Your browser is old and dusty. Try Google Chrome!

Details for slr0793

ORF slr0793
Accession NP_442628.1
Symbol nrsB
Category cation efflux system protein involved in nickel and cobalt tolerance
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -260 -274 4.32615 0.151
NP_441061.1_2 Forward -162 -148 -1.8687 0.274
NP_440557.1_1 Forward -123 -104 -0.197208 0.267
NP_443002.1_5 Forward -144 -126 14.2763 0.202
NP_442752.1_4 Reverse -115 -122 7.90559 0.144
NP_441250.1_3 Forward -251 -232 1.76941 0.284
NP_441802.1_1 Reverse -236 -255 5.80098 0.269
NP_442207.1_4 Reverse -199 -218 13.8641 0.285
NP_442602.1_3 Forward -33 -14 4.42435 0.153
NP_441594.1_6 Reverse -151 -170 1.57275 0.266
NP_440273.1_3 Reverse -143 -162 6.58763 0.232
NP_441558.1_5 Forward -126 -107 5.30933 0.254
NP_442111.1_4 Forward -301 -287 4.81781 0.189
NP_441486.1_1 Forward -166 -152 -0.000409212 0.147
NP_440057.1_6 Forward -33 -14 9.92878 0.298
NP_441634.1_8 Forward -126 -112 -3.34366 0.295
NP_441846.1_10 Reverse -136 -155 -23.5016 0.289
NP_442658.1_1 Forward -276 -266 7.94438 0.199
NP_442544.1_2 Forward -52 -38 -0.0987402 0.217
NP_442321.1_4 Forward -272 -253 -8.85033 0.292
NP_439990.1_5 Reverse -337 -350 7.29578 0.203
NP_439990.1_5 Reverse -260 -273 5.91914 0.267
NP_441338.2_9 Forward -36 -17 3.93269 0.291
NP_443044.1_1 Reverse -64 -83 1.47442 0.3
NP_440206.1_4 Reverse -255 -274 -0.689632 0.29
NP_441041.1_4 Reverse -130 -149 -9.24366 0.214
NP_439966.1_9 Reverse -286 -295 4.52295 0.253
NP_440674.1_3 Reverse -213 -232 2.45773 0.265
NP_442143.1_9 Reverse -161 -180 13.47 0.289
NP_440421.1_1 Reverse -145 -159 15.9292 0.19
NP_443009.1_5 Reverse -331 -342 5.66304 0.193
NP_441015.1_10 Reverse -194 -213 -10.0303 0.282
NP_441826.1_2 Reverse -326 -340 -1.37704 0.245
NP_442490.1_9 Reverse -279 -298 -0.885524 0.179
NP_442719.1_2 Forward -321 -303 -0.964891 0.175
NP_442719.1_2 Forward -246 -228 -1.55487 0.175
NP_442719.1_2 Reverse -17 -35 -11.0929 0.287
NP_442719.1_2 Forward -31 -13 -11.4863 0.292
NP_441251.1_7 Forward -30 -17 13.884 0.266
NP_442427.1_8 Forward -32 -13 8.25926 0.203
NP_441911.1_7 Forward -76 -57 -18.9791 0.261
NP_441882.1_6 Reverse -257 -276 5.99764 0.111
NP_440558.1_2 Forward -222 -203 -7.17871 0.289
NP_441914.1_5 Reverse -38 -57 11.5042 0.238
NP_441308.1_8 Reverse -113 -123 10.7964 0.22
NP_442397.1_4 Forward -215 -196 14.6499 0.294
NP_439980.1_1 Reverse -280 -299 14.9545 0.286
NP_441574.1_1 Reverse -193 -212 10.3242 0.11
NP_441574.1_1 Reverse -142 -161 -4.03212 0.249
NP_442965.1_2 Forward -41 -22 -6.49039 0.257
