Your browser is old and dusty. Try Google Chrome!

Details for slr0809

ORF slr0809
Accession NP_441431.1
Symbol rfbB
Category Surface polysaccharides, lipopolysaccharides and antigens
Definition dTDP-glucose 4,6-dehydratase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -249 -263 22.0257 0.00612
NP_441061.1_2 Reverse -255 -269 10.521 0.0605
NP_440795.1_7 Forward -256 -249 14.6904 0.0123
NP_440795.1_7 Reverse -249 -256 14.6904 0.0123
NP_441418.1_6 Reverse -248 -267 -9.63698 0.0288
NP_441418.1_6 Reverse -326 -345 -19.0768 0.0844
NP_441418.1_6 Forward -171 -152 -25.0749 0.201
NP_442291.1_5 Reverse -247 -263 6.15506 0.0727
NP_442291.1_5 Forward -336 -320 -5.05468 0.296
NP_441453.1_4 Reverse -248 -256 16.539 0.00633
NP_441453.1_4 Forward -257 -249 16.539 0.00633
NP_441453.1_4 Forward -335 -327 14.8674 0.00947
NP_441453.1_4 Reverse -326 -334 6.80426 0.121
NP_442151.1_6 Forward -257 -243 18.1908 0.00782
NP_442151.1_6 Reverse -248 -262 10.6193 0.119
NP_441818.1_1 Reverse -249 -260 18.8393 0.00301
NP_440226.1_1 Forward -257 -238 6.29264 0.132
NP_440226.1_1 Forward -335 -316 5.11266 0.166
NP_441465.1_8 Reverse -315 -333 6.11567 0.279
NP_442173.1_1 Forward -256 -248 15.4574 0.00633
NP_442173.1_1 Reverse -249 -257 15.4574 0.00633
NP_442173.1_1 Reverse -327 -335 13.8841 0.0225
NP_442173.1_1 Forward -334 -326 12.0158 0.0316
NP_442752.1_4 Reverse -326 -333 13.8055 0.0199
NP_442752.1_4 Forward -257 -250 13.8055 0.0199
NP_442752.1_4 Reverse -248 -255 13.8055 0.0199
NP_443027.1_4 Forward -259 -249 14.0414 0.0452
NP_443027.1_4 Reverse -246 -256 7.25653 0.24
NP_441745.1_7 Reverse -109 -128 18.584 0.227
NP_442975.1_10 Forward -261 -247 13.4703 0.0459
NP_442975.1_10 Reverse -244 -258 10.8154 0.0516
NP_442975.1_10 Reverse -191 -205 6.29216 0.184
NP_442975.1_10 Forward -339 -325 2.75226 0.269
NP_442975.1_10 Forward -151 -137 1.37564 0.299
NP_440784.1_7 Forward -256 -249 15.9687 0.0123
NP_440784.1_7 Reverse -249 -256 15.9687 0.0123
NP_440784.1_7 Reverse -216 -223 6.43063 0.218
NP_440784.1_7 Reverse -327 -334 6.23397 0.241
NP_440784.1_7 Forward -334 -327 6.13563 0.241
NP_442909.1_7 Reverse -249 -263 10.717 0.131
NP_440878.1_9 Reverse -238 -257 -3.54046 0.299
NP_442062.1_8 Reverse -248 -258 17.3846 0.00193
NP_442062.1_8 Forward -257 -247 10.3048 0.0493
NP_442062.1_8 Reverse -326 -336 9.7148 0.0559
NP_440761.1_4 Forward -262 -243 -13.5702 0.257
NP_441859.1_3 Reverse -72 -91 14.4533 0.0704
NP_441859.1_3 Reverse -247 -266 9.24175 0.13
NP_440304.1_4 Forward -259 -249 10.8948 0.051
NP_440304.1_4 Reverse -246 -256 10.8948 0.051
NP_442242.1_4 Forward -256 -249 14.3954 0.0124
NP_442242.1_4 Reverse -249 -256 14.3954 0.0124
NP_440044.1_8 Reverse -249 -268 -2.36049 0.262
NP_441781.1_7 Reverse -248 -267 9.53756 0.138
NP_440908.1_7 Forward -343 -333 17.8763 0.285
NP_441581.1_6 Forward -344 -325 13.4617 0.283
NP_441208.1_9 Reverse -245 -259 7.47274 0.221
NP_441594.1_6 Forward -266 -247 1.86774 0.261
NP_442110.1_7 Forward -257 -243 12.3893 0.0586
NP_442110.1_7 Reverse -248 -262 10.0294 0.0684
NP_441083.1_5 Reverse -248 -258 20.3345 0.00053
NP_441083.1_5 Forward -257 -247 11.2881 0.0159
NP_441083.1_5 Forward -335 -325 0.766681 0.218
NP_441083.1_5 Reverse -326 -336 -1.00328 0.289
NP_442827.1_8 Reverse -133 -152 -0.29631 0.224
NP_441738.1_2 Forward -333 -326 15.28 0.0102
NP_441738.1_2 Forward -255 -248 15.28 0.0102
NP_441738.1_2 Reverse -250 -257 15.28 0.0102
NP_441558.1_5 Forward -259 -240 11.9958 0.0736
NP_441645.1_1 Reverse -201 -220 9.53674 0.223
NP_440209.1_1 Reverse -248 -256 18.1123 0.00295
NP_440209.1_1 Forward -257 -249 18.1123 0.00295
NP_440209.1_1 Reverse -326 -334 8.57422 0.0425
NP_442889.1_8 Reverse -245 -259 7.76712 0.141
NP_442889.1_8 Forward -260 -246 3.63724 0.273
NP_441713.1_1 Reverse -242 -261 -15.2418 0.261
NP_440178.1_7 Forward -336 -317 -13.4719 0.136
NP_440178.1_7 Forward -258 -239 -20.5517 0.194
NP_442461.1_2 Reverse -180 -199 12.2908 0.296
NP_441716.1_1 Reverse -248 -262 12.586 0.0741
NP_441716.1_1 Reverse -254 -268 2.75286 0.294
NP_442111.1_4 Forward -258 -244 20.3541 0.00311
NP_442111.1_4 Forward -336 -322 4.91614 0.185
NP_442111.1_4 Reverse -72 -86 3.44117 0.244
NP_440906.1_5 Forward -256 -249 15.8704 0.0124
NP_440906.1_5 Reverse -249 -256 15.8704 0.0124
NP_440906.1_5 Reverse -327 -334 6.23397 0.234
NP_440906.1_5 Forward -334 -327 6.13563 0.241
NP_440747.1_10 Reverse -245 -257 15.2803 0.0019
NP_440747.1_10 Forward -260 -248 7.51213 0.00286
NP_440747.1_10 Forward -338 -326 -12.2524 0.254
NP_440747.1_10 Forward -221 -209 -12.3507 0.27
NP_441486.1_1 Forward -260 -246 15.1426 0.0061
NP_441486.1_1 Reverse -245 -259 3.63784 0.0563
NP_441486.1_1 Reverse -323 -337 -4.4253 0.198
NP_441486.1_1 Forward -338 -324 -5.40861 0.237
NP_442145.1_3 Forward -317 -298 6.4893 0.243
NP_442634.1_4 Forward -259 -245 -1.18038 0.149
NP_442634.1_4 Reverse -246 -260 -2.36035 0.149
NP_441265.1_3 Reverse -242 -256 1.67122 0.2
NP_441014.1_8 Forward -342 -323 -8.35868 0.283
NP_442848.1_1 Forward -263 -249 16.0275 0.0143
NP_443018.1_3 Forward -256 -249 14.8871 0.0123
NP_443018.1_3 Reverse -249 -256 14.8871 0.0123
NP_443018.1_3 Forward -334 -327 11.7405 0.0655
NP_443018.1_3 Reverse -327 -334 5.44732 0.193
NP_441316.1_7 Forward -259 -244 5.09311 0.121
NP_440376.1_1 Forward -257 -248 19.4693 0.000692
NP_440376.1_1 Reverse -248 -257 19.4693 0.000692
NP_440376.1_1 Reverse -326 -335 5.89959 0.116
NP_440376.1_1 Forward -335 -326 -0.0986038 0.285
NP_441588.1_4 Reverse -250 -260 8.63316 0.14
NP_441588.1_4 Forward -255 -245 7.05986 0.178
NP_441588.1_4 Forward -333 -323 6.96153 0.178
NP_442687.1_7 Reverse -247 -257 9.02648 0.0994
NP_442687.1_7 Forward -258 -248 8.92815 0.0994
NP_442687.1_7 Reverse -325 -335 5.78156 0.188
