Your browser is old and dusty. Try Google Chrome!

Details for slr0783

ORF slr0783
Accession NP_442075.1
Symbol tpi
Category CO2 fixation
Definition triosephosphate isomerase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -268 -254 3.93283 0.158
NP_441453.1_7 Reverse -358 -365 14.1988 0.175
NP_442151.1_6 Reverse -65 -79 8.75105 0.164
NP_440996.1_2 Forward -308 -299 14.8477 0.248
NP_441816.1_6 Forward -319 -307 14.1003 0.286
NP_442744.1_8 Forward -373 -354 2.45773 0.196
NP_442287.1_1 Reverse -37 -47 14.6309 0.256
NP_442752.1_4 Forward -319 -312 5.84064 0.166
NP_441812.1_3 Reverse -129 -143 7.9644 0.254
NP_441054.1_2 Reverse -265 -284 11.7992 0.257
NP_441054.1_2 Forward -48 -29 9.73422 0.284
NP_442074.1_2 Reverse -82 -100 20.9636 0.0881
NP_442074.1_3 Reverse -114 -127 19.4882 0.178
NP_442074.1_7 Reverse -10 -26 19.0364 0.248
NP_441035.1_3 Reverse -118 -137 -0.983855 0.298
NP_440853.1_5 Forward -77 -58 17.994 0.0907
NP_440916.1_1 Reverse -298 -312 8.35772 0.273
NP_439918.1_2 Reverse -170 -189 0.884433 0.217
NP_441352.1_2 Reverse -190 -209 0.982764 0.261
NP_441935.1_1 Reverse -354 -373 10.5209 0.211
NP_441935.1_9 Forward -33 -14 21.915 0.0647
NP_440307.1_2 Reverse -346 -365 2.45773 0.262
NP_440518.1_9 Forward -319 -300 8.45592 0.293
NP_441082.1_10 Forward -110 -97 9.06573 0.257
NP_442726.1_1 Forward -361 -342 14.7491 0.147
NP_441083.1_5 Reverse -336 -346 1.94665 0.197
NP_441738.1_2 Reverse -312 -319 8.20023 0.181
NP_441558.1_5 Forward -292 -273 4.03102 0.293
NP_442889.1_8 Forward -251 -237 10.3237 0.0864
NP_441713.1_1 Forward -351 -332 -8.26035 0.147
NP_442570.1_3 Forward -364 -345 5.211 0.159
NP_442570.1_3 Reverse -231 -250 -0.295539 0.208
NP_441387.1_2 Forward -73 -54 10.2259 0.282
NP_441486.1_1 Reverse -35 -49 0.0979218 0.145
NP_441486.1_1 Forward -216 -202 -6.29359 0.288
NP_440944.1_2 Forward -284 -265 -4.03212 0.296
NP_442634.1_4 Reverse -252 -266 -5.70361 0.271
NP_441012.1_4 Reverse -349 -362 9.75405 0.272
NP_441012.1_4 Forward -364 -351 8.47575 0.272
NP_441012.1_4 Reverse -61 -74 5.91914 0.286
NP_441634.1_8 Reverse -237 -251 -4.62196 0.295
NP_440376.1_1 Forward -47 -38 2.06468 0.236
NP_440376.1_1 Forward -362 -353 1.67135 0.243
NP_440376.1_1 Forward -48 -39 0.589713 0.267
NP_442687.1_7 Forward -320 -310 4.40493 0.249
NP_442485.1_3 Forward -196 -177 -2.26216 0.262
NP_442485.1_3 Reverse -264 -283 -3.14714 0.272
NP_440642.1_8 Reverse -222 -241 13.7055 0.234
NP_441013.1_3 Reverse -258 -277 11.0125 0.204
NP_441422.1_7 Reverse -95 -112 -9.3026 0.297
NP_441950.1_7 Forward -103 -84 0.982764 0.175
NP_440141.1_10 Reverse -302 -321 4.81688 0.173
NP_441971.1_5 Reverse -347 -366 17.0107 0.105
NP_442782.1_2 Reverse -270 -284 12.291 0.173