NP_442888.1_6 Forward -285 -266 8.75091 0.195
NP_442594.1_8 Reverse -197 -216 14.9458 0.146
NP_442738.1_4 Forward -363 -344 9.63589 0.247
NP_440136.1_1 Reverse -18 -34 10.0876 0.238
NP_442998.1_5 Forward -37 -27 14.7297 0.149
NP_442998.1_5 Forward -26 -16 13.5497 0.158
NP_442998.1_5 Reverse -64 -74 12.8614 0.158
NP_440899.1_1 Reverse -286 -305 9.96891 0.2
NP_442334.1_2 Forward -44 -27 -14.0225 0.297
NP_441270.1_5 Reverse -336 -355 11.3352 0.294
NP_440915.1_6 Reverse -111 -125 1.27789 0.142
NP_440749.1_6 Reverse -57 -76 7.66927 0.275
NP_441464.1_10 Reverse -195 -209 8.06273 0.287
NP_441939.1_3 Forward -123 -104 8.16093 0.18
NP_442993.1_1 Reverse -205 -221 -10.6595 0.224
NP_442386.1_9 Reverse -153 -162 6.48915 0.219
NP_442386.1_9 Forward -125 -116 5.70251 0.241
NP_440327.1_6 Reverse -3 -22 4.916 0.266
NP_441877.1_5 Forward -240 -221 4.62101 0.211
NP_442713.1_3 Reverse -341 -360 4.22769 0.238
NP_440344.1_10 Reverse -281 -298 -13.0392 0.273
NP_440531.1_8 Reverse -118 -137 4.916 0.269
NP_442078.1_3 Forward -230 -211 -1.47628 0.277
NP_442033.1_3 Forward -264 -245 12.5858 0.289
NP_442845.1_2 Reverse -109 -123 12.7826 0.104
NP_442845.1_2 Reverse -148 -162 6.3911 0.21
NP_442845.1_4 Forward -332 -313 9.63589 0.178
NP_441469.1_8 Reverse -320 -329 5.01461 0.297
NP_440220.1_4 Reverse -20 -39 -2.16459 0.266
NP_441929.1_3 Reverse -65 -84 1.76941 0.278
NP_441560.1_3 Forward -306 -288 5.72234 0.293
NP_442487.1_2 Forward -144 -125 3.24359 0.232
NP_441867.1_2 Reverse -221 -240 -12.2919 0.253
NP_441867.1_2 Reverse -360 -379 -14.8485 0.289
NP_440673.1_7 Reverse -261 -280 2.45773 0.226
NP_440436.1_4 Forward -162 -153 8.06244 0.118
NP_440436.1_4 Reverse -260 -269 5.11253 0.222
NP_441004.1_1 Reverse -199 -218 -13.0786 0.253
NP_441004.1_4 Reverse -202 -212 10.3048 0.254
NP_442813.1_4 Forward -59 -40 -2.95047 0.287
NP_442206.1_10 Reverse -115 -130 0.176559 0.269
NP_440328.1_4 Reverse -266 -285 0.884433 0.237
NP_441851.1_10 Reverse -153 -163 4.50326 0.266
NP_441545.1_1 Reverse -344 -363 0.196116 0.294
NP_441668.1_4 Reverse -229 -248 1.47442 0.214
NP_441046.1_2 Reverse -143 -162 -1.37718 0.288
NP_441349.1_10 Reverse -205 -224 -2.85214 0.127
NP_441349.1_10 Reverse -269 -288 -9.53865 0.294
NP_441524.1_6 Reverse -219 -237 7.59063 0.243
NP_441124.1_5 Forward -37 -27 13.0082 0.215
NP_441124.1_5 Reverse -311 -321 10.6209 0.286
NP_440431.1_2 Reverse -221 -240 2.85105 0.274
NP_442006.1_2 Reverse -41 -58 -16.4808 0.254
NP_440483.1_1 Forward -275 -256 3.93269 0.154
