Your browser is old and dusty. Try Google Chrome!

Details for slr0790

ORF slr0790
Accession NP_442625.1
Symbol
Category similar to ultraviolet light resistance protein B
Definition DNA replication, restriction, modification, recombination, and repair
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -208 -194 17.6992 0.0218
NP_441061.1_2 Reverse -219 -233 2.75286 0.172
NP_441061.1_2 Forward -318 -304 0.392915 0.211
NP_441418.1_6 Forward -233 -214 -19.9617 0.0997
NP_441418.1_6 Forward -161 -142 -29.8932 0.245
NP_441453.1_1 Reverse -217 -235 5.03327 0.256
NP_441453.1_4 Reverse -200 -208 5.42762 0.135
NP_441453.1_4 Forward -209 -201 3.95266 0.275
NP_442151.1_6 Reverse -224 -238 6.78443 0.221
NP_441818.1_9 Reverse -293 -312 -1.7705 0.2
NP_441818.1_9 Forward -163 -144 -8.94866 0.285
NP_441818.1_9 Forward -233 -214 -10.3253 0.292
NP_442655.1_10 Forward -236 -217 -10.7186 0.221
NP_442173.1_1 Reverse -287 -295 5.72262 0.203
NP_442752.1_4 Forward -233 -226 10.8555 0.0846
NP_442909.1_7 Reverse -326 -340 6.19383 0.255
NP_440061.1_9 Reverse -198 -212 15.1419 0.0511
NP_442826.1_1 Forward -265 -246 9.63589 0.144
NP_441859.1_3 Reverse -199 -218 5.60352 0.196
NP_441859.1_3 Forward -234 -215 1.86696 0.272
NP_440304.1_4 Reverse -150 -160 3.32329 0.299
NP_442276.1_1 Forward -224 -205 12.88 0.238
NP_442110.1_7 Forward -215 -201 0.491246 0.259
NP_441925.1_4 Reverse -214 -233 -8.6544 0.211
NP_441083.1_5 Reverse -224 -234 7.94484 0.048
NP_441083.1_5 Reverse -200 -210 -0.511621 0.269
NP_442827.1_8 Forward -303 -284 -0.886293 0.236
NP_441558.1_5 Forward -235 -216 11.6025 0.0789
NP_441716.1_1 Forward -215 -201 9.14437 0.124
NP_441716.1_1 Reverse -200 -214 2.65453 0.298
NP_441163.1_1 Reverse -205 -222 11.7395 0.183
NP_440012.1_6 Forward -160 -141 9.63589 0.247
NP_440747.1_10 Forward -236 -224 -11.9574 0.178
NP_440747.1_10 Forward -212 -200 -12.4491 0.282
NP_441486.1_1 Reverse -289 -303 -0.983719 0.166
NP_441486.1_1 Forward -212 -198 -1.08205 0.167
NP_441486.1_1 Reverse -197 -211 -4.32697 0.194
NP_442848.1_5 Reverse -145 -163 2.57575 0.276
NP_441012.1_4 Reverse -148 -161 11.7207 0.252
NP_441012.1_4 Reverse -226 -239 8.57408 0.272
NP_441012.1_4 Reverse -97 -110 6.31247 0.282
NP_443018.1_3 Reverse -201 -208 10.6589 0.0967
NP_443018.1_3 Reverse -225 -232 10.4622 0.103
NP_443018.1_3 Forward -238 -231 9.38056 0.128
NP_443018.1_3 Forward -232 -225 4.36568 0.254
NP_443018.1_3 Forward -208 -201 4.16902 0.278
NP_441634.1_8 Forward -235 -221 4.32615 0.13
NP_440376.1_1 Reverse -310 -319 8.06287 0.0463
NP_440376.1_1 Forward -233 -224 2.75299 0.215
NP_440376.1_1 Reverse -105 -114 2.26134 0.228
NP_442485.1_3 Reverse -219 -238 -5.21209 0.287
NP_442485.1_3 Forward -226 -207 -6.1954 0.299
NP_441013.1_2 Reverse -94 -112 5.82068 0.208
NP_441013.1_2 Forward -244 -226 1.78911 0.242
NP_441013.1_2 Reverse -219 -237 -3.32411 0.29
NP_441029.1_3 Forward -238 -219 2.0644 0.277
NP_440533.1_9 Forward -233 -214 2.0644 0.289
