Your browser is old and dusty. Try Google Chrome!

Details for slr0780

ORF slr0780
Accession NP_442064.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -356 -342 1.27789 0.192
NP_440557.1_1 Forward -192 -173 0.294447 0.265
NP_440795.1_7 Forward -192 -185 14.6904 0.0123
NP_440795.1_7 Reverse -185 -192 14.6904 0.0123
NP_441418.1_6 Forward -220 -201 -21.4367 0.149
NP_442291.1_5 Forward -194 -178 0.0585348 0.174
NP_440897.1_6 Reverse -106 -125 2.6536 0.164
NP_441453.1_4 Reverse -184 -192 16.539 0.00633
NP_441453.1_4 Forward -193 -185 7.8859 0.0536
NP_442151.1_6 Reverse -184 -198 12.3893 0.0749
NP_442151.1_6 Forward -193 -179 9.83269 0.139
NP_441818.1_1 Forward -192 -181 9.59626 0.232
NP_441721.1_1 Forward -180 -161 6.88262 0.181
NP_442173.1_1 Forward -192 -184 15.4574 0.00633
NP_442173.1_1 Reverse -185 -193 14.1791 0.0165
NP_442752.1_4 Reverse -184 -191 13.8055 0.0199
NP_443027.1_4 Reverse -182 -192 16.2046 0.0437
NP_443027.1_4 Forward -195 -185 6.07655 0.294
NP_441812.1_3 Forward -194 -180 11.701 0.21
NP_442975.1_10 Reverse -180 -194 9.83206 0.0626
NP_442975.1_10 Reverse -296 -310 4.32555 0.245
NP_440784.1_7 Forward -192 -185 15.9687 0.0123
NP_440784.1_7 Reverse -185 -192 15.9687 0.0123
NP_440061.1_9 Forward -181 -167 7.57046 0.202
NP_440110.1_4 Reverse -173 -192 15.2408 0.0777
NP_440110.1_8 Forward -195 -176 -2.26216 0.265
NP_442062.1_3 Forward -269 -250 -2.0655 0.265
NP_442062.1_4 Reverse -206 -225 20.354 0.0687
NP_442062.1_8 Reverse -184 -194 16.6963 0.00399
NP_442062.1_10 Reverse -292 -311 21.2389 0.0316
NP_441900.1_2 Reverse -213 -231 -0.571569 0.27
NP_440304.1_4 Reverse -182 -192 19.9412 0.00364
NP_442242.1_4 Forward -192 -185 14.3954 0.0124
NP_442242.1_4 Reverse -185 -192 14.3954 0.0124
NP_440044.1_8 Forward -192 -173 18.7807 0.0159
NP_441208.1_9 Forward -196 -182 6.3911 0.246
NP_441208.1_9 Forward -129 -115 5.70279 0.262
NP_441594.1_6 Reverse -208 -227 5.60432 0.209
NP_442110.1_7 Forward -193 -179 3.24451 0.213
NP_441925.1_5 Forward -138 -124 17.1092 0.109
NP_441083.1_5 Reverse -184 -194 10.5998 0.0192
NP_441083.1_5 Forward -193 -183 1.94665 0.197
NP_441434.1_1 Forward -161 -147 15.9588 0.186
NP_441434.1_1 Reverse -257 -271 7.07802 0.288
NP_441738.1_2 Forward -191 -184 15.28 0.0102
NP_441738.1_2 Reverse -186 -193 11.5435 0.084
NP_441738.1_2 Reverse -295 -302 6.72528 0.236
NP_440209.1_1 Reverse -184 -192 18.1123 0.00295
NP_440209.1_1 Forward -193 -185 8.47588 0.0457
NP_442889.1_1 Forward -226 -207 -3.3438 0.145
NP_442889.1_8 Reverse -181 -195 19.2718 0.0084
NP_440447.1_1 Reverse -179 -197 8.57394 0.194
NP_441713.1_1 Forward -199 -180 5.40766 0.0568