NP_441846.1_10 Reverse -322 -341 -22.5183 0.261
NP_441422.1_7 Forward -337 -320 2.98877 0.113
NP_442296.1_5 Reverse -239 -258 2.85105 0.257
NP_442296.1_9 Reverse -249 -268 -2.36049 0.224
NP_442658.1_1 Reverse -246 -256 13.0576 0.04
NP_442658.1_1 Reverse -139 -149 9.71433 0.147
NP_442658.1_1 Forward -259 -249 6.76441 0.214
NP_442658.1_1 Forward -337 -327 6.56775 0.224
NP_442658.1_1 Forward -123 -113 4.89613 0.292
NP_442782.1_2 Forward -328 -314 3.8345 0.261
NP_442782.1_7 Forward -265 -246 2.0644 0.193
NP_442205.1_9 Reverse -156 -172 -3.48138 0.283
NP_441414.1_9 Forward -257 -238 -1.18052 0.0993
NP_441414.1_9 Reverse -248 -267 -6.58872 0.199
NP_441414.1_9 Forward -335 -316 -8.26035 0.232
NP_441256.1_1 Reverse -251 -270 -7.57203 0.239
NP_441958.1_5 Reverse -247 -257 21.2195 0.000805
NP_441958.1_5 Reverse -325 -335 17.6796 0.00183
NP_441958.1_5 Forward -258 -248 12.2714 0.00183
NP_442057.1_5 Forward -290 -272 17.9838 0.0926
NP_442836.1_5 Reverse -33 -52 5.11266 0.193
NP_440203.1_5 Forward -254 -244 13.4509 0.115
NP_440203.1_5 Forward -332 -322 8.92768 0.281
NP_440203.1_5 Reverse -304 -314 8.63269 0.29
NP_439905.1_1 Reverse -210 -223 16.7355 0.0578
NP_439905.1_1 Forward -149 -136 13.9823 0.145
NP_440984.1_7 Reverse -243 -257 9.73436 0.127
NP_439990.1_5 Forward -262 -249 10.049 0.128
NP_439990.1_5 Reverse -243 -256 8.08242 0.181
NP_442690.1_1 Forward -201 -182 -10.6203 0.217
NP_442911.1_2 Forward -267 -248 5.89931 0.0311
NP_442911.1_2 Reverse -238 -257 3.24438 0.045
NP_440153.1_5 Reverse -249 -263 5.70279 0.191
NP_440153.1_5 Forward -334 -320 5.30946 0.191
NP_440153.1_5 Reverse -327 -341 3.14618 0.219
NP_440153.1_8 Forward -345 -332 7.19745 0.168
NP_442064.1_4 Forward -273 -254 13.175 0.147
NP_440993.1_2 Reverse -243 -259 3.59845 0.256
NP_440993.1_2 Forward -176 -160 3.40179 0.259
NP_440993.1_3 Reverse -238 -257 10.0284 0.116
NP_440993.1_3 Forward -345 -326 5.89851 0.148
NP_440827.1_3 Reverse -310 -329 12.5858 0.247
NP_440602.1_2 Reverse -41 -60 3.04771 0.263
NP_443044.1_1 Reverse -73 -92 2.0644 0.296
NP_441099.1_5 Forward -267 -248 6.88262 0.0431
NP_441294.1_7 Forward -261 -247 10.1145 0.207
NP_441294.1_7 Reverse -244 -258 9.15464 0.256
NP_441294.1_7 Forward -339 -325 8.77068 0.281
NP_442438.1_10 Forward -262 -248 6.29277 0.118
NP_442438.1_10 Reverse -243 -257 1.76955 0.188
NP_442438.1_10 Forward -340 -326 -0.295402 0.256
NP_441000.1_6 Reverse -325 -339 -4.22864 0.231
NP_440147.1_4 Reverse -324 -337 15.4572 0.0171
NP_440147.1_4 Reverse -246 -259 12.9006 0.0326
NP_440147.1_4 Forward -259 -246 1.59258 0.224
NP_441175.1_7 Forward -257 -238 5.11266 0.291
NP_441550.1_8 Reverse -246 -256 15.3192 0.0132
NP_441550.1_8 Reverse -324 -334 14.0409 0.0194
NP_441550.1_8 Forward -259 -249 12.3692 0.0336
NP_441916.1_7 Forward -257 -247 18.9579 0.00144
NP_441916.1_7 Reverse -248 -258 10.3048 0.0261
NP_441916.1_7 Forward -335 -325 10.0098 0.0283
NP_441916.1_7 Reverse -326 -336 6.66654 0.0875
NP_441916.1_7 Forward -121 -111 3.12662 0.227
NP_441916.1_10 Forward -265 -246 5.40766 0.213
NP_440206.1_4 Forward -340 -321 -0.39464 0.29
NP_441041.1_4 Forward -257 -238 1.57275 0.0804
NP_441041.1_4 Reverse -248 -267 -1.96717 0.106
NP_441041.1_4 Forward -335 -316 -4.72043 0.141
NP_441041.1_4 Forward -269 -250 -12.6852 0.272
NP_441041.1_7 Reverse -245 -257 14.4144 0.0348
NP_441041.1_7 Reverse -36 -48 11.9849 0.0689
NP_442004.1_6 Forward -257 -243 3.8345 0.231
NP_442004.1_6 Reverse -248 -262 1.76955 0.278
NP_441725.1_4 Reverse -72 -86 6.19383 0.278
NP_441725.1_4 Reverse -243 -257 3.93223 0.278
NP_441725.1_5 Reverse -249 -259 11.2881 0.0247
NP_441725.1_5 Forward -149 -139 2.83163 0.115
NP_441725.1_5 Forward -256 -246 1.94665 0.115
NP_439966.1_7 Forward -259 -249 15.8108 0.0124
NP_439966.1_7 Forward -337 -327 8.73102 0.13
NP_439966.1_7 Reverse -246 -256 6.27276 0.185
NP_442941.1_3 Reverse -249 -259 19.9412 0.00262
NP_442941.1_3 Forward -256 -246 11.0914 0.0116
NP_442941.1_3 Forward -203 -193 2.83163 0.14
NP_442941.1_3 Forward -334 -324 1.25834 0.15
NP_440289.1_2 Forward -260 -247 6.50913 0.0591
NP_440289.1_2 Reverse -245 -258 -4.89726 0.294
NP_440260.1_8 Reverse -251 -269 -4.01242 0.263
NP_442281.1_1 Reverse -243 -257 17.6002 0.00542
NP_442281.1_1 Forward -262 -248 17.5018 0.00555
NP_442281.1_1 Forward -340 -326 9.6354 0.0684
NP_442256.1_2 Forward -259 -241 -7.749 0.215
NP_440437.1_1 Reverse -242 -261 -5.70374 0.292
NP_442012.1_1 Reverse -320 -339 -1.7705 0.297
NP_440498.1_1 Reverse -239 -257 1.39578 0.206
NP_440498.1_1 Reverse -317 -335 -3.91409 0.281
NP_442982.1_5 Reverse -238 -257 0.786102 0.233
NP_440375.1_8 Forward -334 -315 9.83255 0.138
NP_441644.1_6 Forward -257 -247 19.0557 0.000803
NP_441644.1_6 Reverse -248 -258 17.3841 0.00127
NP_441644.1_6 Forward -335 -325 16.4008 0.00405
NP_441644.1_6 Forward -218 -208 4.7978 0.224
NP_441644.1_6 Reverse -254 -264 4.69947 0.228
NP_442215.1_2 Forward -259 -243 8.90832 0.0605
NP_442215.1_2 Reverse -246 -262 6.25339 0.0723
NP_440253.1_2 Reverse -248 -266 4.6407 0.1
NP_440929.1_8 Forward -257 -248 19.2726 0.000701
NP_440929.1_8 Reverse -248 -257 19.2726 0.000701
NP_440929.1_8 Forward -335 -326 7.17789 0.0713
NP_442933.1_10 Forward -257 -248 17.601 0.00325
NP_442933.1_10 Reverse -248 -257 17.601 0.00325
NP_442933.1_10 Forward -171 -162 8.45619 0.0741
NP_442933.1_10 Forward -335 -326 8.06287 0.0885
NP_442933.1_10 Reverse -326 -335 7.96454 0.0937
NP_441751.2_8 Reverse -249 -263 15.4376 0.0119
NP_442554.1_8 Forward -256 -246 16.4013 0.0065
NP_442554.1_8 Reverse -249 -259 15.9097 0.00747
NP_442554.1_8 Forward -334 -324 6.56821 0.112
NP_442554.1_8 Reverse -327 -337 2.14332 0.281
NP_441762.1_7 Forward -336 -324 1.41561 0.0747
NP_441762.1_7 Forward -258 -246 0.333971 0.0747
NP_441762.1_7 Reverse -247 -259 -6.74586 0.284
