342 -356 8.65272 0.0676
NP_441559.1_8 Forward -70 -56 2.5562 0.143
NP_441559.1_8 Reverse -169 -183 -5.60527 0.267
NP_441559.1_8 Forward -361 -347 -6.88358 0.281
NP_441559.1_8 Forward -222 -208 -7.08024 0.283
NP_440915.1_6 Forward -69 -55 13.4709 0.0187
NP_440915.1_6 Forward -360 -346 12.7826 0.0206
NP_440915.1_6 Reverse -343 -357 7.86607 0.0637
NP_440915.1_6 Reverse -52 -66 5.40779 0.0903
NP_442158.1_4 Forward -269 -259 12.0747 0.259
NP_441179.1_1 Forward -68 -49 3.53937 0.247
NP_440717.1_3 Forward -284 -270 10.8154 0.23
NP_442785.1_7 Reverse -345 -359 10.7177 0.228
NP_442866.1_1 Reverse -51 -70 -2.75381 0.214
NP_442866.1_1 Reverse -342 -361 -6.98204 0.263
NP_441464.1_8 Forward -65 -51 19.2725 0.0644
NP_440026.1_7 Reverse -342 -357 16.6962 0.159
NP_442150.1_2 Reverse -90 -109 15.2808 0.298
NP_441939.1_3 Forward -64 -45 8.45592 0.173
NP_441939.1_3 Forward -395 -376 5.60432 0.273
NP_441199.1_6 Forward -69 -50 17.5024 0.0257
NP_441494.1_6 Forward -243 -230 9.55739 0.227
NP_442993.1_1 Forward -211 -195 -9.47957 0.186
NP_440677.1_1 Forward -180 -161 6.68596 0.258
NP_442386.1_9 Forward -66 -57 15.7322 0.0144
NP_442386.1_9 Forward -357 -348 13.8639 0.0289
NP_442386.1_9 Reverse -369 -378 7.96411 0.213
NP_442386.1_9 Reverse -346 -355 6.39082 0.219
NP_442386.1_9 Reverse -55 -64 6.39082 0.219
NP_442386.1_9 Reverse -228 -237 5.89917 0.233
NP_442386.1_10 Reverse -270 -283 3.95252 0.266
NP_441750.1_4 Forward -69 -50 11.3075 0.145
NP_441340.1_5 Forward -355 -348 15.6737 0.0124
NP_441340.1_5 Reverse -348 -355 15.6737 0.0124
NP_441340.1_5 Forward -64 -57 15.6737 0.0124
NP_441340.1_5 Reverse -57 -64 15.6737 0.0124
NP_442484.1_2 Reverse -163 -182 3.14605 0.21
NP_440168.1_9 Reverse -54 -73 -0.787193 0.273
NP_442240.1_2 Reverse -348 -367 -0.000545616 0.0609
NP_442240.1_2 Forward -355 -336 -20.4534 0.295
NP_440161.1_3 Reverse -54 -73 10.2259 0.23
NP_440586.1_1 Reverse -52 -71 -6.1954 0.297
NP_440586.1_8 Forward -355 -348 13.2151 0.026
NP_440586.1_8 Forward -64 -57 13.2151 0.026
NP_440586.1_8 Reverse -348 -355 13.2151 0.026
NP_440586.1_8 Reverse -57 -64 13.2151 0.026
NP_440586.1_8 Forward -188 -181 5.8403 0.283
NP_442251.1_6 Forward -355 -348 15.2804 0.0124
NP_442251.1_6 Reverse -348 -355 15.2804 0.0124
NP_442251.1_6 Forward -64 -57 15.2804 0.0124
NP_442251.1_6 Reverse -57 -64 15.2804 0.0124
NP_442251.1_6 Reverse -388 -395 9.77388 0.162
NP_441262.1_3 Reverse -347 -354 14.7888 0.0223
NP_441262.1_3 Reverse -56 -63 14.7888 0.0223
NP_441262.1_3 Forward -356 -349 14.7888 0.0223
NP_441262.1_3 Forward -65 -58 14.7888 0.0223
NP_440027.1_3 Forward -366 -348 5.72158 0.237
NP_440027.1_3 Reverse -337 -355 4.04996 0.262
NP_443051.1_1 Reverse -346 -355 19.5676 0.00335
NP_443051.1_1 Reverse -55 -64 18.0926 0.00402
NP_443051.1_1 Forward -357 -348 10.4228 0.00754
NP_443051.1_1 Forward -66 -57 10.4228 0.00754
NP_439937.1_8 Reverse -54 -73 -5.01543 0.286
NP_439937.1_9 Forward -66 -49 -16.2847 0.287
NP_440439.1_1 Forward -68 -55 17.5222 0.0105
NP_440439.1_1 Reverse -344 -357 10.934 0.0339
NP_440439.1_1 Reverse -53 -66 1.39592 0.156
NP_440439.1_1 Forward -359 -346 0.0192843 0.203
NP_439943.1_7 Forward -361 -342 15.5357 0.0929
NP_440372.1_2 Forward -355 -348 16.3621 0.0124
NP_440372.1_2 Reverse -348 -355 16.3621 0.0124
NP_440372.1_2 Forward -64 -57 16.3621 0.0124
NP_440372.1_2 Reverse -57 -64 16.3621 0.0124
NP_441181.1_6 Reverse -57 -75 9.0656 0.219
NP_440819.1_5 Reverse -194 -202 8.08256 0.185
NP_440316.1_10 Reverse -269 -279 8.73149 0.239
NP_441803.1_2 Forward -70 -51 6.09597 0.159
NP_439977.1_5 Forward -71 -52 -0.0988766 0.217
NP_439977.1_5 Reverse -341 -360 -0.4922 0.227
NP_439977.1_5 Reverse -50 -69 -3.3438 0.299
NP_440139.1_1 Reverse -50 -69 8.84842 0.108
NP_440139.1_1 Reverse -341 -360 4.12856 0.19
NP_441572.1_7 Reverse -341 -360 3.44104 0.117
NP_441572.1_7 Forward -362 -343 1.67108 0.146
NP_441572.1_7 Reverse -168 -187 -4.52377 0.238
NP_440267.1_2 Reverse -342 -356 19.5668 0.0168
NP_442384.1_10 Forward -356 -343 17.9155 0.00564
NP_442384.1_10 Reverse -347 -360 17.4239 0.00585
NP_442384.1_10 Reverse -56 -69 15.7522 0.00946
NP_442384.1_10 Forward -183 -170 5.03416 0.139
NP_442384.1_10 Reverse -174 -187 4.05085 0.17
NP_442384.1_10 Forward -65 -52 3.26421 0.197
NP_441877.1_7 Forward -70 -51 -0.0996487 0.279
NP_441018.1_7 Forward -50 -31 8.06259 0.256
NP_441018.1_7 Forward -44 -25 6.19431 0.297
NP_442790.1_4 Forward -74 -55 -14.0619 0.271
NP_442262.1_10 Forward -355 -348 14.1988 0.0123
NP_442262.1_10 Reverse -348 -355 14.1988 0.0123
NP_442262.1_10 Forward -64 -57 14.1988 0.0123
NP_442262.1_10 Reverse -57 -64 14.1988 0.0123
NP_441689.1_5 Forward -67 -57 8.53436 0.132
NP_441689.1_5 Reverse -345 -355 8.3377 0.132