NP_440887.1_8 Forward -155 -141 16.4209 0.263
NP_442720.1_8 Reverse -215 -233 13.8838 0.297
NP_442658.1_1 Forward -29 -19 7.45273 0.214
NP_442658.1_1 Reverse -211 -221 6.46942 0.229
NP_442300.1_5 Forward -151 -132 11.5042 0.282
NP_442937.1_5 Forward -154 -135 17.2074 0.0332
NP_442937.1_5 Forward -220 -201 5.80098 0.3
NP_441127.1_1 Forward -221 -207 11.8976 0.215
NP_441127.1_1 Forward -233 -219 8.84938 0.284
NP_442836.1_5 Forward -215 -196 9.3409 0.132
NP_440950.1_8 Reverse -327 -346 12.9205 0.156
NP_440203.1_5 Reverse -227 -237 17.6791 0.0611
NP_440203.1_5 Reverse -289 -299 10.6976 0.215
NP_439905.1_2 Reverse -219 -233 10.816 0.208
NP_440984.1_7 Reverse -217 -231 7.9644 0.16
NP_440153.1_8 Reverse -218 -231 -3.61896 0.296
NP_442064.1_4 Reverse -95 -114 7.37347 0.242
NP_442536.1_8 Forward -275 -256 12.0942 0.253
NP_443055.1_6 Reverse -216 -234 0.608397 0.241
NP_440993.1_2 Reverse -281 -297 1.43517 0.279
NP_440993.1_3 Reverse -214 -233 0.392004 0.255
NP_440827.1_3 Reverse -219 -238 20.944 0.101
NP_441099.1_5 Reverse -214 -233 0.392778 0.0795
NP_442002.1_1 Reverse -308 -326 -8.73231 0.27
NP_440411.1_10 Forward -163 -144 9.77373 0.281
NP_441646.1_1 Forward -216 -197 -0.0988766 0.259
NP_441646.1_7 Forward -221 -207 15.9292 0.234
NP_442431.1_10 Forward -233 -215 4.83737 0.206
NP_442431.1_10 Forward -163 -145 -0.570838 0.29
NP_440147.1_4 Forward -211 -198 2.57589 0.207
NP_441550.1_8 Forward -211 -201 5.87944 0.224
NP_441916.1_7 Reverse -152 -162 1.55333 0.282
NP_441916.1_10 Reverse -242 -261 0.982764 0.27
NP_441041.1_4 Forward -239 -220 -1.67217 0.102
NP_441041.1_4 Forward -233 -214 -5.01543 0.146
NP_441041.1_4 Forward -227 -208 -13.6686 0.293
NP_441725.1_5 Forward -208 -198 -1.00328 0.279
NP_441725.1_5 Reverse -225 -235 -1.10161 0.288
NP_441725.1_10 Reverse -219 -238 19.1113 0.145
NP_439966.1_7 Reverse -222 -232 13.5492 0.0263
NP_439966.1_7 Reverse -198 -208 5.09279 0.243
NP_442941.1_3 Forward -208 -198 0.373358 0.212
NP_442941.1_3 Reverse -225 -235 0.275027 0.222
NP_440289.1_2 Forward -218 -205 -3.32397 0.267
NP_440983.1_5 Reverse -140 -159 9.24257 0.151
NP_442281.1_1 Reverse -195 -209 8.55376 0.0798
NP_442281.1_1 Reverse -219 -233 3.8339 0.217
NP_441566.1_3 Forward -59 -40 16.4207 0.198
NP_442049.1_6 Forward -217 -198 14.0608 0.151
NP_441556.1_10 Forward -214 -200 11.1952 0.235
NP_441644.1_6 Reverse -224 -234 12.6642 0.0302
NP_441644.1_6 Reverse -296 -306 7.74772 0.117
NP_441644.1_6 Forward -239 -229 7.55106 0.123
NP_441644.1_6 Reverse -200 -210 5.97777 0.172
NP_441644.1_6 Forward -209 -199 3.61784 0.272
NP_443049.1_6 Forward -234 -224 14.8615 0.114
NP_443049.1_6 Reverse -324 -334 10.9578 0.292
NP_442215.1_2 Reverse -222 -238 1.43517 0.134
NP_442215.1_2 Reverse -191 -207 -4.26803 0.23
NP_442215.1_2 Forward -290 -274 -7.11963 0.286
NP_442177.1_5 Forward -230 -216 11.8976 0.22
NP_442177.1_5 Reverse -313 -327 10.1277 0.229
NP_440929.1_8 Forward -114 -105 2.06468 0.268
NP_442933.1_10 Reverse -200 -209 4.71961 0.22