NP_442782.1_2 Forward -284 -270 8.35772 0.198
NP_441127.1_1 Reverse -182 -196 10.521 0.244
NP_440203.1_5 Forward -266 -256 9.02601 0.275
NP_440984.1_7 Forward -76 -62 6.09611 0.227
NP_440153.1_6 Forward -75 -56 11.9958 0.222
NP_440153.1_8 Forward -279 -266 -2.144 0.235
NP_440858.1_1 Reverse -181 -200 -1.57384 0.257
NP_442064.1_4 Reverse -229 -248 8.84842 0.224
NP_440934.1_1 Reverse -246 -265 5.99764 0.235
NP_442002.1_9 Reverse -203 -210 11.4455 0.185
NP_441294.1_4 Reverse -238 -257 12.8808 0.214
NP_441646.1_1 Reverse -269 -288 -0.197208 0.259
NP_441646.1_7 Reverse -60 -74 13.9626 0.257
NP_442431.1_10 Reverse -248 -266 11.0322 0.105
NP_441550.1_8 Forward -347 -337 5.38779 0.252
NP_441916.1_7 Forward -362 -352 5.68323 0.124
NP_440206.1_4 Forward -283 -264 -2.36125 0.295
NP_440260.1_8 Reverse -230 -248 31.0917 0.0000621
NP_442847.1_3 Reverse -271 -290 4.42355 0.281
NP_440437.1_1 Reverse -56 -75 -3.73712 0.244
NP_442012.1_1 Forward -77 -58 -0.000545616 0.249
NP_441556.1_4 Forward -260 -241 15.2111 0.16
NP_441556.1_7 Forward -279 -260 -1.18128 0.3
NP_442215.1_2 Forward -375 -359 18.8398 0.0113
NP_442215.1_2 Reverse -36 -52 -6.33298 0.268
NP_442177.1_5 Forward -108 -94 13.1759 0.22
NP_442029.1_1 Reverse -258 -277 -10.4236 0.219
NP_442029.1_6 Reverse -254 -273 5.80098 0.248
NP_442075.1_3 Forward -228 -209 13.2741 0.295
NP_442075.1_4 Forward -274 -255 23.1072 0.0358
NP_442313.1_5 Reverse -234 -253 7.86593 0.211
NP_442142.1_4 Forward -194 -181 5.23026 0.197
NP_443009.1_5 Reverse -352 -363 5.76138 0.189
NP_442301.1_2 Forward -270 -251 14.2566 0.117
NP_440183.1_9 Forward -364 -345 -18.8801 0.276
NP_440379.1_5 Reverse -230 -249 -8.85033 0.256
NP_441015.1_8 Forward -239 -220 1.0811 0.272
NP_441015.1_10 Forward -331 -312 -1.7705 0.176
NP_441015.1_10 Reverse -348 -367 -8.35868 0.273
NP_442253.1_5 Forward -251 -234 -4.38605 0.292
NP_440265.1_8 Forward -265 -247 19.3903 0.101
NP_441826.1_5 Forward -365 -346 6.78429 0.222
NP_442811.1_2 Reverse -258 -277 -2.65548 0.281
NP_442868.1_6 Forward -73 -63 5.38824 0.149
NP_442719.1_2 Reverse -300 -318 -0.178247 0.162
NP_442719.1_2 Reverse -301 -319 -2.63651 0.191
NP_441251.1_5 Forward -117 -98 12.6841 0.289
NP_440785.1_1 Reverse -202 -221 4.32602 0.149
NP_442227.1_2 Forward -267 -248 4.12936 0.208
NP_442808.1_1 Reverse -95 -105 1.65123 0.282
NP_442050.1_1 Forward -330 -311 9.3409 0.247
NP_442903.1_2 Reverse -83 -102 5.0129 0.199
NP_440601.1_7 Reverse -244 -258 20.0591 0.147
NP_440558.1_2 Forward -288 -269 -5.01543 0.251
NP_440558.1_2 Forward -272 -253 -6.29373 0.273
NP_442789.1_4 Forward -98 -79 -8.45701 0.299
NP_440274.1_4 Forward -338 -320 2.67408 0.221
NP_441878.1_6 Forward -48 -38 -7.19813 0.21
