Your browser is old and dusty. Try Google Chrome!

Details for slr0795

ORF slr0795
Accession NP_442630.1
Symbol nrsC
Category cation efflux system protein involved in nickel and cobalt tolerance
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -150 -164 -0.0987402 0.221
NP_440795.1_7 Forward -310 -303 6.92228 0.26
NP_440795.1_10 Forward -324 -305 13.7649 0.217
NP_441418.1_6 Forward -110 -91 -20.2567 0.108
NP_442291.1_5 Reverse -100 -116 2.02515 0.135
NP_442291.1_5 Forward -111 -95 0.451859 0.165
NP_441453.1_4 Reverse -101 -109 7.29591 0.0589
NP_441453.1_4 Forward -110 -102 6.70593 0.121
NP_441453.1_7 Reverse -248 -255 14.1988 0.175
NP_442151.1_6 Reverse -143 -157 11.111 0.108
NP_440226.1_1 Forward -110 -91 15.1424 0.0267
NP_440931.1_7 Reverse -374 -392 11.8181 0.258
NP_443002.1_5 Reverse -144 -162 9.6548 0.285
NP_442173.1_1 Forward -109 -101 7.59091 0.163
NP_442173.1_1 Reverse -102 -110 5.82095 0.2
NP_442752.1_4 Forward -110 -103 13.8055 0.0199
NP_443027.1_4 Forward -112 -102 7.25653 0.24
NP_443027.1_4 Reverse -99 -109 6.56821 0.275
NP_442975.1_10 Reverse -97 -111 11.1104 0.0516
NP_440784.1_7 Reverse -102 -109 6.23397 0.241
NP_440784.1_7 Forward -109 -102 6.13563 0.241
NP_440061.1_9 Forward -154 -140 13.4703 0.0811
NP_440061.1_9 Reverse -99 -113 6.19383 0.255
NP_440928.1_5 Forward -157 -139 8.7706 0.192
NP_442062.1_8 Forward -110 -100 9.61647 0.0587
NP_442062.1_8 Reverse -101 -111 5.19158 0.181
NP_442062.1_8 Reverse -143 -153 3.02829 0.289
NP_442242.1_4 Forward -109 -102 12.4288 0.0393
NP_440908.1_5 Reverse -23 -40 16.8534 0.105
NP_441935.1_1 Reverse -134 -153 17.5024 0.117
NP_441208.1_1 Forward -310 -291 -2.36049 0.25
NP_442110.1_7 Reverse -101 -115 2.35953 0.222
NP_440300.1_1 Reverse -296 -315 11.2084 0.218
NP_441083.1_3 Reverse -142 -152 15.6142 0.133
NP_441083.1_5 Reverse -101 -111 1.84832 0.198
NP_441738.1_2 Reverse -103 -110 15.28 0.0102
NP_441738.1_2 Forward -261 -254 8.29857 0.176
NP_440209.1_1 Forward -110 -102 14.8674 0.012
NP_442889.1_1 Reverse -137 -156 -12.2919 0.226
NP_440447.1_5 Reverse -247 -257 14.4347 0.277
NP_441770.1_4 Reverse -135 -154 -11.0136 0.288
NP_441792.1_5 Reverse -344 -360 11.8583 0.19
NP_441598.1_3 Reverse -165 -184 13.8411 0.195
NP_440906.1_5 Forward -109 -102 12.0355 0.0724
NP_440906.1_5 Reverse -102 -109 12.0355 0.0724
NP_441924.1_5 Forward -263 -244 9.3409 0.258
NP_440747.1_10 Forward -113 -101 6.92215 0.012
NP_440747.1_10 Reverse -140 -152 -12.2524 0.254
NP_441486.1_1 Reverse -98 -112 2.2612 0.0868
NP_441486.1_1 Forward -113 -99 -6.29359 0.288
NP_442634.1_3 Reverse -147 -166 8.94676 0.284
NP_442634.1_4 Forward -360 -346 -5.80194 0.279
NP_441014.1_10 Forward -354 -335 -0.886293 0.254
NP_442848.1_1 Reverse -95 -109 2.85119 0.155
NP_442848.1_5 Reverse -295 -313 3.85406 0.276
NP_443018.1_3 Forward -109 -102 5.34899 0.212
NP_443018.1_3 Reverse -102 -109 5.34899 0.212
NP_441634.1_8 Forward -112 -98 -2.95034 0.295