NP_442933.1_10 Forward -215 -206 3.63797 0.293
NP_440430.1_4 Forward -243 -224 13.47 0.263
NP_441751.2_8 Forward -208 -194 -6.68692 0.277
NP_442926.1_1 Reverse -153 -172 -5.80207 0.278
NP_442926.1_3 Forward -232 -213 1.96607 0.296
NP_442554.1_8 Forward -208 -198 12.4681 0.0263
NP_442554.1_8 Reverse -225 -235 4.99491 0.163
NP_442554.1_8 Forward -232 -222 3.02829 0.245
NP_442075.1_1 Reverse -229 -248 5.30933 0.284
NP_441762.1_7 Forward -234 -222 -4.9759 0.185
NP_442142.1_4 Reverse -221 -234 9.06515 0.103
NP_442142.1_4 Reverse -227 -240 7.98351 0.125
NP_442142.1_4 Reverse -269 -282 4.93527 0.206
NP_442142.1_4 Forward -236 -223 3.85363 0.243
NP_442142.1_4 Reverse -197 -210 2.772 0.278
NP_442292.1_1 Forward -208 -199 5.80125 0.129
NP_442292.1_1 Reverse -225 -234 5.70292 0.135
NP_440158.1_8 Forward -163 -144 14.1591 0.202
NP_440379.1_5 Forward -224 -205 -9.83364 0.267
NP_440379.1_5 Forward -242 -223 -11.6036 0.299
NP_441468.1_1 Forward -232 -225 4.07068 0.263
NP_441468.1_1 Reverse -201 -208 3.97235 0.277
NP_441015.1_10 Forward -238 -219 -2.16383 0.178
NP_441015.1_10 Reverse -219 -238 -6.49039 0.249
NP_441731.1_7 Forward -289 -270 8.35759 0.193
NP_441172.1_1 Reverse -206 -224 4.54237 0.159
NP_441826.1_2 Forward -239 -225 3.8345 0.105
NP_441826.1_2 Reverse -200 -214 -4.62196 0.298
NP_441826.1_5 Reverse -207 -226 1.57275 0.289
NP_442811.1_2 Forward -235 -216 8.94757 0.138
NP_441056.1_1 Reverse -224 -243 -7.86702 0.279
NP_442227.1_2 Reverse -217 -236 4.62101 0.206
NP_442227.1_2 Reverse -214 -233 1.37609 0.246
NP_442808.1_1 Reverse -223 -233 16.8925 0.00954
NP_442808.1_1 Forward -320 -310 2.92952 0.252
NP_442808.1_1 Reverse -145 -155 2.43787 0.266
NP_442542.1_2 Forward -223 -210 6.60746 0.216
NP_442542.1_2 Reverse -222 -235 5.13249 0.281
NP_442342.1_9 Reverse -222 -238 3.00846 0.274
NP_442792.1_5 Forward -32 -15 10.5603 0.285
NP_441036.1_8 Forward -229 -219 9.51814 0.174
NP_441557.1_5 Reverse -200 -209 -0.885252 0.26
NP_441445.1_1 Reverse -316 -335 -0.590531 0.297
NP_441590.1_4 Reverse -226 -245 7.07848 0.251
NP_441433.1_8 Forward -160 -141 3.83436 0.197
NP_442419.1_2 Reverse -219 -238 -3.3438 0.259
NP_442419.1_2 Forward -238 -219 -5.01543 0.295
NP_442183.1_1 Forward -209 -195 4.91614 0.239
NP_442183.1_1 Reverse -206 -220 4.32615 0.266
NP_441116.1_5 Reverse -81 -100 13.3716 0.27
NP_441238.1_10 Forward -372 -358 12.8809 0.292
NP_442508.1_3 Forward -163 -144 15.9291 0.242
NP_442590.1_9 Forward -240 -221 4.916 0.273
NP_442998.1_5 Reverse -237 -247 9.61647 0.238
NP_442998.1_10 Reverse -288 -295 9.28223 0.117
NP_442998.1_10 Reverse -226 -233 6.13563 0.181
NP_442998.1_10 Forward -112 -105 4.07068 0.276
NP_440899.1_8 Forward -255 -236 -7.76869 0.246
NP_440299.1_1 Forward -213 -200 3.65697 0.237
NP_440640.1_6 Forward -239 -220 0.491109 0.272
NP_441007.1_10 Reverse -195 -208 -0.865694 0.295
NP_440087.1_1 Forward -233 -214 -7.96535 0.276
NP_440915.1_6 Forward -237 -223 1.57289 0.134
