Your browser is old and dusty. Try Google Chrome!

Details for slr0810

ORF slr0810
Accession NP_441432.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440815.1_2 Reverse -370 -384 10.422 0.265
NP_441818.1_9 Reverse -55 -74 -8.06369 0.274
NP_440259.1_4 Reverse -324 -338 10.082 0.276
NP_442173.1_1 Forward -81 -73 7.59091 0.163
NP_442173.1_1 Reverse -253 -261 6.3126 0.191
NP_442752.1_4 Reverse -134 -141 4.36568 0.273
NP_442975.1_10 Reverse -229 -243 5.50552 0.219
NP_441675.1_4 Reverse -106 -125 8.25926 0.232
NP_442062.1_3 Forward -95 -76 3.93269 0.198
NP_440044.1_8 Forward -142 -123 -3.3438 0.282
NP_441208.1_1 Reverse -61 -80 -6.88371 0.296
NP_441594.1_6 Forward -194 -175 6.19431 0.193
NP_441594.1_6 Forward -344 -325 0.196116 0.291
NP_441434.1_6 Forward -128 -118 15.5163 0.277
NP_441738.1_2 Forward -212 -205 6.72528 0.236
NP_440209.1_1 Reverse -134 -142 5.42762 0.105
NP_441783.1_2 Forward -141 -132 16.6177 0.154
NP_441909.1_2 Reverse -99 -118 9.73422 0.124
NP_440538.1_10 Forward -82 -63 11.9958 0.245
NP_441327.1_4 Reverse -108 -122 17.6992 0.282
NP_442442.1_5 Reverse -99 -118 14.7491 0.156
NP_440747.1_10 Forward -225 -213 -12.1541 0.227
NP_441486.1_1 Reverse -179 -193 -0.0987402 0.148
NP_442687.1_7 Forward -62 -52 5.09324 0.221
NP_441077.1_6 Forward -91 -75 3.18749 0.271
NP_440141.1_8 Reverse -305 -324 4.52268 0.288
NP_442544.1_6 Reverse -127 -146 -3.04881 0.141
NP_441414.1_9 Reverse -60 -79 -8.94866 0.249
NP_442937.1_5 Reverse -129 -148 5.99764 0.293
NP_441958.1_5 Reverse -133 -143 -6.90313 0.293
NP_440180.1_2 Reverse -255 -274 18.879 0.231
NP_440651.1_1 Reverse -52 -71 6.58763 0.282
NP_440984.1_7 Forward -74 -60 6.09611 0.227
NP_442690.1_1 Reverse -79 -98 -14.5535 0.273
NP_442690.1_1 Forward -127 -108 -15.0452 0.277
NP_442690.1_1 Forward -47 -28 -17.1101 0.297
NP_442911.1_1 Reverse -78 -91 15.436 0.274
NP_440169.1_1 Forward -373 -354 24.4839 0.00415
NP_440169.1_3 Forward -289 -270 28.6138 0.00051
NP_440169.1_5 Forward -226 -207 27.6305 0.000754
NP_440169.1_6 Forward -265 -246 28.0229 0.0000942
NP_440169.1_7 Forward -346 -327 16.1257 0.138
NP_440169.1_8 Forward -394 -375 22.7139 0.0869
NP_443044.1_1 Reverse -346 -365 8.45592 0.233
NP_442002.1_9 Reverse -72 -79 9.97054 0.246
NP_441294.1_7 Forward -226 -212 9.25063 0.256
NP_441294.1_7 Forward -281 -267 8.67469 0.289
NP_441646.1_1 Forward -198 -179 6.4893 0.173
NP_440345.1_3 Reverse -119 -133 12.6166 0.233
NP_441041.1_7 Reverse -210 -222 7.4176 0.167
NP_441041.1_7 Reverse -131 -143 5.37687 0.26
NP_440569.1_10 Forward -125 -106 11.2199 0.219