NP_440376.1_1 Forward -152 -143 4.22796 0.166
NP_440376.1_1 Reverse -101 -110 -0.000272808 0.285
NP_440376.1_1 Forward -110 -101 -0.0986038 0.285
NP_442687.1_7 Forward -111 -101 6.37155 0.171
NP_442687.1_7 Forward -207 -197 3.81494 0.286
NP_441797.1_7 Forward -156 -138 11.0322 0.286
NP_442485.1_3 Forward -148 -129 -4.52377 0.282
NP_440642.1_10 Forward -348 -334 2.45727 0.277
NP_441013.1_2 Forward -121 -103 4.05072 0.226
NP_441511.1_2 Forward -194 -175 20.2556 0.0407
NP_442658.1_1 Reverse -99 -109 11.6809 0.0768
NP_442782.1_2 Forward -110 -96 1.67122 0.281
NP_440656.1_8 Reverse -90 -109 -6.58872 0.245
NP_441414.1_9 Reverse -101 -120 -8.16202 0.23
NP_440607.1_8 Forward -313 -294 8.25926 0.153
NP_441487.1_9 Forward -272 -253 -3.24547 0.298
NP_442937.1_5 Forward -141 -122 6.09597 0.288
NP_441958.1_5 Forward -111 -101 1.455 0.0956
NP_442836.1_5 Forward -116 -97 2.75272 0.248
NP_442836.1_5 Reverse -137 -156 1.27776 0.287
NP_439990.1_5 Forward -115 -102 11.7207 0.128
NP_441580.1_6 Reverse -90 -109 -8.94866 0.277
NP_440153.1_5 Reverse -102 -116 1.67122 0.245
NP_443055.1_6 Forward -31 -13 -1.35821 0.277
NP_443055.1_6 Forward -129 -111 -2.43985 0.295
NP_440934.1_2 Reverse -138 -157 0.884433 0.281
NP_440602.1_8 Forward -110 -96 9.63603 0.298
NP_442002.1_9 Reverse -253 -260 12.8221 0.185
NP_441294.1_7 Reverse -97 -111 13.2821 0.0711
NP_441294.1_7 Reverse -334 -348 8.86667 0.274
NP_441646.1_1 Forward -159 -140 2.45773 0.218
NP_442438.1_10 Reverse -96 -110 0.687908 0.218
NP_442438.1_10 Forward -115 -101 -0.688726 0.274
NP_440879.1_6 Reverse -96 -115 -3.73712 0.279
NP_440377.1_1 Reverse -21 -38 11.0804 0.291
NP_441000.1_6 Forward -111 -97 -4.81863 0.252
NP_440147.1_4 Reverse -99 -112 -0.767364 0.299
NP_441550.1_8 Forward -112 -102 5.78111 0.23
NP_441916.1_7 Forward -110 -100 6.56821 0.0919
NP_441916.1_7 Reverse -101 -111 1.455 0.285
NP_441041.1_4 Reverse -101 -120 -2.75381 0.117
NP_441041.1_4 Forward -158 -139 -13.9635 0.299
NP_441041.1_7 Reverse -98 -110 6.15429 0.221
NP_440703.1_9 Forward -152 -139 10.8351 0.192
NP_439966.1_7 Forward -112 -102 5.48612 0.22
NP_439966.1_9 Forward -136 -127 7.66954 0.253
NP_440202.1_8 Reverse -135 -154 10.1954 0.297
NP_442941.1_3 Reverse -102 -112 9.51814 0.0306
NP_442941.1_3 Forward -109 -99 -0.904945 0.274
NP_440289.1_2 Reverse -98 -111 2.67422 0.0907
NP_440983.1_5 Reverse -290 -309 -5.60541 0.268
NP_442281.1_1 Reverse -96 -110 3.63724 0.224
NP_442281.1_1 Forward -115 -101 2.94893 0.249
NP_001035871.2_7 Reverse -109 -119 17.6796 0.105
NP_441556.1_10 Reverse -138 -152 17.8141 0.0841
NP_440498.1_1 Forward -356 -338 2.87075 0.17
NP_440375.1_8 Reverse -102 -121 -0.39387 0.266
NP_441644.1_6 Reverse -143 -153 9.02601 0.0872
NP_441644.1_6 Reverse -101 -111 6.17443 0.165
NP_443049.1_6 Reverse -111 -121 11.0554 0.282
NP_442215.1_2 Reverse -141 -157 -2.89139 0.206
NP_442215.1_2 Forward -182 -166 -6.92296 0.281
NP_442029.1_1 Forward -112 -93 -20.0601 0.297