NP_441689.1_5 Forward -358 -348 5.78111 0.197
NP_440163.1_10 Forward -68 -58 16.303 0.0762
NP_440344.1_10 Forward -72 -55 0.530496 0.0353
NP_440344.1_10 Reverse -49 -66 -3.8944 0.0889
NP_440282.1_3 Reverse -291 -310 -4.6221 0.298
NP_440282.1_10 Reverse -170 -189 0.884433 0.182
NP_440531.1_6 Reverse -172 -191 -3.44213 0.266
NP_440531.1_6 Reverse -339 -358 -3.73712 0.27
NP_442123.1_3 Forward -65 -46 16.9124 0.0891
NP_441965.1_10 Reverse -53 -69 9.89163 0.114
NP_441965.1_10 Forward -192 -176 5.6634 0.199
NP_441965.1_10 Reverse -344 -360 3.79511 0.253
NP_441965.1_10 Reverse -75 -91 2.8118 0.282
NP_441640.1_8 Reverse -57 -76 -4.42544 0.265
NP_442693.1_6 Reverse -341 -360 -1.08219 0.297
NP_440297.1_9 Forward -64 -54 9.51814 0.0917
NP_440297.1_9 Reverse -57 -67 9.32148 0.0917
NP_440297.1_9 Reverse -348 -358 -0.118297 0.282
NP_440297.1_9 Forward -355 -345 -0.216628 0.282
NP_440100.1_3 Reverse -340 -359 -0.0988766 0.166
NP_441896.1_3 Reverse -47 -66 14.3558 0.0587
NP_441103.1_2 Forward -367 -349 8.86816 0.178
NP_440650.1_8 Forward -92 -73 15.0441 0.211
NP_440894.1_10 Reverse -169 -188 9.83255 0.155
NP_440894.1_10 Forward -82 -63 3.04771 0.279
NP_443036.1_1 Forward -283 -264 8.94676 0.287
NP_440834.1_2 Forward -187 -168 10.9134 0.296
NP_442078.1_3 Reverse -376 -395 7.27514 0.186
NP_440999.1_2 Reverse -209 -228 11.7992 0.211
NP_440999.1_9 Forward -69 -55 10.9143 0.0483
NP_440999.1_9 Reverse -170 -184 1.96621 0.156
NP_440999.1_9 Forward -360 -346 0.687908 0.177
NP_440999.1_9 Reverse -343 -357 0.687908 0.177
NP_440999.1_9 Reverse -2 -16 -3.44199 0.293
NP_440888.1_2 Forward -356 -342 15.1419 0.0122
NP_440888.1_2 Reverse -56 -70 14.9452 0.0137
NP_440888.1_2 Reverse -347 -361 10.717 0.0861
NP_440888.1_2 Forward -65 -51 9.04542 0.139
NP_440888.1_2 Forward -279 -265 7.27547 0.202
NP_440888.1_2 Reverse -164 -178 7.07881 0.208
NP_440803.1_10 Reverse -380 -399 16.4207 0.18
NP_440792.1_5 Forward -355 -336 9.24257 0.237
NP_440600.1_4 Forward -364 -346 1.00246 0.131
NP_439969.1_3 Forward -361 -342 8.55425 0.126
NP_442033.1_10 Reverse -345 -364 -7.86702 0.186
NP_441543.1_2 Reverse -57 -66 18.486 0.00236
NP_441543.1_2 Reverse -348 -357 16.9127 0.00359
NP_441543.1_2 Forward -355 -346 15.9293 0.00518
NP_441543.1_2 Reverse -246 -255 9.73449 0.0818
NP_441543.1_2 Forward -64 -55 9.34117 0.0818
NP_441543.1_2 Forward -182 -173 4.0313 0.293
NP_442845.1_2 Reverse -174 -188 9.83269 0.165
NP_442845.1_2 Reverse -347 -361 7.37441 0.195
NP_442845.1_2 Forward -362 -348 5.80112 0.224
NP_441178.1_4 Reverse -340 -359 11.8975 0.21
NP_441319.1_6 Reverse -113 -132 12.4875 0.277
NP_441319.1_8 Forward -71 -53 7.09898 0.263
NP_441469.1_8 Forward -66 -57 16.126 0.00797
NP_441469.1_8 Reverse -369 -378 13.7661 0.0719
NP_441469.1_8 Reverse -55 -64 13.3727 0.073
NP_441469.1_8 Reverse -228 -237 12.5861 0.102
NP_441469.1_8 Reverse -346 -355 6.5879 0.227
NP_441469.1_8 Forward -357 -348 6.48957 0.227
NP_443064.1_6 Forward -65 -55 13.8273 0.0796
NP_443064.1_6 Reverse -347 -357 12.5669 0.0796
NP_443064.1_6 Forward -356 -346 10.8217 0.13
NP_442578.1_7 Forward -355 -348 14.5921 0.026
NP_442578.1_7 Forward -64 -57 14.5921 0.026
NP_442578.1_7 Reverse -348 -355 14.5921 0.026
NP_442578.1_7 Reverse -57 -64 14.5921 0.026
NP_440710.1_1 Reverse -339 -357 9.36059 0.0983
NP_440710.1_1 Reverse -237 -255 -8.43732 0.264
NP_440071.1_5 Reverse -171 -190 12.7825 0.179
NP_440220.1_4 Reverse -216 -235 0.490334 0.248
NP_441462.1_2 Forward -356 -346 20.2362 0.000805
NP_441462.1_2 Forward -65 -55 20.1379 0.000967
NP_441462.1_2 Reverse -347 -357 11.5831 0.00406
NP_441462.1_2 Reverse -56 -66 11.5831 0.00406
NP_441621.1_4 Reverse -313 -326 12.114 0.285
NP_441621.1_7 Reverse -54 -68 14.2576 0.0266
NP_441621.1_7 Forward -67 -53 -3.24533 0.188
NP_441621.1_7 Reverse -76 -90 -5.11362 0.248
NP_441621.1_7 Forward -358 -344 -5.21195 0.248
NP_443062.1_1 Reverse -347 -365 14.1038 0.0528
NP_443062.1_1 Forward -356 -338 10.0085 0.122
NP_443062.1_1 Reverse -56 -74 7.86337 0.166
NP_443062.1_6 Forward -73 -54 14.0608 0.088
NP_442204.1_1 Reverse -343 -354 11.3667 0.0565
NP_442204.1_1 Forward -69 -58 9.69511 0.0736
NP_442204.1_1 Forward -360 -349 8.7118 0.0852
NP_442204.1_1 Reverse -107 -118 1.92696 0.266
NP_442204.1_5 Forward -180 -161 1.86774 0.225
NP_442204.1_5 Reverse -360 -379 1.57275 0.232
NP_442204.1_6 Forward -123 -104 4.62101 0.287
NP_441560.1_10 Forward -364 -345 5.60432 0.292
NP_440516.1_8 Forward -356 -347 16.9127 0.00442
NP_440516.1_8 Reverse -347 -356 16.9127 0.00442
NP_440516.1_8 Forward -65 -56 16.9127 0.00442
NP_440516.1_8 Reverse -56 -65 16.9127 0.00442
NP_440516.1_8 Reverse -270 -279 -0.295266 0.232
NP_442428.1_5 Forward -355 -348 15.8704 0.0124
NP_442428.1_5 Reverse -348 -355 15.8704 0.0124