NP_441179.1_9 Reverse -144 -154 9.41933 0.28
NP_442069.1_8 Reverse -270 -289 5.99764 0.237
NP_442866.1_1 Reverse -219 -238 -4.03212 0.224
NP_440748.1_5 Reverse -215 -234 2.3594 0.223
NP_441464.1_10 Forward -82 -68 14.9459 0.166
NP_440026.1_4 Reverse -306 -325 9.93088 0.24
NP_440306.1_8 Forward -254 -235 -0.787962 0.222
NP_442386.1_9 Reverse -223 -232 12.389 0.0646
NP_442386.1_9 Forward -240 -231 9.34074 0.166
NP_442386.1_9 Reverse -199 -208 7.96411 0.213
NP_440570.1_5 Forward -165 -146 -2.55715 0.28
NP_441750.1_1 Forward -239 -220 -4.81876 0.204
NP_441750.1_4 Reverse -292 -311 9.14423 0.159
NP_441340.1_5 Forward -208 -201 11.3472 0.0526
NP_441340.1_5 Forward -232 -225 4.07068 0.239
NP_442484.1_2 Reverse -219 -238 8.94757 0.143
NP_442484.1_2 Forward -244 -225 -0.295539 0.26
NP_442506.1_2 Reverse -219 -238 1.96607 0.296
NP_441160.1_1 Reverse -144 -163 -10.227 0.254
NP_440586.1_1 Forward -231 -212 -0.688862 0.237
NP_440586.1_1 Forward -165 -146 -5.99873 0.292
NP_440586.1_8 Reverse -225 -232 7.61025 0.227
NP_440586.1_8 Reverse -201 -208 5.74197 0.283
NP_442959.1_6 Forward -227 -208 -0.000545616 0.297
NP_441262.1_3 Forward -233 -226 5.25066 0.215
NP_440027.1_3 Reverse -286 -304 6.01657 0.23
NP_439937.1_8 Forward -235 -216 4.22769 0.2
NP_439937.1_9 Reverse -211 -228 -11.5649 0.257
NP_442294.1_3 Forward -126 -112 14.7486 0.216
NP_442239.1_8 Forward -231 -212 5.89931 0.266
NP_439943.1_4 Reverse -12 -31 5.99764 0.275
NP_440372.1_2 Forward -232 -225 4.07068 0.262
NP_440271.1_2 Forward -242 -223 -0.590531 0.297
NP_440316.1_10 Reverse -316 -326 8.53483 0.239
NP_440316.1_10 Forward -234 -224 8.1415 0.24
NP_441803.1_2 Reverse -201 -220 -0.983855 0.293
NP_439977.1_5 Reverse -218 -237 15.8307 0.0531
NP_439977.1_5 Forward -338 -319 10.5209 0.0825
NP_441572.1_1 Forward -364 -345 4.916 0.126
NP_442384.1_10 Reverse -200 -213 8.67241 0.0625
NP_442384.1_10 Reverse -237 -250 3.5592 0.186
NP_442384.1_10 Forward -143 -130 2.67422 0.216
NP_440364.1_6 Forward -240 -227 13.9817 0.275
NP_442262.1_10 Reverse -201 -208 12.0355 0.062
NP_442262.1_10 Reverse -225 -232 10.6589 0.14
NP_442262.1_10 Forward -238 -231 9.47889 0.187
NP_442262.1_10 Reverse -287 -294 7.90559 0.266
NP_440163.1_10 Forward -236 -226 14.4347 0.102
NP_440344.1_10 Reverse -217 -234 -0.256152 0.0402
NP_440531.1_6 Reverse -192 -211 -5.21209 0.294
NP_440531.1_8 Reverse -369 -388 5.01433 0.269
NP_441335.1_8 Reverse -314 -333 14.3558 0.16
NP_442832.1_7 Forward -345 -326 20.354 0.182
NP_440562.1_10 Forward -336 -318 7.09898 0.284
NP_441640.1_8 Reverse -225 -244 -5.40875 0.286
NP_440297.1_9 Forward -208 -198 -0.118297 0.282
NP_440297.1_9 Reverse -225 -235 -0.216628 0.282
NP_440350.1_5 Forward -348 -329 9.43923 0.134
NP_440894.1_10 Forward -251 -232 4.12936 0.258
NP_440999.1_9 Reverse -220 -234 10.6193 0.0502
NP_440999.1_9 Forward -213 -199 -2.55701 0.27
NP_440888.1_2 Reverse -224 -238 14.0603 0.0211
NP_440888.1_2 Reverse -286 -300 9.83206 0.113
NP_440888.1_2 Reverse -212 -226 6.68548 0.223