NP_442029.1_6 Forward -164 -145 2.85105 0.286
NP_442933.1_10 Forward -110 -101 13.9627 0.0192
NP_442933.1_10 Reverse -101 -110 8.1612 0.0885
NP_442554.1_8 Reverse -102 -112 6.46988 0.117
NP_442554.1_8 Reverse -350 -360 2.92996 0.249
NP_441762.1_7 Reverse -100 -112 -5.56589 0.217
NP_442142.1_4 Reverse -98 -111 9.26181 0.0998
NP_442142.1_4 Forward -113 -100 4.73861 0.212
NP_442292.1_1 Reverse -102 -111 8.75118 0.0306
NP_442292.1_1 Reverse -350 -359 3.93297 0.189
NP_443009.1_5 Forward -111 -100 7.43299 0.129
NP_442301.1_2 Reverse -367 -386 8.84842 0.219
NP_442338.1_3 Reverse -245 -264 17.0413 0.266
NP_441715.1_4 Reverse -102 -112 7.64985 0.108
NP_441715.1_4 Forward -109 -99 5.19158 0.224
NP_440379.1_5 Reverse -167 -186 -9.83364 0.267
NP_441468.1_1 Reverse -102 -109 6.13563 0.209
NP_441468.1_1 Forward -109 -102 6.0373 0.223
NP_441015.1_10 Reverse -138 -157 -4.81876 0.212
NP_441015.1_10 Forward -310 -291 -10.6203 0.286
NP_441673.1_1 Reverse -101 -110 1.37636 0.114
NP_441673.1_1 Forward -110 -101 1.1797 0.163
NP_441339.1_4 Reverse -136 -155 -5.80207 0.28
NP_442253.1_5 Reverse -140 -157 -0.846137 0.234
NP_441826.1_2 Forward -116 -102 4.71948 0.0999
NP_441826.1_2 Reverse -95 -109 -2.45868 0.271
NP_441826.1_5 Forward -151 -132 5.60432 0.241
NP_442811.1_2 Reverse -195 -214 -1.18052 0.256
NP_442868.1_6 Forward -112 -102 9.41981 0.0485
NP_442719.1_2 Reverse -22 -40 0.706727 0.162
NP_441911.1_10 Reverse -359 -378 6.92008 0.289
NP_442808.1_1 Reverse -100 -110 8.63269 0.0481
NP_442808.1_1 Forward -122 -112 1.35624 0.287
NP_441101.1_10 Forward -114 -95 -0.000545616 0.184
NP_442630.1_1 Forward -109 -90 24.7789 0.0157
NP_442630.1_5 Forward -40 -21 23.6972 0.019
NP_440145.1_3 Forward -120 -101 -2.75381 0.178
NP_440334.1_2 Reverse -192 -205 15.7522 0.203
NP_440558.1_2 Reverse -140 -159 -0.688862 0.204
NP_440558.1_2 Reverse -340 -359 -6.09707 0.271
NP_441878.1_6 Forward -153 -143 -7.29646 0.217
NP_441878.1_6 Reverse -142 -152 -7.68978 0.255
NP_441036.1_8 Reverse -100 -110 15.9097 0.00724
NP_441557.1_5 Forward -110 -101 8.84951 0.0343
NP_441557.1_5 Reverse -101 -110 0.786375 0.106
NP_441433.1_8 Reverse -144 -163 -4.13045 0.289
NP_442183.1_9 Forward -361 -351 11.0914 0.229
NP_440356.1_4 Reverse -192 -211 2.16274 0.241
NP_441549.1_9 Reverse -139 -157 -9.42063 0.248
NP_441467.1_9 Forward -319 -305 15.5359 0.198
NP_442347.1_2 Reverse -102 -111 3.93297 0.284
NP_442645.1_2 Forward -118 -99 -15.1435 0.19
NP_442645.1_2 Reverse -135 -154 -16.2252 0.227
NP_441405.1_1 Reverse -14 -24 16.1063 0.229
NP_440136.1_2 Reverse -102 -109 6.23397 0.171
NP_440136.1_2 Forward -109 -102 6.13563 0.193
NP_442590.1_10 Reverse -137 -156 17.5024 0.113
NP_442590.1_10 Reverse -131 -150 5.30933 0.264
NP_442998.1_10 Reverse -103 -110 15.5754 0.0102
NP_442998.1_10 Forward -345 -338 10.4622 0.0819
NP_440299.1_1 Forward -114 -101 16.5383 0.00987
NP_440299.1_1 Forward -183 -170 2.87033 0.269