NP_441547.1_2 Forward -196 -178 9.75391 0.193
NP_439966.1_7 Forward -71 -61 8.23937 0.14
NP_439966.1_9 Reverse -58 -67 0.491382 0.288
NP_442941.1_5 Forward -121 -107 14.525 0.279
NP_441514.1_6 Reverse -204 -211 12.8221 0.252
NP_442281.1_1 Forward -219 -205 4.03056 0.21
NP_441079.1_7 Forward -188 -169 -2.16459 0.217
NP_440647.1_9 Forward -71 -53 23.2253 0.0192
NP_442500.1_8 Reverse -107 -121 10.1784 0.272
NP_441644.1_6 Reverse -134 -144 6.66608 0.152
NP_442029.1_6 Forward -196 -177 13.8641 0.131
NP_442142.1_4 Forward -146 -133 8.57349 0.112
NP_442142.1_4 Forward -163 -150 4.73861 0.212
NP_440357.1_3 Reverse -336 -355 -0.787193 0.296
NP_440620.1_4 Reverse -118 -132 14.1444 0.278
NP_440279.1_6 Forward -39 -20 4.52268 0.28
NP_441448.1_1 Reverse -152 -171 3.24438 0.299
NP_441015.1_10 Reverse -58 -77 -6.09707 0.241
NP_441876.1_9 Forward -318 -308 12.4676 0.267
NP_441764.1_8 Forward -340 -330 11.1193 0.287
NP_442868.1_6 Forward -224 -214 6.8632 0.0956
NP_442868.1_6 Forward -71 -61 0.766681 0.209
NP_442868.1_6 Forward -145 -135 0.471689 0.226
NP_442808.1_1 Forward -216 -206 2.73286 0.256
NP_442718.1_2 Reverse -282 -301 -5.99873 0.295
NP_441878.1_6 Reverse -212 -222 -6.70647 0.194
NP_441878.1_6 Reverse -205 -215 -7.49312 0.231
NP_442066.2_4 Forward -354 -335 -7.4737 0.28
NP_440101.1_10 Forward -197 -178 5.40766 0.208
NP_442397.1_6 Forward -203 -189 15.5359 0.273
NP_441549.1_9 Reverse -264 -282 -9.32229 0.245
NP_442347.1_2 Forward -276 -267 7.07956 0.134
NP_441037.1_4 Reverse -132 -142 6.05075 0.283
NP_442594.1_7 Forward -288 -269 5.01354 0.256
NP_442594.1_8 Reverse -197 -216 4.62101 0.26
NP_442317.1_6 Forward -247 -228 4.81767 0.241
NP_441633.1_3 Forward -224 -211 -7.25721 0.3
NP_442998.1_10 Forward -141 -134 6.0373 0.205
NP_441007.1_10 Reverse -129 -142 8.9674 0.108
NP_441007.1_10 Reverse -55 -68 1.39592 0.203
NP_441559.1_8 Reverse -360 -374 6.48943 0.0779
NP_441559.1_8 Reverse -386 -400 -7.57189 0.295
NP_442158.1_4 Forward -251 -241 11.5831 0.269
NP_441464.1_8 Forward -222 -208 3.93283 0.283
NP_442993.1_1 Forward -222 -206 -10.1679 0.21
NP_442993.1_1 Forward -261 -245 -11.0529 0.233
NP_442386.1_9 Forward -70 -61 4.62087 0.294
NP_441340.1_5 Reverse -61 -68 4.07068 0.239
NP_441340.1_9 Forward -92 -82 7.29115 0.289
NP_441160.1_5 Reverse -328 -347 0.884433 0.288
NP_441027.1_1 Forward -304 -290 16.0269 0.213
NP_440586.1_8 Reverse -240 -247 5.93863 0.283
NP_441262.1_3 Reverse -134 -141 5.34899 0.181
NP_443051.1_1 Reverse -133 -142 0.491382 0.151
NP_440372.1_2 Reverse -61 -68 4.36568 0.205
NP_442783.1_3 Forward -122 -103 13.1758 0.282