NP_442428.1_5 Forward -64 -57 15.8704 0.0124
NP_442428.1_5 Reverse -57 -64 15.8704 0.0124
NP_442120.1_10 Forward -211 -192 0.786102 0.156
NP_442120.1_10 Forward -104 -85 -8.55534 0.237
NP_442120.1_10 Reverse -196 -215 -13.7669 0.288
NP_441867.1_2 Reverse -292 -311 -19.6667 0.291
NP_440673.1_2 Forward -199 -180 8.73121 0.263
NP_440673.1_2 Forward -165 -146 8.63366 0.264
NP_440673.1_2 Reverse -46 -65 7.95079 0.286
NP_440673.1_3 Forward -354 -347 12.4288 0.0426
NP_440673.1_3 Forward -63 -56 12.4288 0.0426
NP_440673.1_3 Reverse -349 -356 12.4288 0.0426
NP_440673.1_3 Reverse -58 -65 12.4288 0.0426
NP_440865.1_9 Reverse -50 -69 3.44104 0.0986
NP_441052.1_2 Reverse -347 -357 19.9412 0.00106
NP_441052.1_2 Reverse -56 -66 10.5014 0.0285
NP_441052.1_2 Forward -356 -346 10.4031 0.0285
NP_441052.1_2 Forward -65 -55 10.4031 0.0285
NP_441052.1_2 Reverse -174 -184 5.09324 0.132
NP_441052.1_2 Reverse -245 -255 4.60159 0.154
NP_441052.1_2 Forward -183 -173 1.94665 0.221
NP_442219.1_9 Reverse -348 -357 17.7976 0.00718
NP_442219.1_9 Reverse -57 -66 8.35786 0.0681
NP_442219.1_9 Forward -355 -346 8.25953 0.0681
NP_442219.1_9 Forward -64 -55 8.25953 0.0681
NP_440436.1_4 Reverse -57 -66 18.1905 0.00233
NP_440436.1_4 Reverse -348 -357 17.2072 0.00233
NP_440436.1_4 Forward -64 -55 15.9289 0.00508
NP_440436.1_4 Forward -355 -346 9.24241 0.0871
NP_441884.1_9 Reverse -53 -72 -15.4385 0.138
NP_441884.1_9 Forward -399 -380 -22.3217 0.277
NP_441719.1_4 Forward -355 -348 16.3621 0.0124
NP_441719.1_4 Reverse -348 -355 16.3621 0.0124
NP_441719.1_4 Forward -64 -57 16.3621 0.0124
NP_441719.1_4 Reverse -57 -64 16.3621 0.0124
NP_441733.1_10 Reverse -53 -66 16.6372 0.0423
NP_441733.1_10 Forward -68 -55 6.01747 0.203
NP_441004.1_1 Reverse -50 -69 1.57275 0.111
NP_441004.1_1 Reverse -203 -222 -15.2418 0.273
NP_441004.1_4 Forward -249 -239 10.3048 0.254
NP_442813.1_4 Forward -132 -113 4.62101 0.197
NP_442366.1_3 Reverse -55 -73 23.1269 0.00586
NP_442366.1_3 Reverse -346 -364 -4.79907 0.276
NP_442366.1_5 Forward -359 -349 14.0409 0.0497
NP_440129.1_10 Forward -72 -58 16.1259 0.0373
NP_441115.1_4 Reverse -346 -364 14.6697 0.0525
NP_442206.1_10 Reverse -56 -71 14.1396 0.0799
NP_442206.1_10 Reverse -347 -362 1.15987 0.236
NP_442854.1_6 Reverse -347 -366 5.40766 0.249
NP_440328.1_4 Forward -362 -343 13.7658 0.0414
NP_443054.1_2 Forward -67 -53 10.3243 0.0761
NP_443054.1_2 Reverse -345 -359 -0.393733 0.294
NP_442308.1_4 Reverse -62 -81 1.86774 0.267
NP_440508.1_4 Reverse -347 -366 10.2259 0.298
NP_441851.1_10 Reverse -55 -65 17.4829 0.0027
NP_441851.1_10 Forward -66 -56 16.008 0.00552
NP_441851.1_10 Forward -357 -347 15.8113 0.00552
NP_441851.1_10 Forward -380 -370 11.0914 0.0806
NP_441851.1_10 Reverse -346 -356 8.53483 0.114
NP_441851.1_10 Forward -239 -229 4.50326 0.266
NP_442622.1_8 Forward -394 -376 -18.9587 0.293
NP_442011.1_1 Forward -357 -338 7.37428 0.186
NP_442856.1_7 Reverse -165 -184 10.1275 0.0897
NP_442856.1_7 Reverse -338 -357 7.57094 0.112
NP_441668.1_4 Forward -366 -347 6.78429 0.157
NP_442515.1_1 Forward -66 -52 15.4376 0.025
NP_442515.1_1 Forward -171 -157 -1.37704 0.253
NP_442515.1_1 Forward -357 -343 -4.7203 0.298
NP_442515.1_1 Reverse -55 -69 -4.91696 0.298
NP_440165.1_5 Forward -357 -338 2.16274 0.113
NP_440165.1_5 Reverse -346 -365 -5.70374 0.226
NP_442709.1_3 Forward -363 -344 17.5024 0.0291
NP_440940.1_7 Forward -75 -57 16.0463 0.0644
NP_441349.1_10 Forward -366 -347 0.491109 0.0886
NP_441349.1_10 Reverse -337 -356 -1.47551 0.104
NP_441409.1_6 Forward -362 -343 -8.85033 0.176
NP_442314.1_2 Forward -249 -230 2.65439 0.248
NP_441107.1_10 Forward -88 -74 13.1759 0.292
NP_440432.1_9 Forward -64 -49 17.0895 0.00961
NP_440432.1_9 Forward -355 -340 -3.16669 0.179
NP_441477.1_10 Forward -363 -345 11.7205 0.181
NP_442450.1_5 Reverse -54 -64 10.1081 0.115
NP_442450.1_5 Forward -67 -57 9.32148 0.115
NP_442450.1_5 Forward -358 -348 7.55152 0.13
NP_440588.1_2 Forward -74 -55 -0.688862 0.152
NP_440483.1_1 Reverse -43 -62 -0.000545616 0.199
NP_441570.1_1 Reverse -347 -365 8.37728 0.0138
NP_441570.1_1 Forward -356 -338 -1.75081 0.0591
NP_441570.1_1 Reverse -56 -74 -8.83064 0.122
NP_441570.1_1 Forward -254 -236 -10.5023 0.171
NP_441570.1_1 Reverse -174 -192 -12.5672 0.215
NP_441570.1_1 Forward -65 -47 -16.2055 0.24
NP_440078.1_10 Reverse -347 -366 13.9625 0.151
NP_441078.1_4 Forward -356 -347 19.6659 0.0007
NP_441078.1_4 Reverse -347 -356 19.6659 0.0007
NP_441078.1_4 Forward -65 -56 19.6659 0.0007
NP_441078.1_4 Reverse -56 -65 19.6659 0.0007
NP_441078.1_4 Forward -183 -174 -1.27858 0.246
NP_442729.1_5 Reverse -61 -71 14.0414 0.22
NP_442729.1_8 Reverse -52 -65 10.7374 0.125
NP_442729.1_8 Forward -69 -56 8.08242 0.125