NP_442334.1_10 Forward -152 -133 -16.3235 0.226
NP_441449.1_8 Forward -148 -129 12.8237 0.298
NP_440256.1_1 Forward -113 -94 17.3057 0.00544
NP_442756.1_2 Forward -167 -148 3.83436 0.296
NP_442866.1_1 Forward -112 -93 -5.9004 0.245
NP_440748.1_5 Forward -203 -184 -3.24547 0.293
NP_441464.1_10 Reverse -4 -18 9.43936 0.262
NP_440702.1_2 Forward -109 -90 -7.27704 0.269
NP_442386.1_9 Reverse -100 -109 7.07914 0.219
NP_441340.1_5 Forward -109 -102 6.13563 0.175
NP_441340.1_5 Reverse -102 -109 5.93897 0.198
NP_442484.1_2 Reverse -132 -151 1.0811 0.238
NP_442791.1_5 Reverse -93 -112 -12.2919 0.299
NP_440146.1_7 Reverse -171 -190 18.9547 0.198
NP_439976.1_4 Reverse -130 -149 6.58682 0.278
NP_442240.1_2 Reverse -102 -121 -9.63698 0.137
NP_440586.1_8 Forward -109 -102 11.4451 0.0645
NP_442251.1_6 Reverse -102 -109 12.0355 0.0627
NP_441262.1_3 Forward -110 -103 14.7888 0.0223
NP_440027.1_3 Reverse -91 -109 14.9646 0.101
NP_440027.1_3 Forward -152 -134 11.6214 0.159
NP_443051.1_1 Forward -111 -102 0.786375 0.125
NP_440451.1_10 Reverse -102 -121 7.76679 0.283
NP_439996.1_6 Forward -111 -92 8.88508 0.242
NP_439937.1_8 Reverse -171 -190 16.1257 0.0996
NP_440408.1_7 Forward -152 -133 8.06259 0.282
NP_440439.1_1 Forward -113 -100 0.314277 0.194
NP_440372.1_2 Forward -109 -102 6.72562 0.0929
NP_440372.1_2 Reverse -102 -109 6.62729 0.151
NP_440171.1_2 Forward -382 -368 16.1563 0.258
NP_441803.1_2 Forward -151 -132 5.11266 0.171
NP_440139.1_1 Reverse -95 -114 0.392004 0.292
NP_442384.1_10 Reverse -101 -114 16.9322 0.00688
NP_442384.1_10 Forward -152 -139 0.60927 0.286
NP_441877.1_7 Reverse -351 -370 1.08032 0.244
NP_441018.1_7 Forward -315 -296 11.7992 0.177
NP_441018.1_7 Forward -114 -95 11.0125 0.194
NP_441018.1_7 Reverse -139 -158 10.0292 0.218
NP_440344.1_10 Reverse -94 -111 -8.61428 0.13
NP_440531.1_6 Reverse -135 -154 4.52268 0.124
NP_441592.1_4 Forward -30 -11 -0.000545616 0.237
NP_440894.1_10 Forward -169 -150 5.80098 0.227
NP_440894.1_10 Reverse -132 -151 5.40766 0.233
NP_440999.1_9 Reverse -278 -292 -0.885388 0.22
NP_440999.1_9 Reverse -152 -166 -0.885388 0.22
NP_440888.1_2 Reverse -101 -115 6.48882 0.232
NP_442033.1_10 Reverse -99 -118 -14.4552 0.298
NP_441949.1_2 Forward -144 -125 6.98095 0.261
NP_441543.1_2 Reverse -102 -111 7.17789 0.131
NP_441543.1_2 Forward -109 -100 5.99792 0.159
NP_441834.1_1 Reverse -172 -191 17.3057 0.185
NP_443064.1_6 Reverse -101 -111 8.6886 0.276
NP_442337.1_8 Forward -321 -302 3.34271 0.216
NP_442578.1_7 Forward -109 -102 5.93897 0.183
NP_440220.1_4 Forward -269 -250 4.52188 0.212
NP_440148.1_1 Reverse -361 -380 -7.67036 0.291
NP_441462.1_2 Forward -110 -100 1.16001 0.0976
NP_443062.1_1 Reverse -101 -119 7.66836 0.17
NP_443062.1_1 Forward -121 -103 5.91323 0.215
NP_443062.1_6 Reverse -189 -208 0.58944 0.292
NP_441601.1_4 Reverse -132 -151 -5.70374 0.294
NP_440519.1_8 Forward -167 -151 5.46674 0.21
NP_442204.1_1 Forward -114 -103 11.5634 0.0565