NP_440052.1_8 Forward -154 -135 14.9458 0.101
NP_441748.1_3 Forward -151 -132 12.8065 0.247
NP_442033.1_10 Forward -221 -202 -9.34199 0.213
NP_441123.1_6 Forward -328 -310 9.85225 0.25
NP_441543.1_2 Forward -208 -199 5.3096 0.204
NP_441543.1_2 Reverse -225 -234 4.81794 0.219
NP_441543.1_2 Reverse -207 -216 4.0313 0.293
NP_442845.1_2 Forward -239 -225 7.57108 0.195
NP_442845.1_2 Forward -215 -201 6.29277 0.212
NP_442845.1_2 Reverse -224 -238 5.21113 0.24
NP_441918.1_10 Forward -238 -220 20.9636 0.0511
NP_441548.1_8 Forward -137 -119 23.0286 0.0207
NP_440220.1_4 Forward -252 -233 -3.24622 0.285
NP_441621.1_7 Forward -226 -212 1.37622 0.144
NP_441621.1_7 Reverse -222 -236 -4.91696 0.248
NP_440889.1_4 Forward -133 -114 6.39097 0.225
NP_440519.1_8 Forward -287 -271 10.3833 0.199
NP_440519.1_8 Forward -161 -145 1.33684 0.288
NP_442204.1_1 Forward -237 -226 10.6784 0.0697
NP_442204.1_6 Reverse -221 -240 14.8474 0.1
NP_441560.1_6 Reverse -219 -238 12.7825 0.241
NP_440516.1_8 Forward -233 -224 9.24284 0.0264
NP_440516.1_8 Reverse -325 -334 -0.590259 0.283
NP_442428.1_5 Forward -232 -225 4.46401 0.267
NP_442428.1_5 Reverse -201 -208 4.36568 0.271
NP_440673.1_2 Forward -171 -152 7.95079 0.286
NP_440673.1_3 Reverse -226 -233 11.6422 0.0724
NP_440673.1_3 Forward -159 -152 7.80726 0.244
NP_441052.1_2 Reverse -224 -234 7.64985 0.0672
NP_441052.1_2 Reverse -206 -216 3.91327 0.17
NP_440436.1_4 Forward -208 -199 4.7192 0.244
NP_440436.1_4 Reverse -225 -234 4.62087 0.248
NP_441884.1_9 Forward -218 -199 -21.7317 0.261
NP_441893.1_10 Reverse -154 -173 11.5042 0.24
NP_440222.1_2 Forward -239 -223 9.7933 0.212
NP_442414.1_10 Forward -220 -201 21.3364 0.0305
NP_441004.1_1 Forward -239 -220 -9.83364 0.212
NP_441004.1_4 Reverse -315 -325 8.33817 0.277
NP_442366.1_3 Forward -210 -192 -0.0791831 0.183
NP_440129.1_9 Forward -238 -219 6.29264 0.293
NP_440296.1_10 Reverse -307 -326 1.67108 0.209
NP_440094.1_9 Forward -216 -197 -4.13045 0.251
NP_441851.1_9 Forward -236 -217 7.47261 0.279
NP_441851.1_10 Reverse -199 -209 5.68323 0.203
NP_441396.1_5 Forward -232 -223 7.76787 0.239
NP_442843.1_1 Forward -379 -360 -10.6203 0.279
NP_439960.1_10 Forward -240 -222 2.37909 0.179
NP_440588.1_2 Forward -343 -324 2.26107 0.122
NP_441031.1_6 Forward -159 -140 1.17943 0.296
NP_442006.1_2 Forward -233 -216 -16.1858 0.243
NP_441078.1_4 Reverse -206 -215 -1.08191 0.222
NP_441078.1_4 Forward -233 -224 -2.06522 0.295
NP_442729.1_5 Forward -234 -224 15.3197 0.199
NP_442729.1_8 Reverse -319 -332 4.73917 0.282
NP_442348.1_2 Forward -282 -273 11.6028 0.232
NP_440526.1_3 Forward -208 -197 0.943182 0.267
NP_441432.1_8 Forward -234 -225 11.3078 0.0569
NP_441432.1_8 Forward -296 -287 5.40793 0.158
NP_441432.1_8 Reverse -199 -208 4.22796 0.235
NP_441432.1_9 Forward -391 -378 8.11358 0.294
NP_441732.1_2 Reverse -282 -298 -7.41462 0.0849
NP_441732.1_2 Reverse -202 -218 -17.346 0.253
NP_440497.1_2 Forward -238 -219 4.916 0.287