NP_441713.1_1 Reverse -159 -178 -15.0452 0.26
NP_441770.1_1 Reverse -204 -223 10.7167 0.279
NP_442570.1_3 Forward -222 -203 -7.37537 0.27
NP_441716.1_1 Forward -226 -212 5.89945 0.211
NP_441716.1_1 Forward -214 -200 5.50613 0.227
NP_442111.1_4 Forward -194 -180 9.34103 0.0609
NP_441387.1_8 Reverse -256 -275 17.9043 0.175
NP_440343.1_3 Forward -186 -168 3.8533 0.266
NP_440906.1_5 Forward -192 -185 15.8704 0.0124
NP_440906.1_5 Reverse -185 -192 15.8704 0.0124
NP_440438.2_8 Forward -269 -250 0.687771 0.289
NP_440747.1_10 Forward -196 -184 14.887 0.00223
NP_440747.1_10 Reverse -181 -193 -11.6624 0.131
NP_440747.1_10 Forward -223 -211 -12.4491 0.282
NP_441486.1_1 Reverse -181 -195 6.58777 0.0344
NP_441486.1_1 Forward -196 -182 1.96621 0.0939
NP_442634.1_4 Reverse -182 -196 -1.77037 0.149
NP_441014.1_10 Forward -221 -202 -2.36125 0.274
NP_441014.1_10 Forward -215 -196 -3.04956 0.292
NP_442848.1_1 Reverse -178 -192 -4.22864 0.282
NP_442848.1_4 Forward -340 -326 20.2558 0.0858
NP_441012.1_4 Reverse -207 -220 12.0157 0.249
NP_441012.1_4 Reverse -213 -226 10.639 0.262
NP_443018.1_3 Forward -192 -185 14.8871 0.0123
NP_443018.1_3 Reverse -185 -192 14.8871 0.0123
NP_441316.1_7 Reverse -182 -197 12.8613 0.0486
NP_441634.1_9 Forward -71 -52 8.16011 0.294
NP_440376.1_1 Reverse -184 -193 9.73449 0.0365
NP_440376.1_1 Forward -193 -184 9.63616 0.0385
NP_440376.1_1 Forward -309 -300 -0.68859 0.291
NP_441857.1_5 Forward -200 -182 3.26407 0.246
NP_441588.1_4 Forward -191 -181 6.66654 0.185
NP_442730.1_8 Forward -222 -203 4.32522 0.273
NP_442730.1_8 Forward -201 -182 4.12856 0.273
NP_442687.1_7 Reverse -51 -61 6.07655 0.179
NP_442687.1_7 Reverse -210 -220 5.87989 0.183
NP_442191.1_4 Forward -192 -178 11.5748 0.252
NP_442485.1_3 Reverse -200 -219 -1.08219 0.255
NP_440642.1_10 Reverse -296 -310 2.06395 0.284
NP_441422.1_2 Reverse -290 -309 11.5033 0.173
NP_442658.1_1 Reverse -182 -192 13.0576 0.04
NP_442658.1_1 Forward -195 -185 4.89613 0.292
NP_440662.1_1 Reverse -89 -108 7.17762 0.287
NP_440656.1_8 Reverse -173 -192 1.86774 0.123
NP_441414.1_9 Reverse -184 -203 14.0608 0.013
NP_441256.1_1 Reverse -202 -221 -6.49039 0.239
NP_441958.1_5 Reverse -183 -193 12.0747 0.00222
NP_441958.1_5 Forward -194 -184 2.43831 0.0422
NP_440203.1_5 Forward -177 -167 9.321 0.263
NP_439905.1_1 Reverse -212 -225 16.7355 0.0578
NP_440995.1_8 Forward -203 -184 3.83436 0.264
NP_440984.1_7 Forward -225 -211 5.89945 0.235
NP_440984.1_7 Forward -184 -170 5.21113 0.265
NP_439990.1_5 Forward -198 -185 15.5556 0.0534
NP_442690.1_1 Forward -247 -228 -12.5869 0.245
NP_442690.1_1 Forward -275 -256 -15.7335 0.28
NP_442911.1_2 Forward -203 -184 -0.39387 0.0747