NP_442204.1_5 Forward -162 -143 0.884433 0.251
NP_442204.1_6 Forward -119 -100 4.32602 0.293
NP_441560.1_3 Reverse -308 -326 4.9357 0.298
NP_440516.1_8 Forward -110 -101 8.1612 0.0417
NP_442428.1_5 Reverse -102 -109 6.13563 0.209
NP_442428.1_5 Forward -109 -102 6.0373 0.212
NP_440673.1_3 Reverse -103 -110 12.4288 0.0426
NP_440673.1_3 Reverse -145 -152 6.23397 0.283
NP_441052.1_2 Reverse -101 -111 1.74999 0.229
NP_442219.1_8 Reverse -139 -158 8.74691 0.241
NP_442219.1_8 Forward -189 -170 7.49067 0.267
NP_442219.1_9 Reverse -102 -111 8.06287 0.0696
NP_440436.1_4 Reverse -102 -111 13.9623 0.0193
NP_440436.1_4 Forward -109 -100 13.6673 0.0225
NP_441884.1_8 Forward -111 -92 -14.0619 0.298
NP_442864.1_2 Reverse -350 -369 13.3725 0.227
NP_441719.1_2 Forward -194 -180 12.8678 0.296
NP_441719.1_4 Forward -109 -102 6.72562 0.093
NP_441719.1_4 Reverse -102 -109 6.62729 0.151
NP_442813.1_2 Reverse -114 -133 -1.7705 0.273
NP_442873.1_5 Forward -150 -131 9.83173 0.248
NP_441115.1_4 Forward -147 -129 7.88485 0.269
NP_442206.1_10 Reverse -144 -159 3.81481 0.181
NP_442586.1_6 Forward -319 -300 8.75091 0.272
NP_441851.1_10 Forward -111 -101 7.25653 0.144
NP_441668.1_4 Forward -40 -21 -2.45882 0.288
NP_442515.1_1 Forward -153 -139 6.19444 0.1
NP_442515.1_1 Reverse -50 -64 -4.03198 0.298
NP_442515.1_1 Reverse -14 -28 -4.4253 0.298
NP_440593.1_3 Forward -163 -144 -4.6221 0.251
NP_441046.1_2 Reverse -254 -273 -2.16383 0.295
NP_440940.1_7 Reverse -91 -109 7.49153 0.201
NP_441661.1_3 Forward -136 -119 3.0871 0.226
NP_441409.1_8 Reverse -305 -324 8.26977 0.272
NP_442843.1_1 Forward -151 -132 -4.32711 0.237
NP_442843.1_1 Forward -109 -90 -9.63698 0.267
NP_439960.1_3 Forward -152 -133 -1.18052 0.3
NP_439960.1_10 Reverse -133 -151 -3.6191 0.277
NP_441124.1_5 Reverse -116 -126 12.0532 0.239
NP_442006.1_2 Reverse -329 -346 -17.5624 0.279
NP_442006.1_2 Forward -227 -210 -18.939 0.296
NP_442243.1_1 Forward -159 -141 -1.35821 0.277
NP_441570.1_1 Forward -110 -92 -4.99573 0.075
NP_441570.1_1 Reverse -101 -119 -9.51896 0.139
NP_441078.1_4 Reverse -101 -110 0.196389 0.205
NP_441078.1_4 Forward -110 -101 -0.000272808 0.205
NP_441078.1_4 Forward -152 -143 -1.37691 0.254
NP_440526.1_3 Reverse -102 -113 5.17139 0.253
NP_441432.1_8 Reverse -196 -205 9.24284 0.0755
NP_441432.1_8 Forward -111 -102 7.17789 0.102
NP_441432.1_8 Forward -153 -144 5.50626 0.151
NP_442320.1_2 Forward -194 -175 18.289 0.159
NP_442320.1_8 Reverse -95 -109 -5.50694 0.228
NP_441732.1_2 Forward -156 -140 -16.2644 0.165
NP_442447.1_1 Reverse -30 -49 5.89931 0.258
NP_440760.1_1 Forward -24 -5 -22.6167 0.263
NP_440760.1_1 Reverse -101 -120 -22.8133 0.271
NP_441057.1_4 Forward -168 -150 5.72234 0.195
NP_439900.1_6 Forward -160 -143 19.8034 0.166
NP_442353.1_4 Forward -158 -139 19.3698 0.0597
NP_440913.1_1 Forward -112 -94 9.16393 0.179
NP_442727.1_1 Forward -318 -304 16.3225 0.195
NP_442489.1_7 Reverse -101 -110 0.884706 0.145
