Your browser is old and dusty. Try Google Chrome!

Details for slr0799

ORF slr0799
Accession NP_442640.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY802c: 3066278 - 3067184]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440259.1_4 Reverse -94 -108 18.1801 0.0912
NP_439997.1_6 Forward -338 -319 9.73422 0.218
NP_442975.1_10 Reverse -42 -56 6.88214 0.156
NP_442861.1_4 Reverse -162 -181 4.22689 0.253
NP_441476.1_5 Reverse -276 -295 0.786102 0.19
NP_441476.1_10 Forward -167 -154 17.1289 0.212
NP_441781.1_7 Reverse -206 -225 -0.590531 0.261
NP_441620.1_3 Forward -62 -43 16.0274 0.227
NP_441594.1_6 Forward -185 -166 0.982764 0.276
NP_439957.1_10 Forward -110 -100 15.9097 0.278
NP_442827.1_8 Reverse -292 -311 -1.27961 0.245
NP_441434.1_7 Reverse -9 -23 4.03116 0.225
NP_441713.1_1 Forward -228 -209 -13.1769 0.252
NP_440331.1_5 Forward -69 -50 -17.7001 0.295
NP_442111.1_4 Forward -304 -290 3.93283 0.226
NP_441486.1_1 Reverse -18 -32 -5.9986 0.272
NP_443017.1_1 Reverse -125 -144 16.5041 0.191
NP_440376.1_1 Forward -55 -46 5.50626 0.131
NP_442687.1_7 Forward -17 -7 13.0581 0.0591
NP_442687.1_7 Forward -330 -320 5.68323 0.189
NP_440642.1_10 Reverse -94 -108 12.782 0.133
NP_440642.1_10 Reverse -103 -117 6.68548 0.225
NP_440141.1_8 Reverse -275 -294 4.12936 0.293
NP_442300.1_5 Forward -388 -369 11.8975 0.282
NP_440153.1_5 Forward -328 -314 2.5562 0.221
NP_440475.1_5 Forward -118 -99 19.174 0.0274
NP_442566.1_7 Reverse -166 -185 19.174 0.104
NP_440147.1_4 Forward -331 -318 5.52582 0.122
NP_440147.1_4 Reverse -302 -315 2.18257 0.209
NP_441916.1_7 Forward -55 -45 11.1898 0.0261
NP_441041.1_4 Forward -319 -300 -5.40875 0.152
NP_439966.1_3 Reverse -247 -266 15.3391 0.269
NP_441554.1_4 Forward -83 -69 15.2706 0.22
NP_442281.1_1 Forward -35 -21 2.5556 0.263
NP_442288.1_3 Reverse -211 -228 6.13536 0.279
NP_441644.1_6 Forward -329 -319 9.71433 0.0705
NP_442215.1_2 Reverse -77 -93 -6.03799 0.263
NP_442029.1_6 Reverse -207 -226 6.39097 0.238
NP_442029.1_10 Forward -332 -313 5.50599 0.284
NP_442142.1_4 Reverse -384 -397 6.60689 0.16
NP_443009.1_5 Reverse -376 -387 3.79477 0.278
NP_440015.1_9 Reverse -300 -318 -0.7675 0.264
NP_441015.1_8 Forward -119 -100 3.04771 0.272
NP_441015.1_10 Forward -318 -299 -10.7186 0.287
NP_441096.1_5 Reverse -67 -85 15.358 0.297
NP_441764.1_8 Forward -179 -169 11.7892 0.284
NP_441911.1_10 Forward -111 -92 19.7422 0.0263
NP_441911.1_10 Reverse -194 -213 6.82367 0.291
NP_440871.1_2 Reverse -274 -293 14.8474 0.241
NP_440346.1_7 Forward -86 -67 8.45592 0.233
NP_440346.1_7 Forward -75 -56 5.80098 0.29
NP_441114.1_3 Reverse -9 -18 7.27622 0.247
NP_441114.1_3 Reverse -23 -32 6.29291 0.285
NP_441878.1_6 Forward -330 -320 -0.314959 0.174
NP_441590.1_4 Forward -253 -234 2.55527 0.293
NP_440136.1_1 Forward -333 -317 9.7926 0.238
NP_442998.1_2 Forward -295 -276 8.75009 0.216