NP_440153.1_5 Forward -192 -178 2.94952 0.219
NP_442064.1_1 Forward -198 -179 35.4969 0.00000451
NP_442064.1_2 Forward -249 -230 34.8086 0.0000106
NP_442064.1_3 Forward -177 -158 31.1704 0.0000137
NP_442064.1_4 Forward -224 -205 22.713 0.021
NP_442064.1_4 Forward -230 -211 7.86512 0.237
NP_442064.1_4 Forward -197 -178 5.30853 0.271
NP_442064.1_10 Forward -275 -256 21.8289 0.047
NP_441294.1_7 Reverse -180 -194 14.242 0.0448
NP_441646.1_1 Forward -33 -14 5.01433 0.184
NP_442438.1_10 Reverse -179 -193 0.392915 0.229
NP_442431.1_7 Forward -152 -133 5.89931 0.273
NP_441000.1_6 Forward -194 -180 -3.83532 0.225
NP_440484.1_3 Reverse -182 -196 10.7177 0.242
NP_440147.1_4 Forward -195 -182 1.29759 0.233
NP_441550.1_8 Reverse -182 -192 13.0576 0.0273
NP_441550.1_8 Forward -195 -185 11.3859 0.0503
NP_441916.1_7 Forward -193 -183 10.6981 0.0261
NP_441916.1_7 Reverse -184 -194 0.963343 0.297
NP_440465.1_4 Forward -194 -175 15.4374 0.184
NP_441041.1_4 Reverse -184 -203 1.57275 0.0804
NP_441041.1_7 Forward -196 -184 6.73736 0.195
NP_442996.1_1 Reverse -255 -274 9.97848 0.21
NP_441547.1_2 Reverse -173 -191 4.34571 0.249
NP_442004.1_6 Forward -180 -166 11.8976 0.115
NP_441725.1_5 Forward -192 -182 11.1898 0.0247
NP_441725.1_5 Reverse -185 -195 0.766681 0.149
NP_441725.1_5 Forward -219 -209 -0.511621 0.26
NP_439966.1_7 Reverse -182 -192 14.8275 0.0177
NP_439966.1_7 Forward -195 -185 4.69947 0.263
NP_442941.1_3 Forward -192 -182 19.9412 0.00262
NP_442941.1_3 Reverse -185 -195 1.65166 0.147
NP_440289.1_1 Reverse -124 -141 17.7671 0.229
NP_440289.1_2 Reverse -181 -194 4.14919 0.0706
NP_440289.1_2 Reverse -58 -71 -3.61896 0.267
NP_440260.1_8 Forward -347 -329 1.69077 0.183
NP_441514.1_6 Forward -303 -296 12.8221 0.252
NP_442281.1_1 Reverse -179 -193 6.98048 0.111
NP_442281.1_1 Reverse -206 -220 3.73557 0.221
NP_441334.1_7 Forward -195 -176 -12.2919 0.146
NP_441079.1_7 Reverse -255 -274 15.3382 0.0554
NP_440437.1_1 Reverse -178 -197 0.0977854 0.172
NP_441556.1_4 Reverse -202 -221 17.2356 0.113
NP_441556.1_10 Forward -198 -184 15.3807 0.145
NP_441644.1_6 Reverse -184 -194 14.9258 0.00847
NP_441644.1_6 Forward -193 -183 9.71433 0.0705
NP_441644.1_6 Reverse -211 -221 9.616 0.0728
NP_441644.1_6 Forward -220 -210 3.42118 0.282
NP_442215.1_2 Forward -195 -179 10.8749 0.0448
NP_440929.1_8 Forward -193 -184 17.4043 0.00289
NP_440929.1_8 Reverse -184 -193 17.4043 0.00289
NP_442933.1_10 Reverse -184 -193 9.04618 0.063
NP_442933.1_10 Forward -193 -184 8.94785 0.0643
NP_440891.1_8 Reverse -105 -124 14.1715 0.268
NP_441751.2_8 Forward -192 -178 6.3911 0.0354
NP_441751.2_8 Reverse -185 -199 -4.91696 0.187