NP_442142.1_4 Forward -260 -247 14.7683 0.0302
NP_442142.1_4 Reverse -245 -258 11.6217 0.054
NP_442142.1_4 Reverse -212 -225 4.05029 0.234
NP_442142.1_4 Forward -266 -253 2.37867 0.294
NP_442292.1_1 Reverse -249 -258 18.486 0.00229
NP_442292.1_1 Forward -256 -247 17.5026 0.00435
NP_442292.1_1 Forward -334 -325 7.66954 0.0634
NP_443009.1_5 Forward -258 -247 14.5128 0.02
NP_443009.1_5 Reverse -247 -258 10.1862 0.0792
NP_443009.1_5 Reverse -325 -336 8.80962 0.099
NP_443009.1_5 Forward -311 -300 8.71129 0.102
NP_443009.1_5 Forward -103 -92 4.18809 0.259
NP_441715.1_4 Reverse -249 -259 14.828 0.0268
NP_441715.1_4 Reverse -327 -337 7.84651 0.107
NP_441715.1_4 Forward -256 -246 7.35486 0.108
NP_440357.1_3 Forward -152 -133 1.96607 0.269
NP_440881.1_4 Reverse -302 -321 0.294447 0.233
NP_441448.1_1 Reverse -130 -149 16.9124 0.157
NP_441198.1_8 Reverse -246 -256 12.783 0.116
NP_441198.1_8 Forward -312 -302 12.5877 0.12
NP_440464.1_10 Reverse -196 -206 15.8729 0.169
NP_441468.1_1 Forward -256 -249 15.8704 0.0124
NP_441468.1_1 Reverse -249 -256 15.8704 0.0124
NP_441468.1_1 Reverse -327 -334 6.13563 0.209
NP_441468.1_1 Forward -334 -327 6.0373 0.223
NP_441020.2_6 Reverse -336 -353 5.84037 0.289
NP_441015.1_10 Reverse -321 -340 -5.21209 0.219
NP_441015.1_10 Forward -262 -243 -11.4069 0.296
NP_441673.1_1 Forward -257 -248 20.8459 0.000698
NP_441673.1_1 Reverse -248 -257 20.8459 0.000698
NP_441673.1_1 Forward -335 -326 1.27803 0.155
NP_441673.1_1 Reverse -326 -335 1.27803 0.155
NP_441339.1_4 Forward -225 -206 -2.75381 0.227
NP_441876.1_9 Reverse -197 -207 11.3859 0.275
NP_441426.1_8 Reverse -214 -232 10.3439 0.228
NP_441826.1_2 Forward -263 -249 22.0257 0.00354
NP_441826.1_2 Reverse -248 -262 -0.590395 0.215
NP_441826.1_2 Reverse -242 -256 -1.77037 0.254
NP_441826.1_5 Reverse -310 -329 1.37609 0.291
NP_442868.1_6 Forward -259 -249 9.91146 0.038
NP_442868.1_6 Forward -50 -40 6.76487 0.101
NP_442868.1_6 Reverse -246 -256 0.963343 0.205
NP_441056.1_1 Reverse -248 -267 0.491109 0.156
NP_441612.1_2 Reverse -248 -258 8.54929 0.21
NP_442559.1_3 Reverse -130 -149 6.98095 0.297
NP_442227.1_2 Reverse -308 -327 1.86774 0.242
NP_442361.1_3 Forward -263 -250 8.08242 0.285
NP_442361.1_3 Reverse -242 -255 7.98409 0.285
NP_442808.1_1 Forward -336 -326 10.501 0.0481
NP_442808.1_1 Reverse -247 -257 8.73102 0.0481
NP_442808.1_1 Forward -258 -248 8.63269 0.0481
NP_442775.1_1 Reverse -121 -140 16.3224 0.22
NP_442775.1_6 Forward -262 -243 11.3075 0.277
NP_440145.1_3 Reverse -238 -257 2.45773 0.118
NP_442542.1_2 Reverse -37 -50 6.1158 0.234
NP_442542.1_9 Forward -342 -328 5.50552 0.261
NP_442050.1_5 Forward -259 -249 16.4991 0.00812
NP_442050.1_5 Reverse -246 -256 9.22267 0.193
NP_440558.1_2 Reverse -239 -258 -7.37537 0.293
NP_441518.1_3 Forward -267 -248 -15.3402 0.291
NP_441878.1_6 Reverse -247 -257 10.5014 0.0176
NP_441878.1_6 Forward -258 -248 10.4031 0.0176
NP_441878.1_6 Forward -219 -209 -7.49312 0.231
NP_441036.1_8 Reverse -247 -257 15.713 0.00724
NP_441036.1_8 Reverse -325 -335 10.5014 0.167
NP_441036.1_8 Forward -258 -248 8.33817 0.174
NP_441036.1_8 Forward -336 -326 8.1415 0.176
NP_441557.1_5 Forward -257 -248 19.9609 0.000699
NP_441557.1_5 Reverse -248 -257 19.9609 0.000699
NP_441557.1_5 Reverse -326 -335 8.94785 0.0289
NP_441557.1_5 Forward -335 -326 0.688044 0.128
NP_440084.1_8 Forward -232 -218 10.0383 0.271
NP_440101.1_3 Reverse -321 -340 5.11266 0.202
NP_440101.1_3 Reverse -243 -262 0.786102 0.292
NP_441458.1_8 Forward -364 -345 3.54155 0.273
NP_442183.1_1 Reverse -248 -262 18.3875 0.00758
NP_442397.1_9 Reverse -248 -267 5.50599 0.246
NP_441116.1_3 Forward -377 -358 13.8641 0.135
NP_441574.1_1 Reverse -248 -267 -3.14714 0.236
NP_441574.1_1 Forward -375 -356 -7.67036 0.293
NP_441549.1_9 Forward -261 -243 -6.37237 0.198
NP_441549.1_9 Forward -339 -321 -8.14232 0.221
NP_442347.1_2 Reverse -249 -258 12.4878 0.056
NP_442347.1_2 Reverse -196 -205 8.1612 0.108
NP_442347.1_2 Forward -256 -247 3.34298 0.284
NP_442645.1_2 Reverse -318 -337 -13.8652 0.165
NP_442645.1_2 Forward -265 -246 -16.8151 0.242
NP_442645.1_2 Reverse -246 -265 -22.0267 0.29
NP_442888.1_9 Reverse -248 -267 15.9291 0.179
NP_441037.1_4 Reverse -246 -256 15.0168 0.028
NP_441037.1_4 Reverse -324 -334 5.95329 0.289
NP_441633.1_3 Forward -259 -246 -6.07724 0.236
NP_441633.1_3 Reverse -246 -259 -6.07724 0.236
NP_440136.1_2 Forward -256 -249 15.9687 0.0123
NP_440136.1_2 Reverse -249 -256 15.9687 0.0123
NP_440136.1_2 Reverse -327 -334 6.23397 0.171
NP_440136.1_2 Forward -334 -327 6.13563 0.193
NP_442590.1_10 Forward -335 -316 6.78429 0.237
NP_442590.1_10 Reverse -248 -267 5.01433 0.267
NP_442590.1_10 Forward -263 -244 2.94938 0.299
NP_442998.1_5 Reverse -224 -234 10.2065 0.222
NP_442998.1_10 Forward -333 -326 15.5754 0.0102
NP_442998.1_10 Forward -255 -248 15.5754 0.0102
NP_442998.1_10 Reverse -250 -257 15.5754 0.0102
NP_440299.1_1 Forward -261 -248 14.08 0.0259
NP_440299.1_1 Reverse -244 -257 13.195 0.0319
NP_440299.1_1 Forward -339 -326 2.67367 0.279
NP_441799.1_1 Reverse -322 -336 11.7987 0.0524
NP_441799.1_1 Reverse -244 -258 10.0287 0.0797
NP_441799.1_1 Forward -261 -247 4.42388 0.25
NP_441799.1_1 Forward -339 -325 3.44058 0.298
NP_441007.1_10 Reverse -243 -256 1.29759 0.203
NP_441007.1_10 Forward -262 -249 0.412608 0.23
NP_441007.1_10 Reverse -136 -149 -1.06236 0.3
NP_440256.1_1 Reverse -323 -342 15.9291 0.00634
NP_440256.1_1 Reverse -245 -264 6.78429 0.0288
NP_440256.1_1 Forward -260 -241 -1.67217 0.106
NP_440256.1_1 Reverse -206 -225 -5.50708 0.184
NP_442961.1_4 Forward -170 -151 8.06259 0.148
NP_442007.1_3 Reverse -283 -302 10.7167 0.265
NP_441512.1_4 Reverse -322 -341 9.24257 0.244
NP_441559.1_8 Reverse -243 -257 1.08123 0.156