NP_442998.1_10 Reverse -9 -16 10.4622 0.0819
NP_440899.1_8 Reverse -93 -112 -9.44032 0.262
NP_442333.2_5 Reverse -309 -328 -15.2418 0.29
NP_441559.1_8 Reverse -315 -329 -2.26202 0.19
NP_441559.1_8 Reverse -299 -313 -5.70361 0.27
NP_440997.1_4 Forward -295 -276 10.3242 0.289
NP_441704.1_8 Forward -324 -305 7.57013 0.234
NP_440748.1_4 Reverse -311 -330 12.29 0.292
NP_441199.1_6 Forward -297 -278 -1.57384 0.295
NP_442993.1_1 Forward -299 -283 -11.5445 0.251
NP_442386.1_5 Reverse -315 -334 7.37347 0.209
NP_442386.1_9 Forward -255 -246 8.16077 0.209
NP_441340.1_9 Forward -101 -91 9.02648 0.256
NP_440586.1_8 Forward -328 -321 7.51192 0.239
NP_440027.1_3 Reverse -310 -328 2.67334 0.289
NP_443038.1_10 Reverse -86 -105 12.585 0.277
NP_441789.1_7 Forward -286 -267 -2.16459 0.257
NP_441803.1_2 Reverse -308 -327 1.57275 0.229
NP_442384.1_10 Reverse -320 -333 12.0157 0.0315
NP_442384.1_10 Reverse -377 -390 2.96921 0.206
NP_442790.1_4 Forward -309 -290 -12.7836 0.253
NP_442262.1_2 Forward -73 -54 14.7609 0.265
NP_442262.1_10 Forward -312 -305 7.6106 0.274
NP_440531.1_6 Reverse -312 -331 -3.83545 0.272
NP_440350.1_5 Reverse -84 -103 11.7992 0.134
NP_440350.1_5 Reverse -90 -109 0.392778 0.162
NP_440350.1_5 Reverse -102 -121 -3.63879 0.261
NP_440350.1_5 Reverse -72 -91 -5.80207 0.292
NP_439926.1_7 Forward -119 -101 7.78729 0.204
NP_440999.1_2 Reverse -341 -360 8.16093 0.296
NP_442892.1_1 Forward -29 -10 4.12936 0.282
NP_442892.1_9 Reverse -166 -180 16.7152 0.235
NP_442225.1_10 Reverse -11 -30 19.3698 0.0453
NP_441469.1_8 Forward -255 -246 5.60459 0.258
NP_442578.1_7 Forward -302 -295 9.38056 0.138
NP_441462.1_2 Forward -55 -45 -0.806614 0.254
NP_441929.1_3 Forward -371 -352 4.52268 0.266
NP_443062.1_1 Reverse -57 -75 4.45062 0.26
NP_442204.1_1 Reverse -316 -327 9.10512 0.0842
NP_441560.1_8 Forward -292 -273 13.6552 0.205
NP_440504.1_5 Forward -51 -33 11.4255 0.153
NP_440544.1_5 Reverse -103 -110 13.8024 0.28
NP_441351.1_8 Reverse -276 -295 3.34271 0.232
NP_441867.1_2 Reverse -275 -294 -19.6667 0.291
NP_440603.1_9 Forward -292 -273 1.17943 0.278
NP_440673.1_2 Forward -339 -320 11.17 0.186
NP_440673.1_3 Forward -307 -300 8.20058 0.234
NP_441719.1_6 Forward -199 -180 6.98015 0.269
NP_441004.1_1 Reverse -278 -297 3.24438 0.106
NP_441004.1_2 Reverse -273 -292 8.35759 0.169
NP_441004.1_4 Reverse -281 -291 7.84651 0.286
NP_441004.1_5 Reverse -280 -294 10.226 0.248
NP_442366.1_5 Forward -332 -322 11.9759 0.148
NP_442873.1_3 Reverse -20 -39 3.44025 0.287
NP_443029.1_8 Forward -293 -274 12.6841 0.293
NP_441851.1_10 Forward -388 -378 5.68323 0.203
NP_440682.1_4 Forward -34 -15 40.5118 0.000000306
NP_442515.1_1 Forward -304 -290 -1.27871 0.251
NP_441396.1_5 Forward -395 -386 8.35786 0.224
NP_440593.1_3 Reverse -16 -35 -3.24547 0.233
NP_441409.1_6 Reverse -155 -174 -7.67036 0.154
NP_441394.1_10 Forward -206 -188 9.35981 0.263