NP_441663.1_8 Reverse -341 -360 4.12936 0.169
NP_441663.1_8 Forward -71 -52 -1.57384 0.243
NP_442348.1_2 Forward -34 -25 11.9961 0.225
NP_440707.1_6 Reverse -339 -358 11.6017 0.254
NP_441094.1_6 Reverse -195 -212 9.18288 0.261
NP_440526.1_3 Forward -64 -53 11.4645 0.0646
NP_440526.1_3 Reverse -348 -359 8.02298 0.126
NP_441432.1_8 Reverse -346 -355 16.8143 0.00595
NP_441432.1_8 Forward -357 -348 16.8143 0.00595
NP_441432.1_8 Reverse -55 -64 8.35786 0.0755
NP_441432.1_8 Forward -66 -57 8.25953 0.0755
NP_441432.1_8 Forward -255 -246 2.94966 0.28
NP_441432.1_8 Forward -184 -175 2.65466 0.292
NP_442320.1_8 Reverse -50 -64 7.37441 0.0195
NP_442320.1_8 Forward -71 -57 4.62115 0.0472
NP_442320.1_8 Forward -362 -348 -4.22864 0.151
NP_442344.1_7 Forward -64 -45 -6.1954 0.17
NP_442344.1_7 Forward -355 -336 -8.16202 0.204
NP_441732.1_2 Forward -69 -53 2.22182 0.0253
NP_441732.1_2 Reverse -343 -359 -6.7263 0.0495
NP_441732.1_2 Forward -360 -344 -7.51295 0.0859
NP_440760.1_1 Forward -65 -46 -3.54046 0.0345
NP_440760.1_1 Reverse -347 -366 -4.32711 0.0417
NP_442353.1_4 Forward -362 -343 -0.39464 0.29
NP_440913.1_1 Reverse -345 -363 6.60732 0.224
NP_442727.1_1 Forward -273 -259 11.6026 0.289
NP_440280.1_4 Forward -121 -107 16.6175 0.27
NP_440713.1_4 Forward -50 -31 6.58763 0.188
NP_442489.1_2 Reverse -169 -188 4.81767 0.206
NP_442489.1_7 Forward -356 -347 20.1576 0.000695
NP_442489.1_7 Reverse -347 -356 20.1576 0.000695
NP_442489.1_7 Forward -65 -56 20.1576 0.000695
NP_442489.1_7 Reverse -56 -65 20.1576 0.000695
NP_442079.1_7 Forward -64 -45 2.75272 0.223
NP_440559.1_1 Reverse -348 -357 17.4043 0.00658
NP_440559.1_1 Forward -64 -55 17.306 0.00658
NP_440559.1_1 Reverse -57 -66 8.75118 0.0586
NP_440559.1_1 Forward -355 -346 8.65285 0.0586
NP_440559.1_1 Reverse -388 -397 4.42462 0.277
NP_441659.2_8 Forward -356 -346 20.9245 0.000805
NP_441659.2_8 Forward -65 -55 19.3512 0.000966
NP_441659.2_8 Reverse -347 -357 18.1713 0.00133
NP_441659.2_8 Reverse -56 -66 11.9764 0.0147
NP_441659.2_8 Reverse -111 -121 0.275027 0.27
NP_440426.1_7 Reverse -337 -356 10.9142 0.124
NP_441022.1_1 Forward -209 -200 13.8484 0.188
NP_441022.1_1 Reverse -198 -207 11.1625 0.284
NP_441022.1_1 Forward -208 -199 10.9707 0.284
NP_441022.1_1 Reverse -199 -208 10.9707 0.284
NP_442913.1_10 Reverse -338 -357 15.7324 0.0155
NP_442913.1_10 Forward -365 -346 5.99764 0.0664
NP_442913.1_10 Forward -93 -74 -1.27885 0.168
NP_441040.1_2 Forward -358 -339 -15.7335 0.286
NP_441040.1_5 Reverse -342 -361 5.89931 0.229
NP_441968.1_1 Reverse -194 -202 14.1787 0.286
NP_442008.1_2 Forward -359 -340 8.16093 0.2
NP_440779.1_5 Forward -65 -48 -14.2191 0.243
NP_442346.1_2 Forward -367 -348 5.211 0.281
NP_442346.1_5 Reverse -55 -65 17.9746 0.00128
NP_442346.1_5 Forward -357 -347 16.6963 0.00248
NP_442346.1_5 Reverse -346 -356 16.303 0.00248
NP_442346.1_5 Forward -66 -56 9.02648 0.118
NP_442346.1_5 Forward -184 -174 5.19158 0.256
NP_440545.1_3 Forward -360 -343 18.9184 0.00965
NP_440545.1_3 Reverse -52 -69 14.1002 0.0159
NP_440545.1_3 Reverse -343 -360 1.41547 0.119
NP_440025.1_5 Reverse -260 -279 21.6323 0.0403
NP_440831.1_3 Forward -81 -62 5.41637 0.28
NP_441710.1_9 Forward -363 -344 20.6481 0.0918
NP_440486.1_6 Reverse -334 -353 8.94757 0.235
NP_440250.1_4 Forward -219 -200 11.995 0.208
NP_440459.1_2 Reverse -345 -362 16.8534 0.0845
NP_440459.1_2 Forward -220 -203 11.6419 0.169
NP_441653.1_2 Forward -367 -348 4.78586 0.253
NP_441653.1_3 Forward -203 -189 13.7659 0.275
NP_440010.1_4 Forward -366 -347 0.588665 0.247
NP_442603.1_7 Reverse -347 -361 12.2903 0.1
NP_442603.1_7 Reverse -56 -70 8.3571 0.176
NP_442603.1_7 Forward -396 -382 7.76712 0.195
NP_441585.1_5 Reverse -379 -398 2.16195 0.279
NP_441585.1_5 Reverse -378 -397 -1.37794 0.298
NP_441888.1_7 Forward -70 -56 13.3726 0.0743
NP_441948.1_4 Reverse -49 -67 -1.25915 0.145
NP_440170.1_2 Reverse -258 -277 2.75272 0.297
NP_440170.1_6 Reverse -342 -361 15.0441 0.183
NP_441833.1_4 Forward -355 -348 15.9687 0.0124
NP_441833.1_4 Reverse -348 -355 15.9687 0.0124
NP_441833.1_4 Forward -64 -57 15.9687 0.0124
NP_441833.1_4 Reverse -57 -64 15.9687 0.0124
NP_441833.1_4 Reverse -388 -395 11.0522 0.0559
NP_442162.1_9 Forward -355 -348 16.2637 0.0124
NP_442162.1_9 Reverse -348 -355 16.2637 0.0124
NP_442162.1_9 Forward -64 -57 16.2637 0.0124
NP_442162.1_9 Reverse -57 -64 16.2637 0.0124
NP_442796.1_10 Reverse -41 -60 7.47261 0.278
NP_440671.1_4 Forward -71 -57 13.4709 0.0806
NP_440671.1_4 Forward -362 -348 9.14437 0.184
NP_440224.1_1 Reverse -336 -355 -0.39387 0.141
NP_442140.1_3 Forward -64 -54 14.828 0.0433
NP_442140.1_3 Reverse -348 -358 12.2714 0.0632
NP_442140.1_3 Reverse -57 -67 8.33817 0.119
NP_442140.1_3 Forward -395 -385 5.28991 0.216