NP_441559.1_8 Reverse -296 -310 -6.78525 0.279
NP_441559.1_8 Reverse -190 -204 -6.88358 0.281
NP_441559.1_8 Reverse -108 -122 -7.08024 0.283
NP_441559.1_8 Forward -340 -326 -7.37523 0.291
NP_440915.1_6 Forward -261 -247 13.5693 0.0187
NP_440915.1_6 Reverse -244 -258 3.73617 0.1
NP_440915.1_6 Forward -86 -72 2.65453 0.113
NP_440915.1_6 Forward -339 -325 2.06454 0.126
NP_442785.1_7 Reverse -324 -338 8.35772 0.298
NP_442866.1_1 Reverse -243 -262 -7.57203 0.266
NP_440748.1_5 Reverse -251 -270 3.24438 0.21
NP_442031.1_3 Reverse -308 -327 11.1109 0.156
NP_441464.1_8 Forward -48 -34 6.58777 0.231
NP_440026.1_4 Reverse -323 -342 12.0942 0.239
NP_441199.1_6 Reverse -244 -263 2.94938 0.19
NP_441494.1_6 Forward -315 -302 10.344 0.227
NP_441494.1_6 Reverse -243 -256 6.01747 0.289
NP_442993.1_1 Reverse -248 -264 -6.92296 0.146
NP_442993.1_1 Forward -240 -224 -11.7412 0.257
NP_440677.1_6 Forward -320 -301 15.6341 0.131
NP_442386.1_9 Forward -258 -249 13.8639 0.0289
NP_442386.1_9 Forward -336 -327 12.8806 0.0501
NP_442386.1_9 Reverse -247 -256 6.39082 0.219
NP_441750.1_1 Forward -324 -305 -9.83364 0.3
NP_441750.1_4 Forward -222 -203 1.0811 0.289
NP_441340.1_5 Forward -256 -249 15.6737 0.0124
NP_441340.1_5 Reverse -249 -256 15.6737 0.0124
NP_441340.1_5 Reverse -327 -334 13.5105 0.0314
NP_441340.1_5 Forward -334 -327 5.84064 0.208
NP_441947.1_10 Reverse -252 -270 1.78911 0.276
NP_442484.1_2 Reverse -237 -256 2.0644 0.226
NP_442791.1_5 Reverse -318 -337 -10.6203 0.279
NP_442240.1_2 Forward -256 -237 -10.1286 0.137
NP_442240.1_2 Forward -295 -276 -14.2585 0.177
NP_440586.1_8 Forward -256 -249 13.2151 0.026
NP_440586.1_8 Reverse -249 -256 13.2151 0.026
NP_440586.1_8 Forward -334 -327 9.47853 0.146
NP_440586.1_8 Reverse -74 -81 8.88855 0.205
NP_440586.1_8 Reverse -327 -334 5.74197 0.283
NP_442251.1_6 Forward -256 -249 15.2804 0.0124
NP_442251.1_6 Reverse -249 -256 15.2804 0.0124
NP_440684.1_9 Forward -263 -249 18.0925 0.0407
NP_440684.1_9 Forward -395 -381 13.2743 0.168
NP_441262.1_3 Reverse -326 -333 14.7888 0.0223
NP_441262.1_3 Reverse -248 -255 14.7888 0.0223
NP_441262.1_3 Forward -257 -250 14.7888 0.0223
NP_440027.1_3 Forward -345 -327 4.34495 0.262
NP_440027.1_3 Reverse -326 -344 1.98502 0.295
NP_440027.1_8 Forward -260 -241 5.11187 0.285
NP_443051.1_1 Reverse -247 -256 19.5676 0.00335
NP_443051.1_1 Reverse -325 -334 16.6177 0.00754
NP_443051.1_1 Forward -258 -249 10.4228 0.00754
NP_440451.1_10 Forward -256 -237 9.83173 0.264
NP_441232.1_9 Reverse -75 -94 15.5349 0.295
NP_440439.1_1 Reverse -323 -336 9.95071 0.0413
NP_440439.1_1 Forward -338 -325 7.39411 0.0659
NP_440439.1_1 Reverse -245 -258 2.08423 0.138
NP_440439.1_1 Forward -260 -247 -0.177378 0.209
NP_442239.1_8 Forward -322 -303 7.86593 0.255
NP_439943.1_7 Forward -262 -243 6.88262 0.208
NP_440372.1_2 Forward -256 -249 16.3621 0.0124
NP_440372.1_2 Reverse -249 -256 16.3621 0.0124
NP_440372.1_2 Reverse -327 -334 13.8055 0.0214
NP_440372.1_2 Forward -334 -327 6.52896 0.188
NP_441803.1_2 Reverse -243 -262 3.93269 0.185
NP_439977.1_5 Reverse -242 -261 3.6377 0.159
NP_441572.1_7 Reverse -242 -261 -3.44213 0.212
NP_441572.1_7 Forward -341 -322 -4.42544 0.235
NP_441572.1_7 Forward -263 -244 -4.91709 0.245
NP_440267.1_2 Reverse -204 -218 5.30886 0.272
NP_442384.1_10 Forward -257 -244 15.4572 0.00986
NP_442384.1_10 Forward -335 -322 12.409 0.0283
NP_442384.1_10 Reverse -248 -261 10.049 0.047
NP_442384.1_10 Reverse -326 -339 1.19926 0.267
NP_442384.1_10 Reverse -209 -222 0.510939 0.289
NP_441604.1_4 Reverse -240 -259 2.75272 0.211
NP_442713.1_1 Reverse -291 -310 -0.295539 0.284
NP_441018.1_7 Reverse -244 -263 8.55425 0.242
NP_442790.1_4 Forward -266 -247 -8.26035 0.166
NP_442790.1_4 Forward -91 -72 -10.817 0.218
NP_442790.1_4 Forward -344 -325 -15.5368 0.294
NP_442262.1_10 Forward -256 -249 14.1988 0.0123
NP_442262.1_10 Reverse -249 -256 14.1988 0.0123
NP_442262.1_10 Forward -334 -327 13.2155 0.0213
NP_441689.1_5 Forward -259 -249 15.3192 0.0403
NP_441689.1_5 Reverse -246 -256 8.3377 0.132
NP_441689.1_5 Reverse -324 -334 5.78111 0.197
NP_440163.1_10 Forward -260 -250 11.3864 0.169
NP_440344.1_10 Forward -264 -247 2.30045 0.0283
NP_440344.1_10 Reverse -241 -258 -6.746 0.114
NP_440282.1_10 Forward -267 -248 -6.68705 0.25
NP_440531.1_6 Reverse -201 -220 -3.14714 0.262
NP_441060.1_2 Reverse -255 -274 12.9791 0.181
NP_441965.1_3 Forward -267 -248 4.12936 0.177
NP_441965.1_10 Forward -260 -244 8.80999 0.123
NP_441965.1_10 Forward -227 -211 3.79511 0.253
NP_441640.1_8 Reverse -249 -268 -5.70374 0.289
NP_440297.1_9 Reverse -249 -259 9.32148 0.0917
NP_440297.1_9 Forward -256 -246 -0.216628 0.282
NP_440894.1_10 Reverse -243 -262 3.93269 0.261
NP_440999.1_9 Forward -339 -325 6.88276 0.0932
NP_440999.1_9 Reverse -244 -258 3.34284 0.131
NP_440999.1_9 Forward -261 -247 1.76955 0.158
NP_440888.1_2 Reverse -248 -262 18.0918 0.00261
NP_440888.1_2 Reverse -209 -223 9.24208 0.134
NP_440888.1_2 Forward -257 -243 8.84875 0.145
NP_440888.1_2 Forward -335 -321 6.19383 0.243
NP_440600.1_4 Forward -343 -325 -4.50408 0.262
NP_440491.1_1 Forward -260 -241 10.4255 0.188
NP_442948.1_2 Reverse -247 -266 6.19431 0.244
NP_442277.1_4 Forward -344 -325 7.37347 0.146
NP_442033.1_10 Reverse -299 -318 -14.0619 0.296
NP_441543.1_2 Reverse -249 -258 16.9127 0.00359
NP_441543.1_2 Forward -256 -247 15.9293 0.00518
NP_441543.1_2 Reverse -327 -336 6.09625 0.153
NP_441543.1_2 Forward -334 -325 6.09625 0.153
NP_442845.1_2 Forward -263 -249 13.9626 0.088
NP_442845.1_2 Reverse -242 -256 11.7993 0.122
NP_442845.1_2 Reverse -320 -334 6.3911 0.21
NP_441469.1_8 Reverse -247 -256 6.5879 0.227
NP_441469.1_8 Forward -258 -249 6.48957 0.227
NP_442315.1_3 Forward -204 -185 6.68596 0.237
NP_443064.1_6 Reverse -248 -258 12.5669 0.0796