NP_441445.1_1 Forward -354 -335 -0.688862 0.3
NP_442397.1_9 Forward -363 -344 9.53756 0.246
NP_440356.1_4 Forward -222 -203 4.03102 0.203
NP_440058.1_7 Reverse -249 -268 7.57094 0.247
NP_442347.1_2 Reverse -330 -339 2.94966 0.292
NP_442645.1_2 Forward -287 -268 -17.9951 0.267
NP_442590.1_10 Reverse -227 -246 20.059 0.0978
NP_442590.1_10 Forward -369 -350 7.96426 0.216
NP_442998.1_5 Reverse -190 -200 10.2065 0.222
NP_440731.1_9 Forward -287 -268 9.83255 0.296
NP_442201.1_2 Forward -33 -14 20.352 0.135
NP_441957.1_1 Forward -250 -231 11.9958 0.15
NP_441090.1_6 Reverse -357 -371 12.4876 0.159
NP_441559.1_8 Forward -367 -353 -1.96703 0.188
NP_441559.1_8 Reverse -305 -319 -4.03198 0.215
NP_441559.1_8 Reverse -229 -243 -5.70361 0.27
NP_440915.1_6 Forward -366 -352 3.93283 0.1
NP_440717.1_2 Forward -278 -259 -11.2103 0.282
NP_442866.1_1 Reverse -228 -247 -8.06369 0.275
NP_440748.1_5 Forward -266 -247 1.86774 0.224
NP_441464.1_10 Forward -107 -93 10.0294 0.262
NP_440677.1_1 Reverse -53 -72 7.27595 0.241
NP_442386.1_9 Reverse -37 -46 6.29249 0.226
NP_442386.1_9 Reverse -129 -138 4.62087 0.294
NP_441750.1_1 Reverse -245 -264 -5.50708 0.213
NP_441750.1_4 Forward -366 -347 2.3594 0.26
NP_442791.1_5 Forward -364 -345 -6.49039 0.279
NP_440327.1_6 Forward -59 -40 9.73422 0.206
NP_440327.1_6 Forward -110 -91 2.94938 0.285
NP_440327.1_6 Reverse -248 -267 2.55606 0.294
NP_440586.1_2 Forward -254 -235 13.4708 0.239
NP_440586.1_8 Reverse -205 -212 8.98688 0.188
NP_439996.1_6 Reverse -244 -263 7.71894 0.257
NP_439937.1_8 Forward -262 -243 2.65439 0.215
NP_439937.1_9 Reverse -84 -101 -11.7615 0.264
NP_441740.2_10 Reverse -233 -252 16.8141 0.111
NP_442374.1_3 Forward -277 -260 12.6252 0.269
NP_439943.1_1 Forward -212 -193 -10.1286 0.29
NP_442783.1_6 Reverse -261 -280 16.9124 0.201
NP_441789.1_7 Forward -277 -258 -5.50783 0.298
NP_440316.1_10 Reverse -181 -191 5.87989 0.277
NP_442549.1_8 Reverse -278 -297 12.9791 0.0967
NP_442384.1_10 Reverse -310 -323 4.14919 0.167
NP_441018.1_7 Reverse -256 -275 6.29264 0.294
NP_440344.1_10 Reverse -55 -72 -11.4659 0.215
NP_440282.1_10 Forward -149 -130 -8.55534 0.263
NP_442917.1_2 Reverse -258 -277 4.81767 0.224
NP_442910.1_6 Reverse -240 -254 7.9644 0.24
NP_440487.1_1 Reverse -317 -336 2.0644 0.192
NP_440487.1_1 Forward -335 -316 -7.67036 0.296
NP_441965.1_10 Reverse -127 -143 10.5799 0.107
NP_442693.1_6 Reverse -96 -115 -0.983855 0.297
NP_440350.1_5 Forward -177 -158 -5.31042 0.289
NP_442280.1_10 Reverse -271 -289 4.87002 0.292
NP_440894.1_10 Reverse -222 -241 2.94938 0.279
NP_440888.1_2 Reverse -275 -289 7.3738 0.198
NP_440060.1_2 Reverse -252 -271 18.8781 0.169
NP_442818.1_3 Forward -45 -28 -4.38605 0.243
NP_440208.1_1 Forward -276 -257 -9.63698 0.257