NP_442489.1_7 Forward -110 -101 0.491382 0.178
NP_442489.1_7 Forward -152 -143 -1.37691 0.195
NP_442489.1_7 Reverse -143 -152 -1.6719 0.235
NP_440559.1_1 Reverse -102 -111 14.1594 0.0317
NP_441659.2_8 Reverse -101 -111 6.37155 0.0774
NP_440786.1_9 Reverse -19 -38 17.0107 0.18
NP_440860.1_8 Forward -394 -375 13.2741 0.296
NP_440363.1_9 Forward -161 -143 14.8671 0.21
NP_440363.1_9 Forward -151 -133 14.7688 0.212
NP_442913.1_10 Forward -161 -142 11.7992 0.0414
NP_442913.1_10 Reverse -134 -153 -5.99873 0.287
NP_440335.1_9 Forward -246 -228 12.0155 0.273
NP_442346.1_5 Forward -111 -101 14.828 0.00967
NP_442346.1_5 Forward -153 -143 9.32148 0.118
NP_442346.1_10 Forward -62 -43 -2.85214 0.294
NP_440545.1_3 Forward -156 -139 -1.92778 0.177
NP_440545.1_3 Reverse -334 -351 -5.66436 0.256
NP_440545.1_3 Forward -222 -205 -7.13932 0.298
NP_440831.1_3 Reverse -128 -147 5.90175 0.28
NP_441786.1_3 Reverse -108 -127 16.4207 0.108
NP_441710.1_9 Forward -117 -98 11.0117 0.256
NP_440486.1_9 Forward -120 -106 17.8958 0.116
NP_440459.1_2 Reverse -99 -116 11.7402 0.166
NP_440459.1_2 Reverse -141 -158 10.0686 0.21
NP_442551.1_4 Reverse -141 -156 5.68309 0.217
NP_442900.1_2 Forward -161 -142 2.16274 0.289
NP_442603.1_7 Reverse -101 -115 6.78381 0.23
NP_441833.1_4 Reverse -102 -109 14.1004 0.0258
NP_441833.1_4 Forward -109 -102 6.13563 0.198
NP_441329.1_6 Forward -249 -230 3.48503 0.216
NP_441895.1_2 Forward -400 -381 -17.3068 0.217
NP_442162.1_9 Reverse -102 -109 6.62729 0.142
NP_442162.1_9 Forward -109 -102 6.52896 0.178
NP_440788.1_8 Forward -143 -124 12.4875 0.265
NP_440671.1_4 Reverse -95 -109 5.01447 0.297
NP_440772.1_8 Forward -127 -108 8.25926 0.259
NP_442140.1_3 Forward -109 -99 6.56821 0.162
NP_442723.1_1 Forward -125 -106 3.24359 0.278
NP_440875.1_9 Reverse -103 -113 8.37203 0.233
NP_441813.1_5 Forward -112 -102 8.33817 0.047
NP_441813.1_5 Reverse -99 -109 6.8632 0.0784
NP_440590.1_4 Reverse -102 -115 9.95071 0.0327
NP_440590.1_4 Reverse -350 -363 -5.58558 0.283
NP_440567.1_1 Reverse -126 -140 2.65453 0.167
NP_442497.1_10 Reverse -102 -111 0.688044 0.141
NP_440821.1_4 Reverse -99 -109 0.57002 0.169
NP_440821.1_4 Forward -112 -102 -0.41329 0.257
NP_441239.1_9 Reverse -135 -147 4.66053 0.248
NP_441951.1_4 Forward -185 -166 2.3594 0.283
NP_442568.1_8 Reverse -311 -325 7.86607 0.296
NP_440400.1_1 Forward -272 -253 -2.26292 0.285
NP_441892.1_2 Reverse -5 -24 0.392778 0.16
NP_442669.1_1 Reverse -1 -20 1.96607 0.206
NP_440604.1_5 Reverse -111 -130 16.7334 0.235
NP_440546.1_4 Forward -110 -100 11.5004 0.0806
NP_440462.1_4 Forward -318 -304 9.93102 0.242
NP_440462.1_6 Reverse -99 -109 5.19158 0.164
NP_440462.1_6 Forward -136 -126 2.53664 0.282
NP_442402.1_4 Forward -286 -267 -7.96609 0.278
NP_442402.1_4 Forward -54 -35 -7.96609 0.278
NP_442258.1_8 Forward -34 -15 16.9124 0.0737
NP_440653.1_10 Reverse -185 -204 3.53937 0.271
NP_440696.1_3 Reverse -133 -151 4.14905 0.2