NP_442140.1_3 Reverse -181 -191 4.99491 0.232
NP_442140.1_3 Forward -355 -345 4.69992 0.238
NP_442723.1_8 Forward -196 -182 18.6825 0.201
NP_440875.1_9 Forward -354 -344 16.5483 0.0145
NP_440875.1_9 Reverse -58 -68 9.05339 0.233
NP_440875.1_9 Forward -118 -108 7.00932 0.287
NP_441813.1_5 Reverse -345 -355 18.1713 0.00743
NP_441813.1_5 Forward -67 -57 17.188 0.00979
NP_441813.1_5 Reverse -54 -64 8.92815 0.0347
NP_441813.1_5 Forward -358 -348 8.63316 0.0367
NP_442254.1_1 Reverse -99 -118 -5.01543 0.282
NP_440590.1_4 Reverse -348 -361 10.934 0.0235
NP_440590.1_4 Forward -64 -51 1.29759 0.127
NP_440590.1_4 Reverse -57 -70 -2.24233 0.239
NP_440590.1_4 Forward -355 -342 -5.38892 0.277
NP_440590.1_4 Forward -39 -26 -5.78224 0.289
NP_440567.1_1 Reverse -57 -71 12.4876 0.023
NP_440567.1_1 Forward -355 -341 9.83269 0.0414
NP_440567.1_1 Reverse -348 -362 5.50613 0.102
NP_440567.1_1 Forward -64 -50 2.35953 0.176
NP_440035.1_1 Reverse -204 -223 15.0441 0.192
NP_442497.1_10 Forward -64 -55 19.8626 0.00532
NP_442497.1_10 Forward -355 -346 17.601 0.00813
NP_442497.1_10 Reverse -348 -357 10.4228 0.0087
NP_442497.1_10 Reverse -57 -66 10.4228 0.0087
NP_440821.1_4 Reverse -54 -64 19.5479 0.00399
NP_440821.1_4 Forward -67 -57 19.0562 0.00399
NP_440821.1_4 Forward -358 -348 9.41981 0.0286
NP_440821.1_4 Reverse -345 -355 2.24165 0.131
NP_441239.1_9 Reverse -54 -66 17.0502 0.0153
NP_441239.1_9 Forward -67 -55 16.8536 0.0155
NP_441239.1_9 Reverse -345 -357 13.0187 0.0389
NP_441239.1_9 Reverse -227 -239 3.67722 0.279
NP_441239.1_9 Forward -358 -346 3.38223 0.285
NP_441009.1_4 Reverse -56 -75 18.6823 0.131
NP_441727.1_3 Reverse -49 -68 4.42435 0.262
NP_440400.1_1 Forward -74 -55 -0.39464 0.285
NP_441892.1_1 Reverse -47 -64 8.00365 0.0841
NP_441892.1_1 Forward -365 -348 5.15205 0.105
NP_441892.1_1 Reverse -236 -253 -3.40274 0.239
NP_441892.1_1 Forward -179 -162 -5.1727 0.275
NP_440665.1_2 Reverse -61 -80 -3.63879 0.246
NP_440604.1_6 Reverse -56 -75 -1.67217 0.204
NP_442044.1_1 Reverse -246 -265 -14.0619 0.283
NP_442044.1_9 Reverse -56 -75 7.27595 0.2
NP_442193.1_8 Reverse -199 -218 10.815 0.28
NP_442643.1_5 Forward -215 -196 -6.29373 0.293
NP_440949.1_7 Forward -73 -54 8.35677 0.288
NP_440354.1_7 Reverse -50 -68 7.59063 0.26
NP_441617.1_6 Forward -218 -199 -6.88371 0.288
NP_442138.1_10 Forward -356 -337 -0.197208 0.147
NP_440546.1_4 Forward -356 -346 13.5365 0.0459
NP_440546.1_4 Forward -65 -55 12.8578 0.0572
NP_440546.1_4 Reverse -56 -66 11.8882 0.0679
NP_440546.1_4 Reverse -347 -357 10.046 0.109
NP_440546.1_4 Reverse -270 -280 9.3673 0.142
NP_440546.1_4 Forward -396 -386 9.17338 0.151
NP_441230.1_5 Reverse -51 -70 14.9458 0.0602
NP_441230.1_5 Reverse -240 -259 -0.0988766 0.277
NP_440675.1_1 Reverse -53 -72 8.16093 0.195
NP_440675.1_10 Forward -392 -373 14.2574 0.228
NP_440462.1_6 Reverse -345 -355 18.7612 0.00454
NP_440462.1_6 Forward -67 -57 15.418 0.0142
NP_440462.1_6 Reverse -54 -64 10.4031 0.0396
NP_440462.1_6 Forward -358 -348 1.35667 0.294
NP_442611.1_1 Forward -356 -337 24.6805 0.0191
NP_440868.1_4 Reverse -343 -355 15.0836 0.0164
NP_440868.1_4 Forward -69 -57 8.6921 0.0582
NP_440868.1_4 Forward -360 -348 6.1355 0.0878
NP_440868.1_4 Reverse -52 -64 0.432302 0.212
NP_440868.1_8 Forward -264 -245 0.392778 0.263
NP_440868.1_8 Reverse -52 -71 -2.95047 0.263
NP_442479.1_9 Reverse -200 -219 -7.86702 0.266
NP_442460.1_7 Forward -77 -58 1.47442 0.249
NP_442460.1_9 Reverse -63 -82 19.6656 0.175
NP_442039.1_4 Forward -355 -348 15.1821 0.0124
NP_442039.1_4 Reverse -348 -355 15.1821 0.0124
NP_442039.1_4 Forward -64 -57 15.1821 0.0124
NP_442039.1_4 Reverse -57 -64 15.1821 0.0124
NP_442039.1_7 Reverse -182 -192 13.2547 0.211
NP_441811.1_8 Reverse -50 -64 8.94771 0.227
NP_441811.1_8 Forward -260 -246 5.60446 0.294
NP_442625.1_4 Forward -77 -58 5.50599 0.173
NP_441926.1_3 Forward -356 -340 4.97508 0.175
NP_440825.1_7 Reverse -348 -358 12.9096 0.152
NP_442837.1_3 Forward -355 -348 15.7721 0.0124
NP_442837.1_3 Reverse -348 -355 15.7721 0.0124
NP_442837.1_3 Forward -64 -57 15.7721 0.0124
NP_442837.1_3 Reverse -57 -64 15.7721 0.0124
NP_442837.1_3 Reverse -392 -399 5.74231 0.275
NP_440160.1_9 Reverse -327 -346 8.75091 0.256
NP_439994.1_1 Reverse -62 -81 7.86593 0.271
NP_442053.1_1 Forward -356 -347 18.3876 0.0007
NP_442053.1_1 Reverse -347 -356 18.3876 0.0007
NP_442053.1_1 Forward -65 -56 18.3876 0.0007
NP_442053.1_1 Reverse -56 -65 18.3876 0.0007
NP_440505.1_3 Reverse -345 -355 17.188 0.00332
NP_440505.1_3 Forward -67 -57 13.8447 0.0247
NP_440505.1_3 Forward -358 -348 9.22315 0.122
NP_440505.1_3 Reverse -54 -64 7.84651 0.147
NP_441701.1_3 Forward -247 -230 6.72535 0.275
NP_441203.1_1 Reverse -57 -76 -11.0136 0.137