NP_442384.1_10 Forward -277 -264 0.904263 0.275
NP_441380.1_8 Forward -325 -306 4.916 0.222
NP_441018.1_7 Reverse -264 -283 8.16093 0.255
NP_442790.1_4 Forward -78 -59 -9.93197 0.198
NP_442262.1_10 Forward -81 -74 7.90559 0.266
NP_442187.1_3 Reverse -133 -143 14.7297 0.151
NP_441896.1_3 Reverse -305 -324 3.44104 0.171
NP_440999.1_9 Forward -265 -251 0.392915 0.187
NP_440822.1_1 Forward -77 -58 12.4797 0.271
NP_439969.1_9 Reverse -388 -400 16.5586 0.254
NP_442033.1_10 Forward -217 -198 -11.5053 0.254
NP_440575.1_1 Forward -86 -67 -3.04956 0.294
NP_440575.1_8 Forward -238 -219 1.76941 0.173
NP_443064.1_6 Reverse -364 -374 8.6886 0.276
NP_441462.1_2 Forward -222 -212 -0.41329 0.225
NP_441462.1_2 Forward -143 -133 -0.806614 0.254
NP_441621.1_7 Forward -71 -57 -5.31028 0.25
NP_443062.1_1 Forward -143 -125 4.45062 0.26
NP_442204.1_2 Forward -79 -60 8.25926 0.259
NP_440516.1_8 Reverse -134 -143 8.25953 0.0391
NP_440516.1_8 Reverse -60 -69 -0.295266 0.232
NP_442859.1_2 Reverse -183 -202 2.0644 0.28
NP_442120.1_10 Forward -260 -241 -15.5368 0.294
NP_440673.1_3 Reverse -254 -261 7.02061 0.274
NP_440673.1_3 Reverse -215 -222 7.02061 0.274
NP_440673.1_3 Reverse -184 -191 6.72562 0.277
NP_442219.1_9 Reverse -234 -243 1.76968 0.298
NP_440648.1_1 Forward -69 -50 7.47261 0.189
NP_441733.1_10 Reverse -57 -70 5.03416 0.231
NP_441004.1_5 Reverse -202 -216 11.0127 0.241
NP_442366.1_3 Reverse -175 -193 11.6222 0.0359
NP_443054.1_2 Reverse -204 -218 3.04785 0.24
NP_442308.1_8 Forward -73 -54 11.0125 0.231
NP_440508.1_2 Reverse -171 -190 14.9324 0.234
NP_442208.1_5 Reverse -55 -74 -0.4922 0.248
NP_442856.1_6 Forward -325 -307 15.358 0.199
NP_441668.1_4 Forward -383 -364 0.491109 0.237
NP_441683.1_7 Forward -374 -355 -6.58872 0.272
NP_441982.1_6 Forward -244 -235 11.5304 0.288
NP_441349.1_10 Forward -232 -213 -3.93378 0.155
NP_441349.1_10 Forward -195 -176 -7.37537 0.248
NP_441409.1_6 Forward -149 -130 1.76941 0.0586
NP_440432.1_9 Forward -142 -127 3.51981 0.0897
NP_440431.1_3 Reverse -81 -100 -6.1954 0.188
NP_442450.1_5 Forward -279 -269 5.97822 0.209
NP_440483.1_1 Reverse -306 -325 -8.45701 0.286
NP_441663.1_8 Forward -75 -56 -1.96717 0.257
NP_441432.1_3 Forward -253 -234 18.8781 0.244
NP_441432.1_5 Forward -79 -65 22.714 0.1
NP_441432.1_8 Forward -192 -183 11.9961 0.0519
NP_441432.1_8 Reverse -319 -328 2.65466 0.292
NP_441432.1_9 Forward -121 -108 18.391 0.0439
NP_441432.1_10 Forward -56 -37 23.9841 0.0238
NP_442320.1_8 Reverse -128 -142 -4.7203 0.185
NP_440760.1_1 Forward -248 -229 -18.6834 0.216