NP_443064.1_6 Forward -257 -247 10.8217 0.13
NP_443064.1_6 Forward -362 -352 8.39772 0.292
NP_442578.1_7 Forward -256 -249 14.5921 0.026
NP_442578.1_7 Reverse -249 -256 14.5921 0.026
NP_442578.1_7 Reverse -327 -334 6.0373 0.18
NP_440710.1_1 Reverse -201 -219 -9.12563 0.294
NP_441462.1_2 Forward -257 -247 20.2362 0.000805
NP_441462.1_2 Reverse -248 -258 11.5831 0.00406
NP_441462.1_2 Reverse -326 -336 8.82982 0.03
NP_441462.1_2 Forward -335 -325 0.668351 0.135
NP_441621.1_7 Forward -259 -245 -5.11362 0.248
NP_443062.1_1 Forward -257 -239 16.1515 0.0321
NP_443062.1_1 Reverse -248 -266 16.1515 0.0321
NP_443062.1_1 Forward -335 -317 7.27833 0.18
NP_443062.1_6 Forward -265 -246 2.16274 0.26
NP_442204.1_1 Reverse -244 -255 18.2499 0.0189
NP_442204.1_1 Reverse -322 -333 6.74518 0.152
NP_442204.1_1 Forward -261 -250 0.353664 0.281
NP_442204.1_2 Forward -345 -326 6.98095 0.287
NP_440516.1_2 Forward -341 -323 1.19912 0.204
NP_440516.1_8 Forward -257 -248 16.9127 0.00442
NP_440516.1_8 Reverse -248 -257 16.9127 0.00442
NP_440516.1_8 Reverse -326 -335 9.4395 0.0183
NP_440516.1_8 Forward -335 -326 5.11294 0.118
NP_441785.1_1 Reverse -248 -262 18.5558 0.06
NP_442428.1_5 Forward -256 -249 15.8704 0.0124
NP_442428.1_5 Reverse -249 -256 15.8704 0.0124
NP_442428.1_5 Reverse -327 -334 6.13563 0.209
NP_442428.1_5 Forward -334 -327 6.0373 0.212
NP_441443.1_1 Forward -319 -300 -6.1954 0.3
NP_442120.1_10 Reverse -248 -267 -0.688862 0.167
NP_442120.1_10 Forward -263 -244 -6.29373 0.208
NP_441835.1_2 Forward -158 -139 10.6192 0.195
NP_440673.1_3 Forward -333 -326 12.4288 0.0426
NP_440673.1_3 Forward -255 -248 12.4288 0.0426
NP_440673.1_3 Reverse -250 -257 12.4288 0.0426
NP_440673.1_3 Reverse -114 -121 7.80726 0.244
NP_440673.1_3 Reverse -41 -48 7.02061 0.274
NP_440673.1_3 Reverse -211 -218 6.72562 0.277
NP_441052.1_2 Reverse -248 -258 19.9412 0.00106
NP_441052.1_2 Forward -257 -247 10.4031 0.0285
NP_441052.1_2 Reverse -209 -219 4.99491 0.135
NP_441052.1_2 Reverse -195 -205 4.10993 0.166
NP_442219.1_8 Forward -238 -219 7.68394 0.265
NP_442219.1_9 Reverse -249 -258 17.7976 0.00718
NP_442219.1_9 Forward -256 -247 8.25953 0.0681
NP_442219.1_9 Reverse -196 -205 1.76968 0.298
NP_440436.1_4 Reverse -249 -258 17.2072 0.00233
NP_440436.1_4 Forward -256 -247 9.24241 0.0871
NP_440436.1_4 Reverse -255 -264 7.76745 0.124
NP_440436.1_4 Reverse -327 -336 7.37413 0.132
NP_441884.1_8 Reverse -325 -344 -7.67036 0.254
NP_441884.1_8 Forward -336 -317 -11.6036 0.271
NP_441336.1_3 Forward -322 -308 15.1426 0.277
NP_442864.1_7 Reverse -309 -327 7.39397 0.274
NP_440648.1_1 Forward -257 -238 5.70265 0.21
NP_441719.1_4 Forward -256 -249 16.3621 0.0124
NP_441719.1_4 Reverse -249 -256 16.3621 0.0124
NP_441719.1_4 Reverse -327 -334 6.82395 0.0855
NP_441719.1_4 Forward -334 -327 6.52896 0.188
NP_441004.1_1 Reverse -321 -340 -17.6018 0.292
NP_442366.1_3 Reverse -247 -265 7.19731 0.0762
NP_442366.1_3 Forward -258 -240 4.6407 0.094
NP_442366.1_3 Forward -283 -265 -3.52077 0.251
NP_442366.1_5 Reverse -323 -333 17.2858 0.0141
NP_442366.1_5 Reverse -245 -255 14.0409 0.0497
NP_440129.1_10 Forward -264 -250 4.42448 0.185
NP_442873.1_9 Forward -267 -248 4.03023 0.287
NP_441115.1_2 Reverse -315 -334 7.57013 0.252
NP_441115.1_4 Reverse -247 -265 9.85146 0.198
NP_442206.1_1 Forward -150 -131 -12.7836 0.235
NP_442206.1_10 Forward -257 -242 2.5365 0.201
NP_440328.1_4 Forward -341 -322 5.80098 0.142
NP_440328.1_4 Forward -263 -244 -0.688862 0.286
NP_443054.1_2 Forward -259 -245 1.47456 0.245
NP_443054.1_2 Forward -220 -206 0.196253 0.274
NP_441851.1_10 Forward -258 -248 15.8113 0.00552
NP_441851.1_10 Reverse -247 -257 8.53483 0.114
NP_442856.1_7 Forward -344 -325 -2.55715 0.236
NP_441668.1_4 Reverse -238 -257 -1.37718 0.273
NP_442515.1_1 Forward -49 -35 0.491246 0.19
NP_441396.1_5 Reverse -331 -340 7.27622 0.29
NP_440593.1_3 Forward -262 -243 -6.29373 0.272
NP_441982.1_8 Reverse -155 -169 19.5581 0.0798
NP_440165.1_5 Reverse -247 -266 -7.37537 0.262
NP_441349.1_10 Forward -267 -248 1.27776 0.084
NP_441349.1_10 Reverse -238 -257 -1.67217 0.106
NP_441409.1_6 Reverse -242 -261 -0.0988766 0.0673
NP_440432.1_9 Reverse -163 -178 1.45486 0.144
NP_440432.1_9 Forward -256 -241 -4.54333 0.211
NP_442450.1_5 Forward -259 -249 9.32148 0.115
NP_442450.1_5 Reverse -246 -256 7.64985 0.13
NP_440588.1_2 Reverse -239 -258 6.29264 0.0584
NP_440588.1_2 Forward -266 -247 -3.14714 0.179
NP_440195.1_4 Forward -269 -250 11.6025 0.139
NP_442243.1_1 Reverse -242 -260 9.26148 0.149
NP_441570.1_1 Reverse -248 -266 0.904127 0.0353
NP_441570.1_1 Forward -335 -317 -7.65067 0.0925
NP_441570.1_1 Forward -257 -239 -8.83064 0.122
NP_441570.1_1 Reverse -326 -344 -17.8771 0.295
NP_441078.1_4 Forward -257 -248 19.6659 0.0007
NP_441078.1_4 Reverse -248 -257 19.6659 0.0007
NP_441078.1_4 Reverse -326 -335 0.0980582 0.205
NP_441078.1_4 Forward -335 -326 0.0980582 0.205
NP_441078.1_4 Forward -218 -209 -1.37691 0.254
NP_442729.1_8 Forward -261 -248 8.47575 0.125
NP_440526.1_3 Reverse -249 -260 10.1862 0.0646
NP_440526.1_3 Forward -47 -36 6.1547 0.213
NP_441432.1_8 Reverse -247 -256 16.8143 0.00595
NP_441432.1_8 Forward -258 -249 16.8143 0.00595
NP_441432.1_8 Reverse -325 -334 14.0611 0.0258
NP_441432.1_8 Forward -219 -210 11.9961 0.0519
NP_441432.1_8 Forward -264 -255 5.3096 0.17
NP_442320.1_8 Forward -263 -249 11.996 0.0175
NP_442320.1_8 Reverse -242 -256 -2.65535 0.0926
NP_441732.1_2 Reverse -244 -260 11.3666 0.0091
NP_441732.1_2 Forward -261 -245 -16.2644 0.165
NP_441732.1_2 Reverse -322 -338 -17.4444 0.258
NP_442003.1_4 Forward -334 -315 11.7992 0.272
NP_440760.1_1 Forward -257 -238 -3.3438 0.0342
NP_440760.1_1 Reverse -248 -267 -21.9284 0.246
NP_442797.1_1 Forward -140 -121 -1.47551 0.236