NP_440431.1_4 Forward -105 -86 12.7478 0.038
NP_442243.1_1 Reverse -314 -332 9.35981 0.149
NP_441570.1_1 Forward -345 -327 -13.7472 0.224
NP_441078.1_4 Reverse -46 -55 -1.08191 0.222
NP_440707.1_8 Forward -295 -276 14.8474 0.293
NP_442443.1_1 Reverse -312 -331 2.65439 0.182
NP_442443.1_2 Forward -296 -277 11.7008 0.247
NP_441432.1_8 Reverse -335 -344 2.55633 0.298
NP_441732.1_2 Reverse -300 -316 -16.6577 0.186
NP_442447.1_1 Forward -107 -88 6.78429 0.258
NP_441131.1_6 Forward -33 -15 4.54237 0.219
NP_440199.1_10 Forward -128 -118 6.46988 0.299
NP_442489.1_7 Reverse -320 -329 -1.47524 0.203
NP_442489.1_7 Forward -55 -46 -1.47524 0.203
NP_441659.2_8 Forward -329 -319 5.78156 0.0979
NP_442849.1_1 Reverse -281 -295 10.4227 0.207
NP_442008.1_2 Reverse -268 -287 2.45773 0.286
NP_442346.1_5 Forward -330 -320 12.0747 0.0508
NP_442346.1_5 Forward -17 -7 4.3066 0.291
NP_440545.1_3 Forward -333 -316 -6.64766 0.285
NP_440486.1_6 Reverse -270 -289 10.3242 0.219
NP_443040.1_1 Forward -108 -94 11.7301 0.276
NP_441329.1_6 Forward -110 -91 2.81659 0.217
NP_441329.1_6 Forward -95 -76 0.0473228 0.266
NP_440912.1_3 Reverse -91 -110 8.06178 0.286
NP_441813.1_9 Reverse -362 -381 15.7324 0.222
NP_442028.1_1 Reverse -92 -105 11.1388 0.251
NP_441259.1_8 Reverse -271 -290 12.4867 0.254
NP_442810.1_7 Forward -297 -278 5.11266 0.221
NP_442639.1_1 Reverse -155 -174 27.3346 0.000172
NP_440624.1_6 Forward -213 -195 3.95163 0.246
NP_441892.1_1 Forward -39 -22 0.92382 0.159
NP_442669.1_1 Forward -153 -134 11.7992 0.0195
NP_441017.1_6 Reverse -342 -356 12.8803 0.217
NP_442216.1_4 Reverse -379 -387 8.37716 0.255
NP_441119.1_1 Reverse -52 -71 2.0644 0.207
NP_442402.1_10 Reverse -381 -391 11.1893 0.269
NP_441848.1_4 Forward -378 -362 9.84247 0.269
NP_441084.1_6 Reverse -344 -358 9.15021 0.292
NP_439942.1_7 Reverse -210 -229 -5.80207 0.284
NP_440696.1_3 Forward -329 -311 1.88744 0.217
NP_441811.1_4 Forward -286 -267 3.44104 0.284
NP_441811.1_8 Forward -315 -301 13.6676 0.178
NP_442679.1_1 Forward -115 -96 3.83436 0.147
NP_442679.1_1 Forward -113 -94 2.45773 0.164
NP_442679.1_1 Forward -114 -95 2.16274 0.167
NP_442679.1_1 Forward -112 -93 -5.40875 0.293
NP_442679.1_2 Reverse -184 -203 6.78429 0.279
NP_439994.1_3 Reverse -224 -243 8.63366 0.286
NP_440724.1_5 Forward -92 -74 15.6538 0.262
NP_442533.1_6 Forward -329 -320 5.11294 0.155
NP_441527.1_4 Forward -110 -91 2.81659 0.125
NP_441527.1_4 Forward -106 -87 0.429291 0.136
NP_441527.1_4 Forward -104 -85 -0.334645 0.146
NP_441527.1_4 Forward -112 -93 -0.716613 0.146
NP_441527.1_4 Forward -118 -99 -1.48055 0.148
NP_441527.1_4 Forward -113 -94 -4.63178 0.188
NP_441527.1_4 Forward -72 -53 -4.91826 0.191
NP_441527.1_4 Reverse -193 -212 -5.49121 0.202
NP_441527.1_4 Forward -124 -105 -8.16498 0.241
NP_441527.1_4 Forward -120 -101 -8.26048 0.242
NP_441527.1_4 Forward -103 -84 -8.35597 0.243
NP_441527.1_4 Forward -121 -102 -10.4568 0.27