NP_442038.1_1 Reverse -177 -196 2.0644 0.278
NP_440539.1_9 Forward -230 -211 6.29264 0.23
NP_442348.1_2 Reverse -14 -23 14.356 0.159
NP_440707.1_6 Forward -349 -330 10.7167 0.28
NP_440707.1_9 Reverse -131 -150 8.06259 0.219
NP_440707.1_9 Reverse -194 -213 2.75272 0.268
NP_442443.1_1 Reverse -131 -150 2.45773 0.187
NP_441432.1_8 Reverse -153 -162 5.3096 0.17
NP_441732.1_2 Forward -80 -64 -7.51295 0.0859
NP_440199.1_10 Reverse -157 -167 6.96153 0.251
NP_439935.1_1 Reverse -16 -35 10.1275 0.229
NP_442489.1_2 Reverse -30 -49 1.67108 0.285
NP_440029.1_10 Reverse -372 -384 19.3112 0.204
NP_440025.1_3 Forward -27 -13 9.54584 0.296
NP_441653.1_2 Reverse -143 -162 3.14308 0.274
NP_442943.1_1 Reverse -17 -32 3.87125 0.25
NP_442140.1_3 Reverse -266 -276 3.51995 0.294
NP_441609.1_1 Reverse -16 -35 10.3242 0.117
NP_442547.1_7 Reverse -144 -163 13.5318 0.188
NP_440227.1_2 Forward -34 -18 9.10498 0.29
NP_441239.1_9 Reverse -207 -219 2.98891 0.3
NP_440156.1_4 Reverse -26 -36 13.2542 0.176
NP_442627.1_4 Reverse -90 -108 17.286 0.216
NP_442643.1_5 Forward -272 -253 -5.40875 0.293
NP_441017.1_8 Forward -344 -329 9.12468 0.231
NP_440833.1_6 Forward -25 -11 8.55376 0.272
NP_440949.1_7 Forward -314 -295 8.55343 0.28
NP_440546.1_4 Reverse -209 -219 8.78555 0.171
NP_441204.1_7 Reverse -146 -165 15.0441 0.113
NP_442499.1_3 Forward -364 -346 4.05072 0.289
NP_442479.1_9 Forward -323 -304 -10.3253 0.266
NP_442402.1_4 Reverse -19 -38 -1.8696 0.194
NP_441084.1_6 Reverse -323 -337 9.05325 0.295
NP_440696.1_6 Forward -97 -78 5.99764 0.266
NP_442358.1_6 Reverse -37 -55 12.2122 0.164
NP_442039.1_7 Forward -48 -38 8.1415 0.264
NP_440825.1_6 Forward -388 -369 8.65258 0.285
NP_442053.1_1 Forward -377 -368 4.12963 0.267
NP_440207.2_7 Forward -35 -16 20.1573 0.0973
NP_440914.1_1 Reverse -115 -125 9.39583 0.186
NP_440914.1_1 Forward -274 -264 8.12715 0.207
NP_441699.1_2 Forward -46 -27 9.73422 0.252
NP_441527.1_4 Reverse -378 -397 -12.5576 0.291
NP_440115.1_6 Forward -221 -211 5.97822 0.206
NP_440007.1_9 Reverse -111 -125 12.1926 0.163
NP_441680.1_4 Forward -356 -337 3.6377 0.213
NP_443045.1_5 Reverse -193 -206 13.8487 0.275
NP_440028.1_6 Reverse -137 -155 11.5239 0.259
NP_440907.2_8 Forward -123 -113 4.7978 0.243
NP_441463.1_3 Forward -134 -115 -2.36049 0.153
NP_441463.1_6 Forward -78 -64 5.44959 0.287
NP_441962.1_4 Reverse -274 -293 -12.5869 0.26
NP_440855.1_3 Forward -29 -10 8.4551 0.208
NP_441431.1_2 Forward -221 -207 6.29216 0.275
NP_442323.1_7 Reverse -326 -345 3.53858 0.238
NP_442324.1_7 Forward -209 -190 5.85867 0.268