NP_440199.1_10 Forward -260 -250 16.7946 0.0381
NP_441805.1_2 Reverse -237 -256 4.42435 0.119
NP_442353.1_4 Forward -341 -322 0.0970122 0.281
NP_440913.1_1 Forward -326 -308 11.3272 0.168
NP_440713.1_4 Forward -267 -248 6.4893 0.189
NP_440713.1_5 Forward -30 -11 16.8141 0.261
NP_442489.1_7 Forward -257 -248 20.1576 0.000695
NP_442489.1_7 Reverse -248 -257 20.1576 0.000695
NP_442489.1_7 Forward -335 -326 0.786375 0.152
NP_442489.1_7 Reverse -326 -335 0.589713 0.17
NP_442489.1_7 Forward -218 -209 -1.57357 0.213
NP_442489.1_7 Reverse -209 -218 -2.06522 0.288
NP_440559.1_1 Reverse -249 -258 17.4043 0.00658
NP_440559.1_1 Forward -256 -247 8.65285 0.0586
NP_440559.1_1 Reverse -327 -336 6.09625 0.134
NP_441659.2_7 Reverse -269 -288 17.6481 0.158
NP_441659.2_8 Forward -257 -247 20.9245 0.000805
NP_441659.2_8 Reverse -248 -258 18.1713 0.00133
NP_441659.2_8 Forward -335 -325 15.5163 0.006
NP_441659.2_8 Forward -389 -379 3.12662 0.172
NP_441659.2_8 Forward -48 -38 0.275027 0.27
NP_441092.1_4 Forward -24 -5 8.55425 0.274
NP_442913.1_10 Reverse -239 -258 10.5209 0.0421
NP_441040.1_2 Reverse -104 -123 -13.3736 0.279
NP_442849.1_1 Forward -25 -11 11.701 0.203
NP_442008.1_2 Reverse -245 -264 5.89931 0.223
NP_442008.1_2 Forward -128 -109 4.32602 0.24
NP_442346.1_2 Reverse -315 -334 4.42435 0.289
NP_442346.1_5 Forward -258 -248 16.6963 0.00248
NP_442346.1_5 Reverse -247 -257 16.303 0.00248
NP_442346.1_5 Forward -219 -209 9.81313 0.117
NP_442346.1_5 Forward -122 -112 7.94484 0.152
NP_442346.1_5 Forward -49 -39 7.45319 0.169
NP_442346.1_5 Reverse -325 -335 6.66654 0.195
NP_440545.1_3 Reverse -244 -261 5.25038 0.0631
NP_440545.1_3 Reverse -322 -339 4.16874 0.0738
NP_440545.1_3 Forward -261 -244 -1.33779 0.167
NP_441856.1_3 Forward -260 -241 17.2074 0.0286
NP_441856.1_3 Forward -125 -106 -3.73712 0.299
NP_440831.1_3 Forward -344 -325 5.61052 0.28
NP_440250.1_4 Forward -163 -144 5.60352 0.253
NP_441653.1_2 Forward -268 -249 10.294 0.133
NP_441653.1_2 Forward -346 -327 5.26902 0.248
NP_441653.1_3 Forward -233 -219 13.2743 0.279
NP_440010.1_4 Forward -267 -248 2.75194 0.222
NP_440010.1_4 Forward -273 -254 -0.39464 0.252
NP_442603.1_7 Reverse -248 -262 10.422 0.126
NP_442603.1_7 Reverse -326 -340 9.73373 0.142
NP_441888.1_7 Forward -340 -326 3.44117 0.225
NP_441888.1_7 Forward -262 -248 2.2612 0.225
NP_441948.1_4 Forward -327 -309 -6.07737 0.287
NP_441833.1_4 Forward -256 -249 15.9687 0.0124
NP_441833.1_4 Reverse -249 -256 15.9687 0.0124
NP_441833.1_4 Forward -334 -327 6.52896 0.0924
NP_441833.1_4 Reverse -327 -334 6.23397 0.163
NP_441112.1_6 Reverse -199 -218 1.37609 0.255
NP_442162.1_9 Forward -256 -249 16.2637 0.0124
NP_442162.1_9 Reverse -249 -256 16.2637 0.0124
NP_442162.1_9 Forward -334 -327 12.9205 0.0282
NP_442162.1_9 Reverse -327 -334 12.9205 0.0282
NP_440671.1_4 Forward -263 -249 19.2725 0.00971
NP_440671.1_4 Reverse -242 -256 8.16106 0.202
NP_440772.1_6 Forward -129 -110 6.29264 0.298
NP_440772.1_8 Forward -263 -244 9.24257 0.253
NP_442140.1_3 Forward -256 -246 6.66654 0.159
NP_442140.1_3 Reverse -327 -337 4.69992 0.238
NP_442140.1_3 Forward -334 -324 4.60159 0.242
NP_442140.1_3 Reverse -249 -259 4.40493 0.243
NP_442723.1_1 Forward -352 -333 5.30853 0.276
NP_442021.1_3 Forward -263 -244 -7.08038 0.261
NP_441609.1_5 Forward -244 -225 10.2259 0.279
NP_440875.1_9 Forward -255 -245 8.37203 0.233
NP_441813.1_3 Forward -135 -116 17.9217 0.238
NP_441813.1_5 Forward -259 -249 15.9097 0.01
NP_441813.1_5 Forward -337 -327 15.5163 0.0106
NP_441813.1_5 Reverse -246 -256 8.63316 0.0367
NP_440590.1_4 Reverse -327 -340 11.819 0.0184
NP_440590.1_4 Reverse -249 -262 5.32916 0.0585
NP_440590.1_4 Forward -256 -243 2.57589 0.0845
NP_440567.1_1 Forward -256 -242 14.5526 0.0187
NP_440567.1_1 Reverse -249 -263 10.0294 0.0402
NP_440567.1_1 Forward -334 -320 0.294584 0.25
NP_440567.1_1 Reverse -327 -341 -0.000409212 0.261
NP_442497.1_10 Forward -256 -247 17.601 0.00813
NP_442497.1_10 Reverse -249 -258 10.4228 0.0087
NP_442497.1_10 Forward -334 -325 7.76787 0.0731
NP_442497.1_10 Reverse -327 -336 -1.18024 0.256
NP_440821.1_4 Forward -259 -249 18.2696 0.00448
NP_440821.1_4 Reverse -246 -256 2.24165 0.131
NP_441239.1_9 Forward -337 -325 11.347 0.0627
NP_441239.1_9 Reverse -246 -258 11.1504 0.0648
NP_441239.1_9 Forward -259 -247 4.36554 0.253
NP_441009.1_4 Forward -257 -238 12.0942 0.243
NP_441892.1_1 Forward -266 -249 -1.82945 0.214
NP_440604.1_6 Forward -257 -238 -4.52377 0.251
NP_442643.1_1 Forward -263 -244 -11.9969 0.24
NP_440863.1_1 Forward -24 -10 13.0311 0.265
NP_442216.1_4 Reverse -303 -311 8.1805 0.255
NP_440949.1_7 Forward -271 -252 10.2251 0.242
NP_442138.1_10 Reverse -248 -267 -1.96717 0.19
NP_442052.1_8 Forward -123 -113 14.9263 0.253
NP_440546.1_4 Reverse -326 -336 14.5061 0.0459
NP_440546.1_4 Forward -257 -247 13.5365 0.0459
NP_440546.1_4 Forward -335 -325 11.6943 0.0748
NP_440546.1_4 Reverse -248 -258 10.046 0.109
NP_440462.1_6 Forward -337 -327 13.648 0.0266
NP_440462.1_6 Reverse -246 -256 10.5014 0.0396
NP_440462.1_6 Forward -259 -249 7.74818 0.0699
NP_440462.1_6 Reverse -71 -81 2.83163 0.272
NP_442340.1_3 Forward -323 -304 -6.58872 0.223
NP_442611.1_1 Forward -257 -238 3.34271 0.209
NP_442611.1_1 Reverse -326 -345 -1.86883 0.283
NP_440868.1_4 Reverse -322 -334 13.2153 0.022
NP_440868.1_4 Reverse -244 -256 6.1355 0.0878
NP_440868.1_4 Forward -261 -249 -0.846001 0.282
NP_442402.1_4 Reverse -187 -206 12.9783 0.0734
NP_440696.1_3 Reverse -326 -344 -2.3408 0.274
NP_442039.1_4 Forward -256 -249 15.1821 0.0124
NP_442039.1_4 Reverse -249 -256 15.1821 0.0124
NP_442039.1_4 Reverse -327 -334 11.6422 0.0747
NP_442039.1_7 Forward -52 -42 11.5831 0.257
NP_442829.1_2 Forward -190 -174 8.52763 0.287
NP_442837.1_3 Forward -256 -249 15.7721 0.0124