NP_441551.1_5 Reverse -126 -142 6.35103 0.273
NP_441918.1_7 Forward -227 -208 -0.688862 0.297
NP_442315.1_2 Forward -103 -91 9.47875 0.291
NP_443064.1_6 Reverse -310 -320 8.59164 0.278
NP_442337.1_8 Reverse -259 -278 -0.787193 0.278
NP_442204.1_5 Forward -329 -310 -0.000545616 0.274
NP_440255.1_7 Forward -316 -299 6.62702 0.299
NP_442428.1_4 Reverse -275 -294 1.86774 0.278
NP_441353.1_7 Forward -288 -270 16.2429 0.242
NP_441443.1_7 Forward -338 -319 -1.86883 0.268
NP_442120.1_10 Reverse -270 -289 -15.5368 0.294
NP_440603.1_3 Forward -254 -235 9.73422 0.265
NP_440603.1_3 Forward -136 -117 6.19431 0.265
NP_441052.1_2 Reverse -65 -75 2.14332 0.216
NP_440592.1_8 Forward -251 -232 10.4225 0.294
NP_441884.1_9 Forward -338 -319 -24.3866 0.286
NP_442414.1_8 Forward -196 -177 15.7324 0.0855
NP_441004.1_1 Forward -324 -305 -17.9951 0.296
NP_442206.1_7 Reverse -258 -277 8.55425 0.295
NP_440328.1_4 Forward -325 -306 -0.885524 0.292
NP_441851.1_10 Forward -320 -310 5.09324 0.227
NP_441851.1_10 Forward -48 -38 4.99491 0.233
NP_440682.1_2 Forward -262 -243 -6.98204 0.0859
NP_442001.1_4 Reverse -375 -394 9.24175 0.288
NP_441501.1_9 Reverse -240 -259 20.4514 0.122
NP_440593.1_9 Reverse -236 -250 12.3893 0.24
NP_441982.1_6 Reverse -187 -196 13.0583 0.274
NP_440463.1_8 Reverse -274 -293 6.0477 0.271
NP_442843.1_1 Forward -46 -27 -11.0136 0.285
NP_442843.1_6 Forward -45 -26 3.6377 0.29
NP_442006.1_2 Reverse -317 -334 -17.5624 0.279
NP_441570.1_1 Reverse -254 -272 -2.73412 0.0673
NP_441570.1_1 Forward -362 -344 -12.2722 0.211
NP_442348.1_2 Forward -357 -348 7.07956 0.291
NP_442443.1_1 Reverse -330 -349 -4.52377 0.272
NP_441432.1_8 Reverse -259 -268 2.65466 0.292
NP_441732.1_2 Reverse -58 -74 -16.3627 0.165
NP_442797.1_1 Reverse -318 -337 2.0644 0.212
NP_442353.1_4 Reverse -56 -75 -0.689632 0.29
NP_441706.1_10 Reverse -263 -282 7.07928 0.296
NP_442008.1_2 Reverse -243 -262 5.80098 0.223
NP_442346.1_5 Forward -75 -65 4.3066 0.291
NP_442346.1_10 Reverse -237 -256 -2.75381 0.294
NP_440545.1_5 Reverse -277 -294 4.07041 0.269
NP_440459.1_2 Reverse -261 -278 8.98696 0.243
NP_440010.1_4 Reverse -316 -335 7.07848 0.197
NP_440010.1_4 Forward -264 -245 4.22689 0.22
NP_442828.1_7 Forward -321 -302 10.4225 0.202
NP_441888.1_9 Forward -47 -28 14.7509 0.267
NP_441050.1_5 Reverse -256 -274 -1.25915 0.262
NP_441779.1_10 Forward -370 -358 19.0169 0.289
NP_441358.1_2 Forward -325 -306 17.3057 0.13
NP_440751.1_3 Reverse -308 -327 10.3234 0.264
NP_442060.1_10 Forward -374 -355 10.4225 0.244
NP_441915.1_4 Reverse -223 -242 6.1935 0.293
NP_442140.1_3 Forward -138 -128 4.99491 0.232
NP_442140.1_3 Reverse -252 -262 4.89658 0.238
NP_440227.1_2 Forward -301 -285 8.90832 0.29