NP_440497.1_6 Forward -238 -219 5.89931 0.227
NP_442003.1_9 Reverse -310 -329 6.4893 0.235
NP_442003.1_9 Reverse -99 -118 5.50599 0.235
NP_440760.1_7 Reverse -31 -50 5.60352 0.211
NP_442797.1_6 Reverse -211 -230 10.0672 0.243
NP_442797.1_7 Reverse -211 -229 2.18243 0.245
NP_442797.1_10 Reverse -151 -165 20.6484 0.226
NP_440199.1_10 Reverse -203 -213 7.74818 0.231
NP_441945.1_10 Forward -162 -143 11.4058 0.238
NP_441945.1_10 Forward -288 -269 6.58763 0.299
NP_442353.1_4 Forward -307 -288 -0.197979 0.287
NP_442510.1_5 Reverse -221 -240 13.6675 0.224
NP_440713.1_4 Forward -305 -286 4.42435 0.23
NP_440713.1_4 Forward -238 -219 3.93269 0.234
NP_440713.1_4 Forward -243 -224 1.57275 0.284
NP_442489.1_7 Forward -215 -206 -1.47524 0.203
NP_442489.1_7 Forward -233 -224 -1.57357 0.213
NP_442489.1_7 Reverse -200 -209 -1.57357 0.213
NP_441452.1_1 Forward -316 -297 16.8141 0.144
NP_442079.1_7 Forward -232 -213 4.81767 0.187
NP_440559.1_1 Forward -208 -199 5.01461 0.161
NP_441659.2_8 Forward -209 -199 4.3066 0.139
NP_441659.2_8 Reverse -224 -234 3.42162 0.161
NP_442749.1_2 Reverse -95 -114 17.0107 0.192
NP_439956.1_7 Forward -301 -282 0.786102 0.296
NP_441800.1_3 Forward -238 -220 3.75572 0.289
NP_440779.1_5 Forward -209 -192 -15.0058 0.3
NP_442346.1_5 Reverse -151 -161 6.27322 0.208
NP_442346.1_5 Reverse -199 -209 5.5849 0.238
NP_442346.1_5 Reverse -133 -143 5.09324 0.262
NP_442346.1_5 Forward -210 -200 4.20827 0.296
NP_440545.1_3 Forward -237 -220 -5.76269 0.259
NP_440545.1_5 Reverse -312 -329 9.08529 0.21
NP_440545.1_5 Forward -237 -220 5.34871 0.238
NP_441629.1_3 Forward -326 -307 -3.44288 0.277
NP_441923.1_2 Reverse -363 -382 7.66927 0.299
NP_440459.1_2 Reverse -222 -239 10.4619 0.198
NP_440010.1_4 Reverse -214 -233 -0.39464 0.252
NP_442603.1_7 Reverse -224 -238 12.192 0.102
NP_440671.1_4 Forward -239 -225 17.0108 0.0246
NP_442045.1_5 Reverse -221 -240 6.58763 0.202
NP_442073.1_6 Reverse -215 -234 10.4225 0.193
NP_442140.1_3 Forward -232 -222 9.02648 0.115
NP_442140.1_3 Reverse -201 -211 6.96153 0.156
NP_441813.1_5 Reverse -198 -208 3.02829 0.178
NP_441490.1_1 Reverse -326 -345 13.2741 0.226
NP_440590.1_4 Reverse -287 -300 -5.38892 0.277
NP_440590.1_4 Reverse -201 -214 -5.88057 0.293
NP_440567.1_1 Forward -232 -218 2.06454 0.184
NP_441239.1_9 Reverse -222 -234 15.0836 0.0244
NP_441951.1_4 Reverse -224 -243 1.27776 0.286
NP_441727.1_3 Reverse -217 -236 8.65258 0.202
NP_441727.1_3 Forward -168 -149 5.211 0.256
NP_441892.1_1 Reverse -362 -379 -1.82945 0.214
NP_441017.1_6 Reverse -202 -216 13.9619 0.164
NP_442216.1_4 Forward -392 -384 8.1805 0.255
NP_440546.1_4 Forward -233 -223 13.4395 0.0494
NP_440546.1_4 Forward -209 -199 10.143 0.109
NP_440546.1_4 Reverse -230 -240 9.56122 0.131
NP_440546.1_4 Reverse -200 -210 8.49468 0.186
NP_440546.1_4 Forward -239 -229 7.13728 0.257
NP_440546.1_6 Reverse -355 -374 9.63589 0.247
NP_441230.1_5 Reverse -219 -238 6.19431 0.182
NP_440462.1_6 Reverse -222 -232 4.20827 0.213