NP_442837.1_3 Reverse -249 -256 15.7721 0.0124
NP_442837.1_3 Forward -334 -327 6.0373 0.25
NP_442837.1_3 Reverse -327 -334 6.0373 0.25
NP_442053.1_1 Forward -257 -248 18.3876 0.0007
NP_442053.1_1 Reverse -248 -257 18.3876 0.0007
NP_442053.1_1 Forward -335 -326 7.17789 0.104
NP_440505.1_3 Forward -259 -249 16.303 0.00696
NP_440505.1_3 Reverse -246 -256 8.04317 0.147
NP_440505.1_3 Reverse -324 -334 6.46988 0.18
NP_440505.1_3 Forward -50 -40 5.87989 0.206
NP_440505.1_3 Forward -248 -238 5.09324 0.246
NP_441203.1_1 Forward -256 -237 -11.8986 0.139
NP_442532.1_2 Forward -189 -170 3.19856 0.218
NP_442174.1_9 Forward -377 -358 9.14423 0.203
NP_440914.1_1 Reverse -248 -258 17.5935 0.000537
NP_440914.1_1 Forward -257 -247 16.3248 0.00196
NP_440914.1_1 Forward -335 -325 13.1043 0.0386
NP_440914.1_1 Forward -263 -253 11.6404 0.0843
NP_440914.1_1 Forward -218 -208 11.3477 0.097
NP_441011.1_8 Forward -256 -247 16.6177 0.00602
NP_441011.1_8 Reverse -327 -336 14.651 0.023
NP_441011.1_8 Reverse -249 -258 8.25953 0.144
NP_441011.1_8 Forward -334 -325 6.78456 0.184
NP_442101.1_10 Reverse -240 -259 9.63589 0.0422
NP_442533.1_1 Reverse -323 -342 -15.3402 0.254
NP_442533.1_6 Forward -257 -248 17.2076 0.00137
NP_442533.1_6 Reverse -248 -257 17.2076 0.00137
NP_442533.1_6 Reverse -336 -345 6.29291 0.113
NP_442533.1_6 Reverse -326 -335 5.40793 0.14
NP_442533.1_6 Forward -218 -209 5.11294 0.155
NP_442533.1_6 Forward -335 -326 4.52295 0.179
NP_442533.1_6 Forward -168 -159 1.37636 0.3
NP_439981.1_2 Reverse -152 -171 17.0107 0.246
NP_442541.1_10 Reverse -209 -223 4.91554 0.248
NP_441482.1_7 Reverse -242 -256 -0.983719 0.0612
NP_441482.1_7 Forward -263 -249 -1.08205 0.0618
NP_441482.1_7 Reverse -67 -81 -6.39192 0.193
NP_439944.1_9 Reverse -249 -259 19.0562 0.00329
NP_439944.1_9 Forward -256 -246 9.12481 0.1
NP_441028.1_6 Reverse -18 -28 3.51951 0.292
NP_440116.1_8 Forward -256 -237 -1.37718 0.119
NP_440116.1_8 Reverse -249 -268 -1.57384 0.12
NP_441527.1_4 Forward -190 -171 -4.63178 0.188
NP_441527.1_4 Forward -187 -168 -8.92892 0.253
NP_440115.1_6 Reverse -245 -255 7.35486 0.147
NP_440115.1_6 Reverse -323 -333 6.37155 0.186
NP_440007.1_9 Forward -261 -247 10.9143 0.163
NP_440007.1_9 Reverse -244 -258 2.75286 0.277
NP_441544.1_1 Forward -221 -209 15.9686 0.242
NP_441602.1_4 Reverse -198 -217 11.6025 0.278
NP_441972.1_5 Forward -256 -237 -4.91709 0.212
NP_441972.1_5 Reverse -249 -268 -10.1286 0.299
NP_441106.1_1 Reverse -247 -256 18.486 0.0028
NP_441106.1_1 Forward -258 -249 9.63616 0.0311
NP_441106.1_1 Reverse -325 -334 8.75118 0.0469
NP_441106.1_1 Forward -336 -327 7.66954 0.0776
NP_439903.1_6 Reverse -245 -264 11.405 0.095
NP_439903.1_6 Reverse -206 -225 2.45694 0.226
NP_442588.1_1 Reverse -304 -323 16.6174 0.131
NP_440797.1_2 Forward -268 -249 14.1282 0.215
NP_440797.1_2 Forward -400 -381 13.7386 0.224
NP_441286.1_1 Reverse -247 -259 11.937 0.0108
NP_441286.1_1 Forward -258 -246 5.93884 0.0258
NP_441286.1_1 Forward -49 -37 -6.74586 0.278
NP_440670.1_8 Forward -257 -248 18.3876 0.000699
NP_440670.1_8 Reverse -248 -257 18.3876 0.000699
NP_440670.1_8 Reverse -326 -335 8.65285 0.0627
NP_440670.1_8 Forward -335 -326 6.29291 0.124
NP_442908.1_9 Forward -164 -145 17.994 0.0522
NP_440886.1_7 Reverse -247 -257 8.04271 0.0805
NP_440886.1_7 Forward -258 -248 7.94438 0.0805
NP_440886.1_7 Forward -336 -326 7.74772 0.0843
NP_442072.1_9 Forward -258 -240 -12.5672 0.0852
NP_442072.1_9 Reverse -247 -265 -12.6655 0.0877
NP_442072.1_9 Forward -336 -318 -23.3836 0.292
NP_440907.2_8 Forward -256 -246 15.9091 0.0161
NP_440907.2_8 Forward -334 -324 14.1392 0.0325
NP_442264.1_2 Reverse -250 -267 5.34871 0.277
NP_439967.1_7 Forward -336 -318 9.45892 0.248
NP_441021.1_1 Reverse -249 -268 3.24438 0.083
NP_440962.1_5 Reverse -99 -109 18.3679 0.248
NP_441463.1_3 Forward -267 -248 9.14423 0.0481
NP_441463.1_3 Reverse -250 -269 -5.21209 0.222
NP_441463.1_6 Reverse -252 -266 7.67217 0.254
NP_441463.1_6 Forward -15 -1 5.83613 0.287
NP_441463.1_6 Forward -265 -251 5.35296 0.291
NP_442842.1_4 Forward -256 -237 2.94938 0.265
NP_441626.1_2 Forward -256 -249 15.7721 0.0124
NP_441626.1_2 Reverse -249 -256 15.7721 0.0124
NP_441626.1_2 Reverse -327 -334 12.2322 0.0511
NP_441626.1_2 Forward -334 -327 5.93897 0.231
NP_442365.1_7 Forward -339 -320 -0.983855 0.189
NP_442794.1_1 Forward -267 -255 13.3137 0.0721
NP_442794.1_1 Reverse -244 -256 12.527 0.0721
NP_442794.1_1 Forward -261 -249 10.1671 0.0721
NP_442615.1_1 Reverse -239 -257 0.0191479 0.109
NP_441962.1_4 Reverse -249 -268 -8.16202 0.196
NP_441962.1_4 Reverse -243 -262 -13.5702 0.275
NP_441796.1_8 Reverse -122 -140 11.2289 0.214
NP_440387.1_1 Reverse -248 -264 7.2367 0.0282
NP_440387.1_1 Forward -257 -241 6.64671 0.0282
NP_440387.1_1 Forward -335 -319 -5.25134 0.222
NP_440387.1_5 Forward -63 -44 12.3837 0.26
NP_441431.1_2 Forward -338 -324 18.0918 0.0206
NP_441431.1_7 Forward -255 -236 17.551 0.162
NP_441431.1_9 Forward -314 -295 29.0071 0.000861
NP_441488.1_8 Reverse -243 -257 12.782 0.146
NP_441993.1_1 Forward -263 -244 3.89583 0.227
NP_440814.1_4 Forward -266 -247 -12.4886 0.23
NP_440467.1_3 Reverse -249 -268 11.2562 0.281
NP_440114.1_10 Forward -335 -321 11.5043 0.111
NP_440114.1_10 Reverse -141 -155 6.78443 0.258
NP_440114.1_10 Forward -218 -204 6.09611 0.285
NP_442323.1_7 Reverse -243 -262 1.86696 0.276
NP_441510.2_7 Forward -263 -249 12.5853 0.28
NP_440287.1_6 Forward -266 -247 0.294447 0.294
NP_440293.1_3 Forward -318 -299 2.65439 0.195
NP_440766.1_4 Forward -261 -247 8.16106 0.0871
NP_440766.1_4 Reverse -322 -336 1.86788 0.209
NP_440766.1_5 Forward -206 -194 6.79636 0.292
NP_441237.1_9 Forward -149 -139 9.7148 0.272
NP_442743.1_4 Reverse -327 -346 -7.27704 0.279