NP_442554.1_8 Forward -192 -182 16.9913 0.0065
NP_442554.1_8 Reverse -185 -195 11.9764 0.0312
NP_442554.1_8 Reverse -212 -222 4.50326 0.184
NP_442554.1_8 Forward -219 -209 2.92996 0.249
NP_441762.1_7 Reverse -183 -195 -6.84419 0.284
NP_442142.1_4 Forward -196 -183 5.82024 0.182
NP_442142.1_4 Reverse -181 -194 4.44361 0.222
NP_442142.1_4 Reverse -208 -221 2.67367 0.281
NP_442292.1_1 Reverse -185 -194 17.896 0.00435
NP_442292.1_1 Forward -192 -183 17.5026 0.00435
NP_442476.1_6 Reverse -185 -199 2.85119 0.171
NP_442476.1_6 Forward -179 -165 0.589577 0.252
NP_440895.1_6 Forward -199 -186 11.9173 0.202
NP_443009.1_5 Reverse -183 -194 9.10461 0.0965
NP_443009.1_5 Forward -194 -183 4.77807 0.23
NP_443009.1_5 Reverse -169 -180 3.8931 0.274
NP_441715.1_4 Forward -192 -182 14.238 0.0295
NP_440881.1_4 Reverse -107 -126 -0.688862 0.265
NP_440279.1_2 Forward -225 -206 4.52268 0.298
NP_440730.1_4 Reverse -106 -125 5.30933 0.237
NP_441448.1_1 Forward -231 -212 4.52268 0.278
NP_441198.1_8 Reverse -182 -192 13.2713 0.108
NP_441468.1_1 Forward -192 -185 15.8704 0.0124
NP_441468.1_1 Reverse -185 -192 15.8704 0.0124
NP_441618.1_7 Forward -192 -173 14.7658 0.295
NP_441015.1_10 Reverse -166 -185 -10.0303 0.282
NP_441673.1_1 Reverse -184 -193 11.1111 0.0121
NP_441673.1_1 Forward -193 -184 11.0128 0.018
NP_441826.1_2 Forward -220 -206 9.34103 0.0612
NP_441826.1_2 Reverse -178 -192 5.30946 0.0977
NP_441393.1_5 Forward -138 -119 12.8808 0.287
NP_442490.1_9 Reverse -172 -191 -7.08038 0.275
NP_442868.1_6 Reverse -182 -192 1.06167 0.205
NP_442868.1_6 Forward -195 -185 0.865012 0.205
NP_442719.1_2 Forward -95 -77 -2.14486 0.184
NP_441612.1_2 Reverse -117 -127 6.80666 0.277
NP_442361.1_3 Reverse -178 -191 9.85238 0.272
NP_441911.1_10 Forward -165 -146 8.75181 0.25
NP_442808.1_1 Forward -181 -171 2.63453 0.26
NP_441101.1_10 Forward -218 -199 -5.99873 0.287
NP_442542.1_9 Reverse -177 -191 10.1271 0.121
NP_442050.1_5 Reverse -182 -192 18.0724 0.00365
NP_442050.1_5 Forward -195 -185 7.0594 0.27
NP_442903.1_2 Reverse -250 -269 15.899 0.093
NP_441114.1_3 Forward -361 -352 8.65285 0.231
NP_440558.1_2 Forward -223 -204 -0.4922 0.203
NP_441518.1_3 Reverse -174 -193 -10.4236 0.244
NP_441878.1_6 Reverse -210 -220 10.4031 0.0176
NP_441878.1_6 Reverse -183 -193 0.766681 0.134
NP_441878.1_6 Forward -221 -211 0.668351 0.139
NP_441878.1_6 Forward -194 -184 0.57002 0.14
NP_441036.1_8 Forward -194 -184 7.35486 0.201
NP_441036.1_8 Reverse -183 -193 6.07655 0.242
NP_442650.1_2 Reverse -184 -198 8.06273 0.13
NP_441557.1_5 Forward -193 -184 17.4043 0.0023
NP_441557.1_5 Reverse -184 -193 10.8161 0.00464