NP_441582.1_9 Forward -247 -228 21.7297 0.0234
NP_441868.1_4 Reverse -127 -141 16.3225 0.258
NP_441811.1_8 Forward -149 -135 8.16106 0.238
NP_442625.1_6 Forward -49 -30 13.1758 0.199
NP_442679.1_1 Reverse -242 -261 -3.73712 0.262
NP_442679.1_1 Reverse -235 -254 -4.42544 0.278
NP_442679.1_1 Reverse -369 -388 -5.21209 0.29
NP_442053.1_1 Reverse -224 -233 4.62128 0.235
NP_440505.1_3 Forward -235 -225 5.68323 0.217
NP_442532.1_7 Forward -233 -219 5.60446 0.171
NP_440914.1_1 Reverse -296 -306 8.81029 0.186
NP_441011.1_8 Forward -232 -223 8.25953 0.144
NP_442533.1_1 Forward -236 -217 -14.3569 0.242
NP_442533.1_6 Reverse -200 -209 11.2095 0.046
NP_442533.1_6 Reverse -224 -233 4.71961 0.177
NP_442533.1_6 Forward -319 -310 4.62128 0.179
NP_441482.1_7 Forward -239 -225 -9.34185 0.198
NP_442293.1_4 Reverse -226 -244 15.2604 0.226
NP_442269.1_10 Forward -220 -201 6.78429 0.217
NP_441527.1_4 Reverse -242 -261 -11.2207 0.278
NP_440115.1_6 Forward -298 -288 6.66654 0.172
NP_440007.1_9 Forward -237 -223 8.55439 0.175
NP_440007.1_9 Reverse -196 -210 7.07942 0.213
NP_441602.1_3 Reverse -305 -324 -5.11376 0.278
NP_441972.1_5 Forward -232 -213 -3.83545 0.201
NP_441815.1_3 Reverse -324 -343 9.3409 0.257
NP_441286.1_1 Forward -234 -222 -5.36923 0.197
NP_441286.1_1 Reverse -205 -217 -7.04085 0.3
NP_441286.1_1 Forward -210 -198 -7.04085 0.3
NP_440886.1_7 Reverse -223 -233 16.2041 0.0142
NP_440886.1_7 Forward -108 -98 5.87944 0.158
NP_442072.1_3 Reverse -142 -160 17.7901 0.214
NP_440028.1_6 Forward -238 -220 9.95058 0.294
NP_441905.1_9 Forward -224 -205 10.8159 0.288
NP_441463.1_6 Forward -235 -221 8.34861 0.25
NP_442365.1_7 Forward -213 -194 -3.73712 0.222
NP_442794.1_1 Forward -237 -225 7.4138 0.138
NP_441962.1_4 Forward -214 -195 -11.6036 0.243
NP_441962.1_5 Reverse -219 -238 13.6675 0.124
NP_441431.1_2 Reverse -221 -235 6.0955 0.28
NP_441836.1_2 Forward -215 -196 -4.13045 0.254
NP_440634.1_10 Reverse -131 -150 8.75009 0.221
NP_441993.1_1 Forward -239 -220 1.36194 0.28
NP_442437.1_8 Forward -232 -213 5.211 0.256
NP_441510.2_7 Forward -239 -225 13.5686 0.28
NP_441510.2_7 Reverse -194 -208 10.717 0.28
NP_441510.2_7 Reverse -224 -238 9.24208 0.292
NP_440766.1_4 Forward -237 -223 11.8976 0.0591
NP_440766.1_4 Reverse -226 -240 1.76955 0.214
NP_439988.1_3 Forward -374 -360 7.57108 0.274
NP_440457.1_1 Forward -237 -225 8.00379 0.101
NP_442680.1_5 Reverse -370 -389 -0.220842 0.278
NP_440801.1_10 Forward -237 -218 11.6025 0.272
NP_442297.1_10 Reverse -349 -368 15.1424 0.183
NP_441332.1_6 Reverse -223 -233 15.6161 0.121
NP_442509.1_4 Reverse -218 -237 14.9458 0.237
NP_441885.1_5 Reverse -206 -216 0.766681 0.123
NP_441885.1_5 Reverse -200 -210 0.0783647 0.183
NP_441885.1_5 Forward -209 -199 -0.314959 0.195
NP_441885.1_5 Reverse -325 -335 -1.19994 0.255
NP_440628.1_2 Reverse -249 -268 22.5172 0.0498
NP_442703.1_9 Forward -59 -41 5.91901 0.244
NP_442341.1_7 Forward -216 -202 6.09611 0.135
NP_442341.1_7 Reverse -223 -237 5.99778 0.139