NP_441203.1_1 Forward -355 -336 -14.8485 0.205
NP_442532.1_7 Forward -65 -51 5.60446 0.171
NP_441408.2_7 Reverse -345 -364 4.71934 0.191
NP_440914.1_1 Reverse -347 -357 17.5935 0.000537
NP_440914.1_1 Forward -356 -346 16.3248 0.00196
NP_440914.1_1 Reverse -25 -35 9.7862 0.172
NP_440914.1_1 Reverse -56 -66 8.6151 0.186
NP_440914.1_1 Forward -65 -55 8.51751 0.186
NP_441011.1_8 Reverse -57 -66 16.9127 0.00602
NP_441011.1_8 Forward -355 -346 16.6177 0.00602
NP_441011.1_8 Forward -64 -55 14.356 0.0249
NP_441011.1_8 Reverse -348 -357 8.25953 0.144
NP_442101.1_10 Reverse -339 -358 -5.99873 0.181
NP_442101.1_10 Forward -364 -345 -8.65367 0.242
NP_442101.1_10 Forward -107 -88 -8.94866 0.243
NP_442101.1_10 Forward -73 -54 -9.14533 0.245
NP_442533.1_6 Forward -356 -347 17.2076 0.00137
NP_442533.1_6 Reverse -347 -356 17.2076 0.00137
NP_442533.1_6 Forward -65 -56 17.2076 0.00137
NP_442533.1_6 Reverse -56 -65 17.2076 0.00137
NP_442533.1_6 Reverse -31 -40 2.16301 0.27
NP_442533.1_6 Forward -279 -270 2.06468 0.275
NP_442232.1_3 Reverse -48 -67 -12.2919 0.282
NP_441482.1_7 Reverse -50 -64 8.35772 0.0173
NP_441482.1_7 Forward -71 -57 8.16106 0.0189
NP_441482.1_7 Forward -362 -348 0.982901 0.0554
NP_441482.1_7 Reverse -341 -355 -2.85201 0.1
NP_439944.1_9 Forward -64 -54 17.4829 0.00423
NP_439944.1_9 Reverse -348 -358 10.5014 0.0887
NP_439944.1_9 Reverse -57 -67 10.3048 0.0887
NP_439944.1_9 Forward -355 -345 9.12481 0.1
NP_442269.1_10 Forward -33 -14 1.76941 0.282
NP_440116.1_5 Forward -359 -342 14.9851 0.0596
NP_440116.1_8 Forward -355 -336 5.60432 0.0628
NP_440116.1_8 Reverse -348 -367 -8.16202 0.247
NP_440115.1_6 Reverse -344 -354 14.0414 0.0615
NP_440115.1_6 Reverse -53 -63 10.0098 0.115
NP_440115.1_6 Forward -359 -349 9.32148 0.115
NP_440115.1_6 Forward -399 -389 7.74818 0.146
NP_440007.1_9 Reverse -343 -357 7.17775 0.213
NP_440007.1_9 Forward -360 -346 1.37622 0.285
NP_439965.1_1 Forward -74 -55 -8.65367 0.275
NP_440608.1_6 Reverse -371 -390 3.83357 0.282
NP_441602.1_3 Reverse -51 -70 -2.95047 0.239
NP_442673.1_7 Forward -268 -249 12.9387 0.239
NP_441972.1_5 Reverse -348 -367 1.96607 0.123
NP_441972.1_5 Forward -76 -57 -2.95047 0.194
NP_441106.1_1 Reverse -346 -355 18.486 0.0028
NP_441106.1_1 Forward -66 -57 18.191 0.0028
NP_441106.1_1 Reverse -55 -64 9.73449 0.0311
NP_441106.1_1 Forward -357 -348 9.63616 0.0311
NP_440429.1_2 Reverse -156 -175 7.7676 0.28
NP_440429.1_4 Reverse -340 -359 10.5209 0.299
NP_439903.1_6 Reverse -344 -363 8.84842 0.134
NP_439903.1_6 Reverse -199 -218 0.883656 0.256
NP_439903.1_6 Forward -68 -49 0.883656 0.256
NP_439903.1_6 Reverse -53 -72 -1.37794 0.299
NP_442588.1_6 Reverse -350 -369 2.94938 0.219
NP_442306.1_10 Forward -70 -51 -10.6203 0.11
NP_441286.1_1 Forward -66 -54 14.6903 0.00418
NP_441286.1_1 Forward -357 -345 5.93884 0.0258
NP_441286.1_1 Reverse -55 -67 5.05386 0.0259
NP_441286.1_1 Reverse -346 -358 3.48056 0.0467
NP_441286.1_1 Reverse -160 -172 -6.15587 0.251
NP_440670.1_8 Forward -356 -347 18.3876 0.000699
NP_440670.1_8 Reverse -347 -356 18.3876 0.000699
NP_440670.1_8 Forward -65 -56 18.3876 0.000699
NP_440670.1_8 Reverse -56 -65 18.3876 0.000699
NP_441479.1_1 Forward -359 -340 22.1239 0.0353
NP_440886.1_7 Forward -66 -56 17.7774 0.0011
NP_440886.1_7 Reverse -346 -356 8.04271 0.0805
NP_440886.1_7 Reverse -55 -65 8.04271 0.0805
NP_440886.1_7 Forward -357 -347 7.94438 0.0805
NP_440886.1_7 Forward -280 -270 7.25606 0.0993
NP_440886.1_7 Reverse -236 -246 5.38779 0.185
NP_440886.1_7 Reverse -77 -87 3.8145 0.265
NP_440197.1_8 Reverse -178 -197 22.5172 0.0253
NP_442614.1_2 Reverse -75 -89 8.94771 0.242
NP_442614.1_2 Forward -356 -342 8.25939 0.255
NP_442614.1_2 Forward -81 -67 8.25939 0.255
NP_442614.1_2 Reverse -347 -361 8.16106 0.255
NP_442614.1_2 Forward -345 -331 6.29277 0.291
NP_442072.1_9 Reverse -55 -73 -13.3539 0.11
NP_442072.1_9 Reverse -346 -364 -13.4522 0.112
NP_442072.1_9 Forward -357 -339 -21.2203 0.206
NP_442072.1_9 Forward -66 -48 -22.007 0.216
NP_442072.1_9 Forward -397 -379 -23.2853 0.288
NP_440513.1_4 Forward -356 -337 7.96426 0.295
NP_440513.1_7 Reverse -356 -375 16.1257 0.206
NP_442213.1_5 Forward -205 -186 3.93269 0.231
NP_442213.1_6 Forward -95 -76 17.3057 0.136
NP_440907.2_8 Forward -64 -54 19.449 0.00351
NP_440907.2_8 Forward -355 -345 9.616 0.103
NP_440907.2_8 Reverse -57 -67 7.84605 0.117
NP_440907.2_8 Reverse -348 -358 7.64939 0.117
NP_442264.1_2 Reverse -52 -69 8.39697 0.216
NP_439967.1_7 Forward -357 -339 9.85225 0.237
NP_441021.1_1 Reverse -57 -76 -8.35868 0.195
NP_441021.1_8 Reverse -64 -82 3.55906 0.226
NP_440841.1_4 Reverse -268 -287 -6.09707 0.215
NP_442459.1_7 Forward -272 -253 -0.4922 0.273
NP_441463.1_3 Reverse -46 -65 -7.96535 0.262