NP_441239.1_9 Reverse -128 -140 10.7571 0.0723
NP_441239.1_9 Reverse -345 -357 2.98891 0.3
NP_441892.1_1 Reverse -344 -361 -0.452814 0.185
NP_441508.1_4 Reverse -190 -204 15.4813 0.244
NP_441017.1_6 Reverse -146 -160 12.3887 0.221
NP_440900.1_4 Reverse -240 -259 16.3346 0.271
NP_440949.1_5 Forward -244 -225 17.6007 0.221
NP_441617.1_6 Forward -105 -86 -7.4737 0.292
NP_442138.1_10 Reverse -254 -273 -6.39206 0.284
NP_442611.1_1 Reverse -246 -265 0.392778 0.259
NP_440868.1_4 Forward -163 -151 2.49725 0.153
NP_440401.1_9 Reverse -93 -100 12.6251 0.287
NP_440401.1_9 Reverse -42 -49 12.6251 0.287
NP_442402.1_4 Reverse -304 -323 -4.42619 0.225
NP_441848.1_7 Reverse -30 -49 -4.32786 0.289
NP_441084.1_6 Forward -141 -127 13.6102 0.125
NP_441084.1_6 Reverse -195 -209 10.9924 0.225
NP_440696.1_3 Forward -366 -348 0.314141 0.233
NP_440696.1_3 Reverse -260 -278 -3.32411 0.285
NP_440825.1_7 Forward -212 -202 11.2506 0.258
NP_442696.1_6 Forward -273 -254 -12.4886 0.252
NP_440160.1_2 Forward -285 -266 -1.18052 0.235
NP_440505.1_3 Forward -50 -40 9.91146 0.122
NP_441701.1_3 Reverse -250 -267 8.59364 0.247
NP_441203.1_1 Forward -372 -353 -18.8801 0.297
NP_442533.1_6 Reverse -353 -362 12.0944 0.0325
NP_442533.1_6 Reverse -65 -74 2.458 0.255
NP_442322.1_4 Reverse -345 -362 -1.63347 0.226
NP_441028.1_6 Forward -196 -186 7.74772 0.218
NP_441527.1_5 Forward -321 -302 14.1533 0.287
NP_440007.1_9 Forward -282 -268 12.7826 0.163
NP_441680.1_4 Forward -324 -305 0.392778 0.246
NP_441602.1_3 Reverse -271 -290 2.3594 0.199
NP_441972.1_5 Forward -372 -353 -5.11376 0.215
NP_440429.1_9 Reverse -224 -243 2.65439 0.278
NP_001035870.1_3 Forward -170 -151 1.47442 0.163
NP_001035870.1_3 Forward -110 -91 -4.6221 0.278
NP_442306.1_10 Forward -273 -254 -6.1954 0.11
NP_442306.1_10 Forward -144 -125 -20.8467 0.231
NP_440828.1_4 Forward -264 -245 -4.52452 0.246
NP_441784.1_5 Forward -261 -242 7.17762 0.152
NP_442072.1_9 Forward -99 -81 -23.2853 0.288
NP_440666.1_3 Reverse -212 -231 8.94757 0.286
NP_441463.1_3 Forward -383 -364 -4.42544 0.205
NP_441463.1_3 Forward -258 -239 -5.31042 0.225
NP_441463.1_3 Reverse -265 -284 -7.08038 0.254
NP_441463.1_3 Reverse -120 -139 -10.522 0.296
NP_441836.1_2 Forward -275 -256 -0.885524 0.215
NP_441836.1_2 Reverse -257 -276 -6.1954 0.292
NP_441193.1_1 Reverse -84 -103 9.63507 0.277
NP_441174.1_2 Forward -142 -128 14.6509 0.156
NP_442698.1_10 Reverse -16 -35 -1.27885 0.297
NP_442323.1_7 Reverse -97 -116 3.63691 0.238
NP_440293.1_9 Reverse -234 -248 18.6884 0.0938
NP_440766.1_4 Forward -110 -96 2.85119 0.167
NP_442743.1_1 Reverse -307 -326 9.24175 0.262
NP_441133.1_3 Forward -287 -268 12.4875 0.289
NP_441801.1_6 Reverse -36 -55 15.0432 0.137