NP_442341.1_9 Reverse -222 -236 4.62054 0.296
NP_441756.1_5 Reverse -220 -239 -4.72043 0.295
NP_441173.1_9 Reverse -44 -52 10.2454 0.261
NP_442395.2_4 Reverse -280 -299 -0.00131823 0.28
NP_440423.1_6 Reverse -317 -336 -20.5517 0.261
NP_441842.1_1 Reverse -202 -215 11.5234 0.252
NP_440560.1_5 Forward -115 -96 15.7885 0.108
NP_440679.1_10 Forward -237 -218 -4.81876 0.16
NP_442451.1_2 Forward -388 -369 -9.44032 0.259
NP_441190.1_2 Reverse -348 -367 3.34271 0.192
NP_442495.1_5 Reverse -213 -232 12.8808 0.23
NP_440149.1_8 Reverse -224 -243 2.45773 0.11
NP_440149.1_8 Forward -239 -220 -8.16202 0.3
NP_441105.1_3 Forward -38 -19 -9.53865 0.29
NP_442373.1_2 Forward -230 -211 -11.3086 0.293
NP_442373.1_10 Reverse -218 -237 13.7658 0.125
NP_440216.1_6 Reverse -199 -215 6.35172 0.189
NP_440172.1_1 Reverse -200 -210 11.5831 0.0368
NP_440172.1_1 Forward -295 -285 4.99491 0.157
NP_440167.1_3 Forward -225 -206 10.5209 0.233
NP_441226.1_7 Forward -208 -201 12.4284 0.0404
NP_441226.1_7 Reverse -225 -232 11.2485 0.0971
NP_441226.1_7 Forward -318 -311 5.34865 0.289
NP_441177.1_7 Reverse -136 -155 9.63507 0.284
NP_441766.1_2 Reverse -224 -233 4.91628 0.154
NP_441766.1_2 Reverse -200 -209 4.62128 0.172
NP_442417.1_5 Reverse -224 -238 5.80112 0.249
NP_440416.1_9 Forward -312 -293 -20.945 0.289
NP_440416.1_9 Reverse -223 -242 -21.0434 0.29
NP_440416.1_9 Forward -240 -221 -21.1417 0.291
NP_443052.1_8 Reverse -315 -334 -11.8003 0.237
NP_443052.1_9 Reverse -220 -239 -6.88371 0.289
NP_443052.1_9 Reverse -271 -290 -7.17871 0.294
NP_440072.1_3 Forward -232 -213 19.764 0.24
NP_442154.1_1 Forward -232 -214 -6.56903 0.141
NP_442154.1_1 Forward -163 -145 -9.0273 0.175
NP_442154.1_1 Forward -280 -262 -15.7138 0.224
NP_442154.1_1 Forward -238 -220 -15.7138 0.224
NP_442154.1_6 Forward -222 -203 4.62101 0.234
NP_442564.1_6 Reverse -158 -177 11.0125 0.3
NP_440988.1_10 Forward -115 -101 10.6108 0.187
NP_440988.1_10 Reverse -198 -212 7.51277 0.216
NP_440988.1_10 Forward -235 -221 3.34982 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTAAAAACGAATTCCCCGCTTTTAATGGCTCCCTTTGGGGCCACTAGTGTTTTGATTTTTGGTGTTCCTGATAGCCCCTTAGCCCAACCCCGTAACGTCATCGGTGGCAATCTGTTAGCGGCATTGGTGAGTCTAACGGTTTTGCATTTTCTCGGTTCTTCACCCATGGCGATGGGGGCGGCAGTGTCGCTAGCCATCGGCATTATGCAATTTACTGGAACATTGCATCCTCCTTCAGGAGCCGTTGCTTTGGTGGTTATGATGACCAGACCAGACTGGAACTTTATCCTAACGCCAACCTTGGAAGGTTCAATACTTTTAGTGCTGTGTGCTGTAGTTTTCAATAATTTGGCGGAAGAAAGAACCTATCCTAAGCACTGGCTATAATTTTGTTTCGGTT

CDS

GTGGGATTGTTGAGGCGATCATCGTACCTGTCCAGTGATCAACGGCCATCTCAGCTGGGTTCCCATGCAGGGATCCCAGCGGTGCGGCTTAGAGTTAAAGCTTTAGGAGTCAAGATGGGAGTGCCGTTCTTCAAAATTCCAGATTTGGTTAAGCGACATAATATTCAGGTTTTTTCTTCCAATTACTGTTTGTACGGCGACTTATCCCACAGGATAATGACCAGCCTGCAATTATTTAGCCCCGTCGTGGAAATTTATTCCATTGATGAAGCCTTTCTCGAACTGACCCCAAATCAAAGTAATACGAATTATGGGGAAGAAATTCAGCTTTGTCTTAATCCATCAGATTAA

Protein

MGLLRRSSYLSSDQRPSQLGSHAGIPAVRLRVKALGVKMGVPFFKIPDLVKRHNIQVFSSNYCLYGDLSHRIMTSLQLFSPVVEIYSIDEAFLELTPNQSNTNYGEEIQLCLNPSD