NP_440199.1_10 Forward -188 -178 8.73149 0.231
NP_442178.1_8 Reverse -116 -134 16.6371 0.228
NP_442489.1_7 Reverse -213 -222 5.3096 0.0708
NP_441706.1_10 Forward -188 -169 6.88262 0.3
NP_441452.1_9 Reverse -259 -278 14.4541 0.258
NP_442346.1_5 Forward -192 -182 9.32148 0.118
NP_440459.1_2 Reverse -58 -75 9.47861 0.227
NP_441653.1_2 Forward -272 -253 4.78586 0.253
NP_441833.1_4 Forward -142 -135 4.56234 0.248
NP_443040.1_1 Forward -338 -324 18.0112 0.249
NP_441329.1_6 Forward -351 -332 -0.239153 0.27
NP_441329.1_6 Reverse -105 -124 -2.62645 0.294
NP_442162.1_9 Reverse -61 -68 3.4807 0.246
NP_442162.1_9 Forward -68 -61 3.38237 0.276
NP_442943.1_1 Reverse -110 -125 8.56074 0.194
NP_442199.1_6 Reverse -251 -270 10.4225 0.274
NP_441609.1_1 Forward -45 -26 -2.55715 0.29
NP_440875.1_9 Forward -141 -131 7.69067 0.255
NP_441813.1_5 Forward -71 -61 6.76487 0.0792
NP_440590.1_4 Forward -197 -184 -2.73398 0.249
NP_440227.1_6 Reverse -118 -132 17.2957 0.212
NP_442270.1_9 Reverse -41 -60 -8.16202 0.217
NP_441874.1_1 Reverse -195 -209 10.7177 0.26
NP_440863.1_2 Reverse -87 -103 16.1449 0.207
NP_440354.1_7 Reverse -54 -72 7.09898 0.278
NP_441617.1_6 Forward -124 -105 -7.37537 0.292
NP_440675.1_1 Reverse -310 -329 3.6377 0.251
NP_440462.1_6 Forward -71 -61 3.81494 0.228
NP_440868.1_4 Forward -73 -61 2.0056 0.167
NP_442402.1_4 Reverse -323 -342 -0.00131823 0.186
NP_442402.1_4 Forward -286 -267 -8.16275 0.278
NP_442402.1_4 Reverse -358 -377 -9.9327 0.295
NP_441084.1_6 Forward -57 -43 10.5076 0.238
NP_442039.1_7 Forward -246 -236 15.123 0.211
NP_442039.1_7 Forward -345 -335 11.8781 0.257
NP_441811.1_1 Forward -82 -63 9.14423 0.269
NP_441811.1_8 Forward -283 -269 6.78443 0.263
NP_441811.1_8 Reverse -308 -322 6.6861 0.265
NP_440160.1_2 Reverse -187 -206 -8.06369 0.286
NP_442053.1_1 Forward -69 -60 4.62128 0.235
NP_440505.1_3 Reverse -132 -142 11.0914 0.0877
NP_441408.2_7 Forward -63 -44 -2.16383 0.265
NP_441011.1_8 Forward -54 -45 5.60459 0.247
NP_442533.1_6 Forward -191 -182 3.04799 0.228
NP_441028.1_6 Reverse -357 -367 5.78111 0.243
NP_441527.1_4 Reverse -105 -124 -12.5576 0.291
NP_440115.1_6 Reverse -70 -80 5.68323 0.227
NP_441420.1_1 Forward -223 -204 0.982764 0.194
NP_441286.1_1 Reverse -267 -279 0.628964 0.109
NP_441286.1_1 Reverse -133 -145 -1.04266 0.139
NP_442674.1_2 Forward -204 -185 6.68596 0.298
NP_440886.1_7 Forward -70 -60 14.2375 0.0549
NP_440828.1_1 Forward -289 -270 -0.00131823 0.269
NP_442614.1_2 Reverse -134 -148 12.7826 0.145
NP_441753.1_5 Forward -322 -303 17.0107 0.168
NP_441463.1_2 Forward -123 -105 0.947315 0.262