NP_440293.1_3 Reverse -197 -216 -4.81876 0.265
NP_440987.1_4 Forward -34 -15 16.8141 0.111
NP_440798.1_6 Forward -49 -36 0.707601 0.251
NP_442509.1_9 Forward -297 -287 10.796 0.159
NP_442514.1_5 Reverse -71 -90 -8.35941 0.285
NP_442862.1_3 Reverse -17 -34 12.5269 0.181
NP_442862.1_3 Reverse -335 -352 7.217 0.258
NP_442862.1_3 Reverse -188 -205 6.62702 0.263
NP_442862.1_3 Reverse -222 -239 5.54538 0.271
NP_442341.1_7 Forward -125 -111 1.08123 0.299
NP_441173.1_9 Forward -243 -235 12.1137 0.21
NP_441173.1_9 Reverse -30 -38 10.9338 0.242
NP_440507.2_4 Forward -386 -367 13.2741 0.257
NP_441842.1_1 Reverse -211 -224 10.8351 0.286
NP_443060.1_5 Reverse -271 -290 13.175 0.112
NP_442638.1_3 Reverse -10 -29 12.6523 0.298
NP_441105.1_3 Reverse -104 -123 -3.63879 0.184
NP_440216.1_9 Forward -272 -263 5.70292 0.29
NP_442371.1_1 Reverse -62 -72 12.6642 0.245
NP_441226.1_7 Forward -217 -210 9.47853 0.147
NP_443052.1_9 Forward -149 -130 12.8808 0.0663
NP_443052.1_9 Forward -212 -193 -5.31042 0.266
NP_442116.1_6 Forward -33 -16 7.78699 0.254
NP_442403.1_8 Reverse -117 -136 14.6508 0.121
NP_442154.1_1 Reverse -194 -212 -6.1757 0.132
NP_440261.1_5 Reverse -210 -223 -6.86388 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCTAGTCCTTCGACACGGTTTTCCGGTTCTCCTAACGCTGTTAACATCAACACCGGCAAGGAATTACCCTGGGTTCTCAGTTTTTGACAGAGTTCCAAACCCGATAATCCCGGCAGTAACCAATCCACAATGGCAAGGGTGTATTCCGTCCATTGATTTTCCAAATAATCCCAAGCTTGGGAGCCATCCGTCACCCAATCCACCACATACTTTTCACTAACTAGCACTTTCTTAATAGCCATTCCCAAATCCGTCTCATCTTCCACCAGCAAAATTCGCATCGCCTCTGCCTTTTTTATAACGGTCTGATCTTAGCGGGGGAAGGAGATTTTCACCTGAATTTCATACCCCCTTTGGCAGACTGGGAAAATCTTGGACAAATTCCCAATTTGAGGTGGT

CDS

GTGATGAAAACAATTCAATTAGCAAGTTCCTTTCTGGCACTGGGTTTGACCCTAGGAACTCCCAATCTCGTAACAGCCCATGTGGGTCACGGTGACGAGTTTCAAGCCGAGGGAGGCATTAATCGGGTTGCCGTGAATGCAGAAACCGATTCCATGTTGGGCATTGTGGTGGAGCCGATCGCCTCTGCGCCAGATGGTAGTGCGGGGGTTTATATTCCGGCGACGGCGTTGGTAGATGGGGGGGATAAACAATTAGTGTTTGTGCAGTATGGAGAATTTTATGAGCCGGTGCCGGTGAAAACGGGGGCAACCCAGGGGGAATTGATTGAAATTACCGAAGGGTTATCGGTGGGGGAAAAATTAGTTACCCAGGGTTCTTTATCCCTTTATGCTGAATCCCGCAAAACCCCAACGGCAGAGACGGAGACCAAAGAACCAGTTGTGGCTGAGGCTGCTGAAAATACGGCTCCTGCGGAGACGACAAGTATGGCTCCCAATGAAACCCAAGCAAGTCCCCCCGTGGCGGCGGAACCAGGATTGCCCGTTTTACCGATCGCCTTGGGAGGACTAGGGGTCATTGGGGCCGGAATTTTGGGATTACGGGCGTTTAACTTGAGTCGCAAAGGCAAAAACTTTTTTGGCAAATAA

Protein

MMKTIQLASSFLALGLTLGTPNLVTAHVGHGDEFQAEGGINRVAVNAETDSMLGIVVEPIASAPDGSAGVYIPATALVDGGDKQLVFVQYGEFYEPVPVKTGATQGELIEITEGLSVGEKLVTQGSLSLYAESRKTPTAETETKEPVVAEAAENTAPAETTSMAPNETQASPPVAAEPGLPVLPIALGGLGVIGAGILGLRAFNLSRKGKNFFGK