NP_440696.1_3 Forward -110 -92 -3.12744 0.282
NP_442039.1_7 Forward -156 -146 7.55152 0.275
NP_442273.1_10 Reverse -59 -77 5.82068 0.288
NP_441053.1_3 Forward -322 -303 -3.73712 0.299
NP_442837.1_3 Reverse -102 -109 6.13563 0.25
NP_442837.1_3 Forward -109 -102 5.93897 0.265
NP_440505.1_3 Forward -112 -102 17.0896 0.00449
NP_440914.1_1 Reverse -101 -111 14.7634 0.00997
NP_441011.1_8 Forward -109 -100 8.45619 0.144
NP_441011.1_8 Forward -377 -368 5.3096 0.271
NP_442533.1_6 Reverse -143 -152 5.60459 0.137
NP_442533.1_6 Forward -110 -101 5.3096 0.145
NP_441482.1_7 Forward -116 -102 -0.983719 0.0612
NP_439944.1_9 Forward -109 -99 6.66654 0.172
NP_440116.1_8 Reverse -102 -121 -8.35868 0.253
NP_441527.1_4 Reverse -311 -330 -3.1994 0.164
NP_441527.1_4 Forward -248 -229 -5.87318 0.21
NP_441527.1_4 Forward -249 -230 -6.8281 0.226
NP_440115.1_6 Forward -113 -103 16.008 0.0325
NP_440007.1_9 Reverse -140 -154 6.98109 0.213
NP_440007.1_9 Forward -362 -348 1.76955 0.285
NP_441680.1_4 Forward -157 -138 2.3594 0.244
NP_441106.1_1 Reverse -100 -109 13.9627 0.0279
NP_440429.1_2 Forward -346 -327 7.7676 0.28
NP_439903.1_1 Forward -149 -130 2.85105 0.214
NP_442588.1_6 Reverse -104 -123 -1.08219 0.268
NP_441286.1_1 Forward -111 -99 2.69391 0.0562
NP_442674.1_2 Forward -396 -377 8.65258 0.249
NP_440670.1_8 Reverse -101 -110 6.98123 0.0882
NP_440828.1_1 Reverse -145 -164 -1.67294 0.287
NP_442264.1_2 Reverse -139 -156 10.4619 0.188
NP_441626.1_2 Forward -109 -102 6.0373 0.212
NP_441626.1_2 Reverse -102 -109 6.0373 0.212
NP_441901.1_1 Reverse -109 -128 0.982764 0.256
NP_442365.1_7 Forward -114 -95 -5.40875 0.269
NP_442794.1_1 Forward -114 -102 10.1671 0.0721
NP_441858.1_2 Reverse -133 -152 14.6152 0.222
NP_442437.1_3 Reverse -103 -122 20.3531 0.083
NP_440492.1_9 Forward -236 -222 11.4262 0.294
NP_441272.1_7 Forward -100 -90 14.9263 0.2
NP_440766.1_4 Forward -114 -100 2.94952 0.163
NP_441237.1_9 Reverse -197 -207 11.3864 0.184
NP_441237.1_9 Forward -152 -142 10.2065 0.241
NP_439910.1_2 Reverse -93 -110 -13.6292 0.162
NP_440457.1_1 Forward -114 -102 0.530633 0.25
NP_441436.1_2 Forward -149 -130 6.09597 0.19
NP_441436.1_8 Forward -310 -291 9.53756 0.263
NP_442582.1_8 Forward -356 -338 8.7706 0.213
NP_442514.1_10 Reverse -137 -156 8.06259 0.258
NP_440554.1_4 Forward -109 -99 6.8632 0.111
NP_441885.1_5 Reverse -101 -111 1.455 0.11
NP_441885.1_5 Forward -110 -100 0.668351 0.133
NP_441173.1_9 Reverse -26 -34 10.9338 0.242
NP_440423.1_10 Forward -117 -98 12.5858 0.196
NP_443000.1_7 Forward -112 -102 10.1081 0.0376
NP_443059.1_10 Reverse -93 -112 1.57197 0.239
NP_440275.1_3 Forward -112 -102 5.48657 0.145
NP_440091.1_1 Reverse -97 -109 20.5902 0.00953
NP_441307.1_4 Forward -394 -375 0.982764 0.238
NP_443060.1_5 Reverse -13 -32 8.4551 0.207
NP_441902.1_3 Reverse -332 -342 12.0099 0.281
NP_441122.1_1 Reverse -10 -25 10.8946 0.222
NP_441207.1_4 Forward -109 -90 7.47261 0.209