NP_441463.1_3 Forward -75 -56 -8.06369 0.264
NP_441463.1_6 Forward -67 -53 7.28563 0.262
NP_441626.1_2 Forward -355 -348 15.7721 0.0124
NP_441626.1_2 Reverse -348 -355 15.7721 0.0124
NP_441626.1_2 Forward -64 -57 15.7721 0.0124
NP_441626.1_2 Reverse -57 -64 15.7721 0.0124
NP_442365.1_7 Forward -360 -341 0.786102 0.177
NP_442794.1_1 Forward -360 -348 21.9668 0.00123
NP_442794.1_1 Forward -69 -57 10.1671 0.0721
NP_442794.1_1 Forward -187 -175 5.15219 0.231
NP_442615.1_1 Reverse -338 -356 10.1472 0.0223
NP_442615.1_1 Reverse -47 -65 4.83737 0.0426
NP_442615.1_1 Forward -365 -347 -0.570838 0.118
NP_441962.1_4 Reverse -51 -70 5.40766 0.094
NP_441962.1_4 Forward -243 -224 -13.7669 0.277
NP_441742.1_7 Reverse -343 -362 13.2741 0.261
NP_440387.1_1 Reverse -56 -72 22.8713 0.00191
NP_440387.1_1 Reverse -347 -363 11.3666 0.017
NP_440387.1_1 Forward -356 -340 7.63002 0.0282
NP_440387.1_1 Forward -65 -49 -1.80975 0.145
NP_441431.1_2 Reverse -344 -358 16.0269 0.04
NP_441431.1_2 Forward -68 -54 8.94708 0.2
NP_441431.1_7 Forward -209 -190 14.8329 0.256
NP_442020.1_1 Reverse -254 -273 -1.08295 0.291
NP_441488.1_8 Forward -361 -347 13.7653 0.146
NP_441836.1_2 Reverse -341 -360 -0.295539 0.212
NP_441993.1_1 Forward -362 -343 9.06107 0.136
NP_441993.1_1 Reverse -50 -69 4.18821 0.223
NP_441993.1_1 Forward -254 -235 1.65431 0.273
NP_441993.1_1 Reverse -347 -366 0.679741 0.294
NP_440114.1_10 Forward -65 -51 15.4376 0.0252
NP_440114.1_10 Forward -356 -342 9.04604 0.186
NP_442437.1_3 Reverse -349 -368 19.8614 0.088
NP_442698.1_10 Forward -118 -99 -0.0988766 0.297
NP_441510.2_7 Reverse -25 -39 13.7653 0.28
NP_441510.2_7 Forward -71 -57 11.602 0.28
NP_440287.1_6 Forward -365 -346 4.32602 0.206
NP_440293.1_10 Reverse -53 -72 -1.47551 0.271
NP_440766.1_4 Forward -69 -55 15.2409 0.0269
NP_440766.1_4 Reverse -383 -397 5.30946 0.112
NP_441237.1_9 Forward -64 -54 17.2863 0.00348
NP_441237.1_9 Reverse -348 -358 14.828 0.0242
NP_442743.1_5 Reverse -57 -76 13.2741 0.125
NP_441311.1_2 Reverse -341 -355 14.1586 0.229
NP_440643.1_2 Reverse -218 -237 12.5858 0.0963
NP_439910.1_2 Forward -73 -56 -21.3973 0.183
NP_442867.1_3 Forward -211 -192 6.68596 0.193
NP_440457.1_1 Reverse -343 -355 10.2654 0.092
NP_440457.1_1 Forward -69 -57 8.29878 0.101
NP_440457.1_1 Reverse -52 -64 8.20045 0.101
NP_440457.1_1 Forward -360 -348 -0.452677 0.263
NP_440213.1_5 Reverse -197 -216 12.3892 0.205
NP_440798.1_6 Forward -355 -342 10.8357 0.0721
NP_440798.1_6 Reverse -348 -361 4.34585 0.145
NP_440798.1_6 Forward -64 -51 1.9859 0.188
NP_440798.1_7 Forward -215 -196 3.44104 0.284
NP_440142.1_7 Reverse -348 -367 16.1257 0.102
NP_441984.1_1 Reverse -50 -68 10.6389 0.204
NP_442509.1_9 Forward -65 -55 17.3841 0.00128
NP_442509.1_9 Reverse -56 -66 16.2041 0.00739
NP_442509.1_9 Reverse -347 -357 8.14104 0.192
NP_442509.1_9 Forward -356 -346 8.04271 0.192
NP_442582.1_7 Reverse -372 -391 19.0877 0.251
NP_441871.1_8 Forward -237 -218 20.944 0.0601
NP_440554.1_4 Forward -355 -345 17.9746 0.0131
NP_440554.1_4 Reverse -57 -67 14.6313 0.02
NP_440554.1_4 Forward -64 -54 6.27322 0.123
NP_441885.1_5 Reverse -347 -357 20.9245 0.000538
NP_441885.1_5 Reverse -56 -66 11.4848 0.00668
NP_441885.1_5 Forward -356 -346 11.3864 0.00668
NP_441885.1_5 Forward -65 -55 11.3864 0.00668
NP_442341.1_7 Reverse -55 -69 15.5359 0.0218
NP_442341.1_7 Forward -66 -52 8.65272 0.0858
NP_442341.1_7 Reverse -346 -360 7.66941 0.0994
NP_442341.1_7 Reverse -68 -82 3.53951 0.22
NP_442341.1_7 Reverse -173 -187 2.06454 0.271
NP_442341.1_9 Reverse -345 -359 21.9267 0.00232
NP_442341.1_9 Forward -281 -267 6.58715 0.221
NP_441756.1_5 Forward -360 -341 5.70265 0.183
NP_441756.1_5 Reverse -170 -189 -3.63879 0.29
NP_441173.1_9 Reverse -205 -213 13.2937 0.17
NP_440423.1_6 Reverse -48 -67 -12.2919 0.194
NP_443000.1_7 Reverse -345 -355 20.3345 0.00223
NP_443000.1_7 Forward -358 -348 10.3048 0.0345
NP_443000.1_7 Forward -67 -57 8.73149 0.0437
NP_443000.1_7 Reverse -54 -64 2.14332 0.226
NP_443000.1_7 Forward -185 -175 1.55333 0.244
NP_442513.1_5 Forward -191 -172 9.63507 0.266
NP_440275.1_3 Reverse -54 -64 19.5479 0.00756
NP_440275.1_3 Reverse -345 -355 16.1063 0.0155
NP_440275.1_3 Forward -67 -57 8.4365 0.0602
NP_440275.1_3 Forward -358 -348 8.04317 0.0602
NP_442932.1_9 Reverse -183 -202 5.99764 0.252
NP_440091.1_1 Reverse -52 -64 1.51394 0.197
NP_440091.1_1 Forward -69 -57 1.41561 0.197
NP_441307.1_6 Reverse -56 -75 5.89931 0.272
NP_440679.1_10 Reverse -173 -192 -14.6519 0.242
NP_440679.1_10 Reverse -58 -77 -17.7001 0.275
NP_442451.1_2 Forward -73 -54 -9.14533 0.259
NP_440149.1_8 Reverse -174 -193 4.42435 0.0825
NP_440149.1_8 Reverse -56 -75 2.75272 0.105
NP_440149.1_8 Forward -65 -46 -1.67217 0.162