NP_441463.1_3 Reverse -124 -143 -5.9004 0.235
NP_441962.1_4 Reverse -68 -87 -7.96535 0.195
NP_440855.1_5 Forward -74 -55 7.86512 0.285
NP_441431.1_2 Forward -72 -58 10.0287 0.17
NP_442020.1_1 Reverse -108 -127 -1.77127 0.299
NP_441836.1_2 Reverse -54 -73 -6.39206 0.297
NP_441993.1_1 Reverse -207 -226 4.28566 0.222
NP_441510.2_7 Forward -267 -253 9.83206 0.281
NP_440293.1_3 Reverse -61 -80 -7.08038 0.299
NP_440766.1_4 Forward -19 -5 5.40779 0.112
NP_440766.1_5 Forward -342 -330 6.79636 0.292
NP_440766.1_5 Forward -244 -232 6.50989 0.299
NP_440766.1_5 Reverse -32 -44 6.50989 0.299
NP_440422.1_10 Forward -114 -95 13.9864 0.147
NP_439998.1_9 Forward -291 -272 17.5024 0.175
NP_442680.1_5 Forward -343 -324 2.31911 0.237
NP_441332.1_4 Reverse -106 -125 3.83436 0.293
NP_441332.1_6 Forward -71 -61 15.2288 0.135
NP_442509.1_9 Forward -373 -363 8.14104 0.192
NP_441173.1_9 Reverse -236 -244 11.4254 0.226
NP_441173.1_9 Forward -94 -86 9.85212 0.275
NP_440275.1_3 Forward -263 -253 4.69992 0.178
NP_442932.1_9 Reverse -89 -108 8.16093 0.241
NP_440091.1_10 Forward -85 -67 19.2912 0.156
NP_443010.1_10 Reverse -131 -148 8.37555 0.16
NP_441635.1_1 Forward -125 -106 5.77684 0.259
NP_442373.1_2 Reverse -252 -271 -11.2103 0.293
NP_440172.1_1 Forward -191 -181 8.4365 0.0621
NP_440172.1_1 Forward -400 -390 2.92996 0.258
NP_441350.1_9 Forward -68 -49 17.2065 0.217
NP_442015.1_10 Reverse -264 -277 4.73917 0.162
NP_441226.1_7 Reverse -61 -68 10.0685 0.103
NP_441111.1_7 Forward -142 -134 -0.570565 0.233
NP_440416.1_1 Forward -143 -124 -1.37718 0.116
NP_442116.1_6 Forward -124 -107 5.2087 0.299
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGGATTACGTCGGGCCGGTTAATTTGGGTAATCCGGGGGAATATACCATATTGCAACTGGCAGAAAAAATCCAGAATGCCATTAACCCCGATGCAGAGTTAATTTATCAACCCTTACCGGAGGATGATCCCAAACAGCGGCAACCGGATATTACGTTGGCGAAAACTTATTTAGACTGGCAACCGACCATTCCCCTAGATCAAGGTTTGGCAATGACTATCGAAGATTTCAAATCTCGCCACGAAGGATGATTAATCACGACCGCCTCTTTAAGGAACTTTTGACAATTTTTTTTGCAGAGTTCCTTTAGCAAAAGTTCAGATTGCTCCCCCCGACCGCGTCAAAGTTAAGGCTGAATGTTTGCGACTATTGGTAACCCTCAAGCTAGATCCGGCTAGA

CDS

ATGCAATTAATCTCTGGCTTTGTGGACACCTATCTCACCCTTAACCAAGCGGAAGAGACAATTTTTAAAGAAGCTATCGCTGAATTTTCCCCCCTGGAACAGGAGGACGTTATGCAGTTAACAACCAGTTGGATGCTTCAGGGCATTGAACAGGGCATCGAACGTGGACAAAAATCTCTGCTACTCAAACAAATTAGACATCGTTTTGGAGAGTTGAATGCAGTTAATTTGTCGAGGATTGACATTCTCACAGTGCCTCAATTGGAACAGTTGGGAGAAGTGCTGTTGGACTGCTCTGATTTCGCAGAATTAGAACAATGGCTAGCGGCCCAATCTGAAACACCTGAGCGAAAAATTTAG

Protein

MQLISGFVDTYLTLNQAEETIFKEAIAEFSPLEQEDVMQLTTSWMLQGIEQGIERGQKSLLLKQIRHRFGELNAVNLSRIDILTVPQLEQLGEVLLDCSDFAELEQWLAAQSETPERKI