NP_439962.1_4 Reverse -129 -148 -5.50708 0.28
NP_440175.1_7 Forward -111 -93 14.6331 0.144
NP_442495.1_4 Reverse -246 -256 15.123 0.146
NP_440149.1_8 Forward -152 -133 -4.42544 0.207
NP_441105.1_3 Reverse -138 -157 2.16274 0.107
NP_441105.1_3 Reverse -192 -211 -7.27704 0.25
NP_440216.1_1 Reverse -101 -115 -9.93184 0.145
NP_440216.1_1 Forward -110 -96 -12.0951 0.24
NP_440216.1_6 Forward -153 -137 0.156866 0.258
NP_440216.1_9 Reverse -357 -366 5.40793 0.294
NP_442015.1_10 Forward -114 -101 8.47575 0.0654
NP_441226.1_7 Reverse -150 -157 9.47853 0.147
NP_441111.1_7 Reverse -102 -110 8.96754 0.0463
NP_441766.1_2 Forward -110 -101 8.06287 0.0691
NP_440416.1_9 Reverse -142 -161 -17.1101 0.231
NP_440416.1_9 Reverse -132 -151 -17.4051 0.239
NP_440416.1_9 Forward -153 -134 -19.4701 0.275
NP_440416.1_9 Forward -117 -98 -20.2567 0.283
NP_443052.1_9 Forward -147 -128 -6.78538 0.289
NP_443052.1_9 Reverse -126 -145 -7.17871 0.294
NP_442154.1_1 Forward -319 -301 -0.177514 0.109
NP_442154.1_1 Forward -372 -354 -6.4707 0.139
NP_442154.1_1 Forward -166 -148 -17.0904 0.249
NP_442154.1_1 Forward -109 -91 -18.1721 0.278
NP_442564.1_2 Forward -362 -343 7.27595 0.253
NP_440261.1_5 Reverse -102 -115 -2.93064 0.0983
NP_440261.1_5 Forward -151 -138 -6.17557 0.196
NP_440988.1_10 Reverse -141 -155 9.35221 0.205
NP_440988.1_10 Forward -154 -140 6.54464 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCTTAGCCCTAATTGGGGGGTTGTTATCCGTTGTTTTCACTGGCGGTGTCATTTCTATTGCCTCCCTAGTCGGTTTTATTACCCTGTTTGGGGTGGCTGTACGGAACGGACTATTACTGGTGGATAACTACAACCAGAAATTCGCCCAGGGAATGAAACTAAAAGAAACAATCTTTAAGGGGTCTATGGAACGGGTCAATGCCATTTTAATGACCGCTTTGACCTCAGCTTTAGGGATGTTACCGTTGGCAACGGCCAGCAGTGCCGGGAACGAAATTCTCCAACCCCTGGCGATCGTTGTTCTTGGTGGACTGTGTACTTCTACGGCTTTAACCTTATTGGTATTACCCGCTTTGTATGCCAAATTTGGTAAATGGTTAATGCCCAAACAGCCTACCA

CDS

ATGGAGACCACATTGCTCCTTTTGTGCGTAACGATAGGGTCAGCACTCAAAAATCGCATTTTTAAACGTGAATTATTATCTCTTCTGGCTGTATTAACAACGGTGGGAGAGATTTTTTTACCACATTTTTTCTGGTTAATTTCCATGACCATTACCCAAAACACAACTCGCCACTATCATCATCGTCGAAGGTCTCAACAATCATCTTGGTCACGCCATTTTTTTCTGGCCACTTTATTATTTACTCTTTGCTTGGCAGCTTTTATTAGAAAGTCTCCTGAAACTGAAAACATCAATTCCTTTTTTGGCCATTTACCATCCCTAGCCATGGAAGGAGGAGATCCTTACATTAGAGCTTTAATGCGGACAATTTCAGCCAGTGAATCTAATGCTAAAAATCCCTACGTTTTACTCTATGGCGGTCAACATACCCATGATTTAAGTCGCCATCCCAATGCTTGTATTGCCATCAAAACAGATGTTAACCAAGGGCATTGCTCCACAGCGGCAGGACGTTATCAATTTTTGACTAAGACTTGGCAGGAAAAAGCGGCTTTGTATCACCCTCAACGTCATTTGGGAAAATCACACTATAACTTTGAGCCTGAATTTCAGGATTTAGTAACCTATCGATGGTTGACCGATAAACACCACTGGGGCATGGACTTTTCCACCCAATTACAACAGGGAAATATCGAACAAGTGTTGAAAAAACTTTCTGGCACTTGGACAAGTTTGGGTTACGGCATTGAAGACAATAGAATGACCGCTTCTTTACCCAAAATTTATCAAAAACTATTAGCAGAAGAACTTGACCAAGCTAATTAA

Protein

METTLLLLCVTIGSALKNRIFKRELLSLLAVLTTVGEIFLPHFFWLISMTITQNTTRHYHHRRRSQQSSWSRHFFLATLLFTLCLAAFIRKSPETENINSFFGHLPSLAMEGGDPYIRALMRTISASESNAKNPYVLLYGGQHTHDLSRHPNACIAIKTDVNQGHCSTAAGRYQFLTKTWQEKAALYHPQRHLGKSHYNFEPEFQDLVTYRWLTDKHHWGMDFSTQLQQGNIEQVLKKLSGTWTSLGYGIEDNRMTASLPKIYQKLLAEELDQAN