NP_441527.1_4 Forward -107 -88 -11.0297 0.278
NP_441527.1_4 Forward -115 -96 -11.6982 0.284
NP_441527.1_4 Forward -109 -90 -12.7486 0.293
NP_441972.1_5 Reverse -305 -324 -5.11376 0.215
NP_441106.1_1 Reverse -319 -328 2.16301 0.297
NP_441106.1_3 Reverse -122 -141 11.3075 0.217
NP_440646.1_9 Forward -39 -20 16.8141 0.167
NP_442674.1_3 Forward -38 -19 3.04693 0.296
NP_442908.1_1 Forward -334 -315 0.884433 0.277
NP_441705.1_4 Reverse -15 -34 11.4058 0.218
NP_440886.1_7 Forward -330 -320 3.22451 0.291
NP_440404.1_9 Forward -113 -94 10.4559 0.209
NP_440907.2_8 Reverse -119 -129 5.58445 0.194
NP_440841.1_4 Reverse -344 -363 -6.49039 0.215
NP_440962.1_5 Reverse -92 -102 16.6963 0.261
NP_441463.1_3 Reverse -367 -386 -6.49039 0.246
NP_442365.1_7 Reverse -118 -137 -4.22878 0.238
NP_441993.1_1 Forward -329 -310 1.55686 0.274
NP_440114.1_10 Reverse -7 -21 10.3243 0.148
NP_442698.1_10 Forward -117 -98 6.19431 0.233
NP_442698.1_10 Forward -118 -99 0.58944 0.297
NP_441853.1_5 Forward -85 -66 0.294447 0.283
NP_442743.1_4 Forward -233 -214 -8.06369 0.287
NP_442680.1_5 Forward -113 -94 5.4452 0.225
NP_442680.1_5 Forward -112 -93 3.00294 0.237
NP_440942.1_10 Reverse -21 -40 13.3725 0.291
NP_442130.1_8 Forward -228 -209 7.27514 0.235
NP_442509.1_9 Reverse -320 -330 7.45273 0.219
NP_442509.1_9 Reverse -377 -387 6.66608 0.259
NP_441842.1_10 Forward -320 -306 12.9793 0.0872
NP_441307.1_4 Forward -328 -309 -1.67217 0.293
NP_442354.1_8 Forward -338 -319 7.96426 0.266
NP_442638.1_2 Forward -175 -156 19.469 0.0426
NP_441207.1_7 Forward -107 -93 9.54584 0.275
NP_439962.1_4 Forward -280 -261 -7.27704 0.288
NP_442495.1_4 Reverse -275 -285 15.3197 0.133
NP_441105.1_3 Forward -366 -347 -0.983855 0.145
NP_440216.1_1 Forward -329 -315 -11.3085 0.178
NP_442371.1_1 Forward -164 -154 13.8442 0.196
NP_442015.1_10 Reverse -316 -329 -0.767364 0.281
NP_441226.1_7 Forward -253 -246 8.29857 0.205
NP_440261.1_10 Forward -81 -67 13.4709 0.207
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCATCTTGATGGTGGGGAATCATCATTTCGATAAAACTTTGGTCTGTCCATTGCATGTGCATGCCTTGTTGGGCCATCATCTGCGGTGGAGATTGATTGCGATAAACCGCTGTTACCCCAGCCGCTGAACCACTGAGGAGTAGTCCTGCCAACCCATATATCCAGAATTGATTACCCACGGGAATGCTTACCTCCTATTCCTTCTCTAATTCCAGTCTGGCAAAGCAAAATGAAATCAGGATGAAATTTAGAGCTCATTTATAAAGTCTTGTAATGGATAGCAAGTAGGAGAAGAAAAAAAGGAAAACTAAGAGTAAGAGCAGAAGGAGACAAAGAGCATGAAAAGTCGACAGCCTATGAAACAGACCTGAGCGATGCAGAATGGGCAATAGTTGAATCA

CDS

ATGATTCCTCCCGCAAAGCCCGGAGGACACCCACGAACCACAGATATGCGAGCGGTTTGTAATGGTATTTACTACCAACTAAAAACGGGTTGTCAATGGGCAATGTTACCCCATGACTTTCCTCCTAGTAGCACGGTCTATAGCTATTACCGTAAATGGCAACGTCATGGCGTGTGGGAAAGGCTCAATCTAAGGCTGCTGGAGCAATGCCGCCTCCAGAGTGGCAAGAGCCTTCAACCTAGCGTAATAGCGGCAGATAGCCAATCGGTAAAAACCACCGAAAAAAGGGGGAAGTCTACGGTTTTGACGGAGGTAAGAAGGTGA

Protein

MIPPAKPGGHPRTTDMRAVCNGIYYQLKTGCQWAMLPHDFPPSSTVYSYYRKWQRHGVWERLNLRLLEQCRLQSGKSLQPSVIAADSQSVKTTEKRGKSTVLTEVRR