NP_440942.1_4 Reverse -337 -356 16.0265 0.0751
NP_442130.1_8 Forward -279 -260 5.80018 0.269
NP_442703.1_9 Reverse -373 -391 9.45892 0.244
NP_442341.1_9 Forward -257 -243 6.0955 0.243
NP_442395.2_4 Reverse -335 -354 4.62021 0.18
NP_440275.1_3 Forward -73 -63 4.0116 0.205
NP_441307.1_4 Reverse -261 -280 0.58944 0.246
NP_443046.1_9 Reverse -154 -172 14.3747 0.116
NP_443046.1_9 Reverse -82 -100 1.5917 0.295
NP_440679.1_10 Reverse -244 -263 -14.5535 0.24
NP_440175.1_7 Reverse -250 -268 11.5101 0.23
NP_442495.1_2 Reverse -266 -285 10.1275 0.266
NP_440149.1_8 Reverse -347 -366 -0.787193 0.154
NP_442214.1_1 Forward -117 -98 11.6025 0.226
NP_442015.1_10 Forward -323 -310 3.65753 0.178
NP_442015.1_10 Reverse -58 -71 -1.06236 0.293
NP_441226.1_7 Reverse -354 -361 8.59356 0.197
NP_441226.1_7 Reverse -39 -46 8.29857 0.205
NP_440416.1_9 Reverse -346 -365 -10.6203 0.143
NP_443052.1_9 Forward -270 -251 1.37609 0.185
NP_443052.1_9 Reverse -315 -334 -0.983855 0.219
NP_443052.1_9 Forward -261 -242 -6.68705 0.287
NP_443052.1_9 Forward -258 -239 -6.88371 0.289
NP_442154.1_1 Reverse -231 -249 -10.3056 0.205
NP_442154.1_1 Reverse -252 -270 -15.3205 0.218
NP_442154.1_1 Reverse -240 -258 -15.6155 0.222
NP_440988.1_10 Forward -280 -266 5.86695 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGTCATTGTTGTTAAGCCAGTAAATTTGTGCTTGCCCAGGGACGGCCTTGTCGGGCTTATCGGGGTCCACTGTGACCGTGGGGGAACGTTGGGAAAGATTAAATCCAGTCCAGAAGGCAAAGCCGGTGCCAACCAATGCCACCATCAGAGCGGCCAGAGCAAAGCCGGTCAGGGACGAAGATGATTTTTGTTCGCTCATGATTTTTTCCACCAGTGCCGGAACTAATTCCAGTTTATCTTCTCGATTGGACTAGATTGAAAGCCAGGGCGGCATTAATTCGGCTTCAAGCAGTTGAGTTTGGGGGTTAGTTCCTCGTTGGTTAATGGTGACGACCCCGGACGACGTAAACTGGGGGTTGGCAAATTTTGTTGTGACCTTCATCGTTAAAGATTGGAATC

CDS

GTGCGAAAAATCATTATTGCGGGCAATTGGAAAATGCATAAGACGCAGGCGGAGGCCCAAGCGTTTTTGCAGGGGTTTAAACCTTTAATCGAAGATGCGGCGGAAAGTCGTGAGGTGGTGTTGTGTGTTCCTTTCACCGATTTGAGCGGCATGTCCCAACAACTCCATGGCGGTAGGGTCCGCCTAGGGGCACAAAATGTCCATTGGGAAGCGAGTGGGGCCTACACAGGGGAAATTTCAGCGGCTATGTTGACGGAAATCGGTATTCATTATGTGGTTATCGGCCACAGTGAACGACGGCAATATTTTGGGGAAACGGACGAAACTGCCAATTTGAGAGTATTGGCGGCCCAAAAGGCGGGCTTAATTCCCATTCTGTGTGTGGGGGAAAGTAAGGCGCAACGGGATGCCGGAGAAACGGAACAGGTTATCGTTGACCAAGTGAAAAAAGGCTTGGTGAATGTGGATCAATCTAACCTAGTCATCGCCTACGAGCCGATTTGGGCCATTGGTACAGGGGACACCTGTGCGGCAACGGAAGCCAATCGGGTTATTGGGCTGATTCGGGAACAGTTAACTAATTCCCAGGTCACCATCCAGTATGGCGGTTCGGTCAATGCCAACAATGTGGATGAAATTATGGCCCAACCGGAAATTGATGGAGCCTTGGTGGGAGGAGCTAGTCTGGAACCCCAGAGCTTTGCCCGCATTGTTAATTTTCAGCCCTGA

Protein

MRKIIIAGNWKMHKTQAEAQAFLQGFKPLIEDAAESREVVLCVPFTDLSGMSQQLHGGRVRLGAQNVHWEASGAYTGEISAAMLTEIGIHYVVIGHSERRQYFGETDETANLRVLAAQKAGLIPILCVGESKAQRDAGETEQVIVDQVKKGLVNVDQSNLVIAYEPIWAIGTGDTCAATEANRVIGLIREQLTNSQVTIQYGGSVNANNVDEIMAQPEIDGALVGGASLEPQSFARIVNFQP