NP_440149.1_8 Forward -189 -170 -5.21209 0.221
NP_441105.1_3 Reverse -45 -64 -2.95047 0.171
NP_441105.1_3 Reverse -265 -284 -9.24366 0.286
NP_441105.1_3 Forward -367 -348 -10.0303 0.3
NP_440216.1_1 Forward -356 -342 26.254 0.000481
NP_440216.1_1 Forward -65 -51 5.30946 0.0215
NP_440216.1_1 Reverse -347 -361 -0.492064 0.0284
NP_440216.1_1 Reverse -56 -70 -2.26202 0.0484
NP_440216.1_1 Forward -183 -169 -11.9968 0.236
NP_440172.1_1 Forward -356 -346 17.5813 0.00421
NP_440172.1_1 Forward -65 -55 16.303 0.00854
NP_440172.1_1 Reverse -347 -357 15.0247 0.00945
NP_440172.1_1 Reverse -56 -66 8.73149 0.0586
NP_442015.1_10 Forward -360 -347 19.8821 0.00366
NP_442015.1_10 Forward -69 -56 19.1938 0.00444
NP_442015.1_10 Reverse -170 -183 6.50913 0.114
NP_442015.1_10 Reverse -343 -356 3.75586 0.178
NP_442015.1_10 Forward -187 -174 3.65753 0.178
NP_441226.1_7 Forward -355 -348 14.4934 0.0123
NP_441226.1_7 Reverse -348 -355 14.4934 0.0123
NP_441226.1_7 Forward -64 -57 14.4934 0.0123
NP_441226.1_7 Reverse -57 -64 14.4934 0.0123
NP_441226.1_7 Reverse -290 -297 6.52862 0.253
NP_441226.1_7 Reverse -31 -38 5.64364 0.286
NP_441757.1_3 Forward -357 -338 1.86774 0.159
NP_441111.1_7 Forward -355 -347 18.7023 0.00294
NP_441111.1_7 Forward -64 -56 18.7023 0.00294
NP_441111.1_7 Reverse -348 -356 18.7023 0.00294
NP_441111.1_7 Reverse -57 -65 18.7023 0.00294
NP_442379.1_10 Forward -72 -55 6.43035 0.115
NP_442379.1_10 Forward -363 -346 0.235503 0.223
NP_442379.1_10 Reverse -340 -357 0.235503 0.223
NP_441766.1_2 Forward -356 -347 17.5026 0.00297
NP_441766.1_2 Reverse -347 -356 17.5026 0.00297
NP_441766.1_2 Forward -65 -56 17.5026 0.00297
NP_441766.1_2 Reverse -56 -65 17.5026 0.00297
NP_442417.1_5 Reverse -56 -70 21.3374 0.00922
NP_442417.1_5 Reverse -347 -361 8.06273 0.164
NP_442417.1_5 Forward -356 -342 4.52282 0.292
NP_440416.1_9 Forward -363 -344 0.58944 0.0513
NP_440416.1_9 Forward -72 -53 -2.75381 0.0719
NP_440416.1_9 Forward -190 -171 -7.96535 0.109
NP_440416.1_9 Reverse -340 -359 -8.06369 0.109
NP_440416.1_9 Reverse -61 -80 -15.3402 0.189
NP_440416.1_9 Forward -35 -16 -18.5851 0.26
NP_443052.1_8 Reverse -46 -65 -8.85033 0.179
NP_443052.1_8 Forward -75 -56 -9.44032 0.19
NP_442154.1_1 Forward -262 -244 -5.88071 0.127
NP_442154.1_1 Forward -248 -230 -11.6822 0.215
NP_442154.1_1 Reverse -54 -72 -15.3205 0.218
NP_442154.1_1 Forward -387 -369 -18.3687 0.281
NP_442564.1_2 Reverse -272 -291 8.45592 0.253
NP_440261.1_5 Forward -355 -342 6.60746 0.0318
NP_440261.1_5 Forward -64 -51 -0.767364 0.0655
NP_440261.1_5 Reverse -348 -361 -0.964025 0.0655
NP_440261.1_5 Reverse -57 -70 -10.5021 0.201
NP_440261.1_5 Reverse -230 -243 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGGAGCGATCTTGCCCGGTTTGGGATTGCAGTTAGCAACCCTTGGCGATCGCCTGGCGGCCCTACCGAAGTTAGAAATGGATCAATTAACCGAGTTGCCTGACCGTTGGGCTTTAGATACCCCCAGCGCCATTTTTAGTGGTGTTGTCTATGGCGTGTTGGGGGCATTGCAGAGTTATCTCCAGGATTGGCAAAAGCTTTTTCCTGGTGCCGCCATGGTTATCACCGGGGGAGACGGCAAGATATTACATGGCTTCCTAAAAGAGCATTCTCCTAATCTTTCGGTGGCCTGGGATGACAATTTGATCTTCCTCGGTATGGCGGCCATACACCACGGCGATCGCCCCATCTGTTAGGGTTAGGGGTCGGCATTGTTATAGCTACGGGAGGTTAAATCGGG

CDS

GTGAATCTTGGCCAATGGGGGGAAATTATGTCCTGGTTATGTTTATTGCCCATATCCGGGGGCATTGTATATAACCTGCTGACCGTGTTTACCACTAGCCTTTTTCTGGCAAGGTCTCTACCCAAGCAAGATTTCCAACCAGGGGTGTCAGTGCTGAAGCCAGTGCGGGGCTTGGAAAAAAACCTAGAAGCCAACTTACGCACCATTGCCCAGCAGAATTATCCCGCCTATGAAGTAATCTACTGTGTGCAAGATCCCCAGGATCCGGCGTTGCCCATAGTCAAAAAGCTTCAAGCGGAGTTTGGCCCAGAAAAAATTATTGTGGCGGTGCATCAAATCGAACAGGGAGCCAACGGTAAGGTTAATAATCTCCTAGGGGGATTAAAACATGCTAAATACGACATTTTGGTGATAAGCGACAGTGACACCAATCTGCGCCCCGATTACTTGGCCACCATGGTCAGTCCCTTGGGCGATCGCCTGGTGGGCTGTGTCACCACCCCTTTCAAGTTGACCCAAGCCCAAACATGGTACGAAGGTTTAGAATTGCTGAGCATCAATGCTGACTTCATGCCCAGTGTTCTGTTTGCGGAGGTAACTGGAGCATCCAAAGCTTGTTTAGGTCCTTCCATTGCCATTCGGCGATCGACTTTAACGGAAATTGGCGGCCTAGAAAGTTTAGCAGACTACTTGGTGGAGGATTTTGAACTGGGGCAGCGGGTTTGGACGGGGGGGTTAAAGATGGTTTTACTGCCCTATGTCATCGACGCAGGGGTGAATTTGGATAATTGGACTAATTGGTGGAGCCATCAACTTTATTGGGATCAAAATACTTACCTGGCTCGCCCCTTGCCTTTTTTAGCCACCATCATTATTCGGGCAGTGCCCTTCGCCTTTTTGTTTACCTTTTGTCATTGGTCTGAGCCTTGGGCCTGGCTAATTCTGTTCATAACCCTAGCTACCCGTTATGGGACAGCGGCCATAGTTGCCCAGGAACTAAAAGATGGGGAAACTATCCGCTATTTACCTTTATTACTATTGCGGGACTGCTTTGGCTTGGTTTTTTGGGCCCTATCTTTTTCCCAACGACAAGTCCTGTGGCGGGGCATAACCTATCGTCTTACCAAGGGGGGCAAAATGATACCGGCTTCCCCTATCCCTAAAAGTTAA

Protein

MNLGQWGEIMSWLCLLPISGGIVYNLLTVFTTSLFLARSLPKQDFQPGVSVLKPVRGLEKNLEANLRTIAQQNYPAYEVIYCVQDPQDPALPIVKKLQAEFGPEKIIVAVHQIEQGANGKVNNLLGGLKHAKYDILVISDSDTNLRPDYLATMVSPLGDRLVGCVTTPFKLTQAQTWYEGLELLSINADFMPSVLFAEVTGASKACLGPSIAIRRSTLTEIGGLESLADYLVEDFELGQRVWTGGLKMVLLPYVIDAGVNLDNWTNWWSHQLYWDQNTYLARPLPFLATIIIRAVPFAFLFTFCHWSEPWAWLILFITLATRYGTAAIVAQELKDGETIRYLPLLLLRDCFGLVFWALSFSQRQVLWRGITYRLTKGGKMIPASPIPKS