NP_441311.1_2 Reverse -242 -256 14.2569 0.229
NP_439910.1_2 Forward -265 -248 -21.594 0.183
NP_440457.1_1 Forward -261 -249 7.02048 0.105
NP_440457.1_1 Reverse -322 -334 5.05386 0.149
NP_440457.1_1 Reverse -244 -256 -0.354346 0.262
NP_440798.1_6 Forward -334 -321 21.2588 0.0122
NP_440798.1_6 Forward -256 -243 11.229 0.0624
NP_441801.1_4 Reverse -304 -314 3.02829 0.231
NP_441984.1_3 Reverse -231 -249 5.42735 0.286
NP_442509.1_9 Reverse -248 -258 8.14104 0.192
NP_442509.1_9 Forward -257 -247 8.04271 0.192
NP_442439.1_9 Forward -116 -102 18.8791 0.28
NP_442587.1_9 Forward -285 -272 13.3923 0.184
NP_440554.1_4 Reverse -327 -337 8.82982 0.0646
NP_440554.1_4 Forward -256 -246 8.82982 0.0646
NP_440554.1_4 Reverse -249 -259 7.05986 0.106
NP_440554.1_4 Forward -334 -324 5.87989 0.129
NP_442737.1_5 Reverse -253 -272 18.8903 0.0752
NP_441885.1_5 Reverse -248 -258 20.9245 0.000538
NP_441885.1_5 Forward -257 -247 11.3864 0.00668
NP_441885.1_5 Reverse -326 -336 7.94484 0.0385
NP_441428.1_8 Reverse -133 -152 7.17762 0.206
NP_442341.1_7 Reverse -247 -261 9.63603 0.0726
NP_442341.1_7 Forward -258 -244 8.55439 0.0864
NP_442341.1_7 Reverse -234 -248 1.08123 0.299
NP_442341.1_9 Reverse -246 -260 17.9935 0.0212
NP_442341.1_9 Forward -259 -245 6.88214 0.21
NP_442395.2_4 Forward -258 -239 0.195343 0.276
NP_443000.1_7 Forward -259 -249 17.0896 0.00865
NP_443000.1_7 Reverse -246 -256 10.6981 0.0345
NP_443000.1_7 Forward -337 -327 1.06167 0.274
NP_443000.1_7 Reverse -324 -334 0.963343 0.278
NP_441842.1_10 Forward -264 -250 6.58777 0.283
NP_440275.1_3 Reverse -246 -256 9.02648 0.0563
NP_440275.1_3 Forward -259 -249 8.1415 0.0602
NP_440275.1_3 Reverse -324 -334 6.46988 0.105
NP_440091.1_1 Forward -261 -249 8.88877 0.0567
NP_442451.1_2 Forward -343 -324 -8.55534 0.251
NP_439962.1_4 Forward -343 -324 6.88262 0.155
NP_439962.1_4 Reverse -308 -327 -5.01543 0.272
NP_442495.1_4 Forward -253 -243 13.4514 0.187
NP_440149.1_8 Reverse -209 -228 -5.11376 0.219
NP_440149.1_8 Reverse -248 -267 -6.88371 0.265
NP_441105.1_3 Forward -268 -249 6.19431 0.0624
NP_441105.1_3 Reverse -237 -256 4.22769 0.081
NP_440216.1_1 Forward -257 -243 7.37441 0.00942
NP_440216.1_1 Forward -335 -321 5.50613 0.0196
NP_440216.1_1 Reverse -326 -340 -1.18038 0.0301
NP_440216.1_1 Reverse -248 -262 -9.73518 0.145
NP_440172.1_1 Forward -257 -247 17.5813 0.00421
NP_440172.1_1 Reverse -248 -258 15.0247 0.00945
NP_440172.1_1 Forward -218 -208 8.73149 0.0586
NP_440172.1_1 Forward -335 -325 4.89658 0.162
NP_440172.1_1 Reverse -73 -83 3.02829 0.251
NP_442015.1_10 Forward -339 -326 12.3107 0.0372
NP_442015.1_10 Reverse -244 -257 12.2123 0.0372
NP_442015.1_10 Forward -261 -248 10.344 0.0391
NP_442015.1_10 Reverse -256 -269 3.36254 0.183
NP_441226.1_7 Forward -256 -249 14.4934 0.0123
NP_441226.1_7 Reverse -249 -256 14.4934 0.0123
NP_441226.1_7 Reverse -327 -334 12.7234 0.0312
NP_441226.1_7 Forward -334 -327 11.5435 0.0757
NP_441111.1_7 Forward -256 -248 18.7023 0.00294
NP_441111.1_7 Reverse -249 -257 18.7023 0.00294
NP_441111.1_7 Forward -334 -326 8.86921 0.0589
NP_442379.1_10 Forward -264 -247 3.67709 0.17
NP_442379.1_10 Forward -178 -161 1.61214 0.223
NP_441766.1_2 Forward -257 -248 17.5026 0.00297
NP_441766.1_2 Reverse -248 -257 17.5026 0.00297
NP_441766.1_2 Reverse -326 -335 8.1612 0.0645
NP_441766.1_2 Forward -335 -326 5.89959 0.103
NP_442417.1_5 Forward -257 -243 15.0442 0.0589
NP_442417.1_5 Forward -375 -361 4.62115 0.292
NP_440416.1_9 Reverse -319 -338 -12.1936 0.155
NP_440416.1_9 Forward -346 -327 -14.8485 0.18
NP_440416.1_9 Forward -264 -245 -16.2252 0.21
NP_440416.1_9 Reverse -253 -272 -16.7168 0.22
NP_443052.1_9 Reverse -308 -327 -0.4922 0.211
NP_443052.1_9 Reverse -110 -129 -4.32711 0.257
NP_442403.1_8 Reverse -250 -269 15.7324 0.11
NP_440591.1_9 Forward -264 -246 11.8189 0.0935
NP_442226.1_1 Forward -32 -13 10.9142 0.281
NP_440261.1_5 Forward -256 -243 -1.06236 0.0655
NP_440988.1_10 Forward -259 -245 6.15739 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTACTGAAATTACCGACCGTAATCAAGCGGAAGCTTTAGTCAATTACCAACTATTAGTCCCCGCCACCGATCGCCTACCGTTGGAGCCGGGGGAATTCCACGTCACTGATTTACTGGGGTTGATTGTTTACGACCATGACAATGGCGATCGCCTAGGGATAGTGACGGATTTTTACAGTGCTGGCAATGACCTATTGGGGATAACTTTGGATAAAAACCCAGACAAAGAAGTGCTCGTCCCCTTTGTTGAAGCCATTGTGCCCACGGTAGAACTAGCGGAGCAACGGCTGGAAATTAAAACCATTCCAGGGCTACTGGATTGATCGGCTGTGTTCCTTCATACCAGTTAACTGGCAACCGTACCTTATTTTCTCAGGGGTAAACAAAGTGAATTGCACTG

CDS

ATGCCCAGCCATTTGCCAAATGCTAAACTGATGCCATTTGAACAAAGCGGGGAAACAATGCGGATTTTGGTTACCGGGGGAGCAGGATTTATCGGTTCCCATCTTATTGATCGCTTGATGGCCCAGGGCCACGAGGTTCTATGCCTCGATAACTTTTACACCGGCACCAAACGCAACATCGTCCAATGGTTAGATAATCCCAATTTTGAGCTCATCCGCCATGACGTTACCGAGCCCATTCGCTTGGAAGTCGACCAGGTTTACCATTTAGCCTGCCCCGCTTCCCCCGTCCATTATCAGTTCAATCCCGTCAAAACCATCAAAACTAATGTGATGGGCACTTTATACATGTTGGGTTTGGCTAAGCGGGTCGGAGCAAGGTTTTTGTTGGCATCCACCTCGGAAGTGTATGGCGATCCCGATGTTCATCCCCAACCGGAAAGCTACCGGGGCAATGTTAATACAATTGGTCCAAGAGCCTGTTACGACGAAGGAAAACGGGTAGCGGAAACCCTGGCTTTTGAGTATTACCGAGAGCACAAGGTTGATATCAGAGTAGCGCGGATATTCAATACCTATGGACCACGTATGTTGGAAAACGATGGTCGGGTGGTGAGTAACTTTATTGTGCAGGCGCTACAGGGTAAACCCCTCACTGTGTTTGGCGACGGCTCCCAAACCCGCAGTTTTTGTTACGTATCCGACTTAGTGGAAGGCCTAATGCGCCTCATGAATGGGGATTACGTCGGGCCGGTTAATTTGGGTAATCCGGGGGAATATACCATATTGCAACTGGCAGAAAAAATCCAGAATGCCATTAACCCCGATGCAGAGTTAATTTATCAACCCTTACCGGAGGATGATCCCAAACAGCGGCAACCGGATATTACGTTGGCGAAAACTTATTTAGACTGGCAACCGACCATTCCCCTAGATCAAGGTTTGGCAATGACTATCGAAGATTTCAAATCTCGCCACGAAGGATGA

Protein

MPSHLPNAKLMPFEQSGETMRILVTGGAGFIGSHLIDRLMAQGHEVLCLDNFYTGTKRNIVQWLDNPNFELIRHDVTEPIRLEVDQVYHLACPASPVHYQFNPVKTIKTNVMGTLYMLGLAKRVGARFLLASTSEVYGDPDVHPQPESYRGNVNTIGPRACYDEGKRVAETLAFEYYREHKVDIRVARIFNTYGPRMLENDGRVVSNFIVQALQGKPLTVFGDGSQTRSFCYVSDLVEGLMRLMNGDYVGPVNLGNPGEYTILQLAEKIQNAINPDAELIYQPLPEDDPKQRQPDITLAKTYLDWQPTIPLDQGLAMTIEDFKSRHEG