NP_441445.1_1 Reverse -202 -221 2.3594 0.235
NP_441445.1_8 Forward -75 -56 -12.8819 0.299
NP_441433.1_8 Forward -313 -294 5.30933 0.178
NP_441308.1_8 Reverse -182 -192 13.353 0.218
NP_441407.1_6 Forward -97 -78 2.85105 0.285
NP_441549.1_9 Forward -197 -179 -4.70074 0.198
NP_441549.1_9 Forward -224 -206 -6.27403 0.198
NP_441638.1_1 Reverse -163 -182 9.83255 0.232
NP_442347.1_2 Reverse -185 -194 10.1278 0.0622
NP_442347.1_2 Forward -192 -183 3.34298 0.284
NP_442645.1_2 Reverse -169 -188 -15.5368 0.203
NP_441037.1_4 Forward -28 -18 7.51261 0.237
NP_441037.1_4 Reverse -182 -192 7.31769 0.237
NP_441037.1_4 Forward -195 -185 6.92787 0.237
NP_442594.1_8 Forward -309 -290 6.09597 0.236
NP_440151.1_5 Forward -350 -331 4.81767 0.262
NP_441633.1_3 Forward -195 -182 2.77255 0.0865
NP_441633.1_3 Forward -181 -168 -6.76555 0.271
NP_440136.1_2 Forward -192 -185 15.9687 0.0123
NP_440136.1_2 Reverse -185 -192 15.9687 0.0123
NP_442590.1_10 Forward -226 -207 6.78429 0.237
NP_442998.1_10 Forward -191 -184 15.5754 0.0102
NP_442998.1_10 Reverse -186 -193 5.84064 0.235
NP_440899.1_2 Reverse -173 -192 9.53674 0.176
NP_440299.1_1 Forward -197 -184 11.1301 0.0518
NP_441799.1_1 Reverse -180 -194 10.422 0.0747
NP_441799.1_1 Forward -197 -183 9.6354 0.0879
NP_441007.1_10 Reverse -179 -192 2.77255 0.183
NP_441007.1_10 Forward -198 -185 0.707601 0.219
NP_440256.1_1 Forward -196 -177 15.6341 0.00669
NP_440256.1_1 Forward -217 -198 -6.88371 0.223
NP_441090.1_4 Reverse -254 -272 17.5743 0.151
NP_441559.1_8 Reverse -165 -179 -6.49025 0.279
NP_442069.1_6 Reverse -205 -224 3.83436 0.3
NP_442031.1_3 Forward -88 -69 21.8289 0.029
NP_440537.1_7 Forward -280 -261 11.0289 0.263
NP_441939.1_3 Forward -37 -18 11.5042 0.112
NP_441939.1_3 Forward -192 -173 5.80098 0.263
NP_442386.1_9 Forward -194 -185 12.5856 0.058
NP_442386.1_9 Forward -181 -172 9.43907 0.161
NP_442386.1_9 Reverse -183 -192 6.39082 0.219
NP_441750.1_4 Forward -197 -178 8.25926 0.159
NP_441340.1_5 Forward -192 -185 15.6737 0.0124
NP_441340.1_5 Reverse -185 -192 15.6737 0.0124
NP_442327.1_3 Reverse -254 -273 9.97848 0.203
NP_440586.1_8 Forward -192 -185 13.2151 0.026
NP_440586.1_8 Reverse -185 -192 13.2151 0.026
NP_440586.1_8 Reverse -212 -219 5.8403 0.283
NP_442874.1_5 Reverse -213 -232 9.53756 0.292
NP_442251.1_6 Forward -192 -185 15.2804 0.0124
NP_442251.1_6 Reverse -185 -192 15.2804 0.0124
NP_442959.1_5 Forward -276 -257 10.2259 0.224
NP_441262.1_3 Forward -193 -186 14.8871 0.0223
NP_441262.1_3 Reverse -184 -191 14.7888 0.0223
NP_443051.1_1 Reverse -183 -192 19.5676 0.00335
NP_443051.1_1 Forward -194 -185 8.35786 0.0371
NP_440408.1_7 Reverse -199 -218 12.6841 0.205
NP_440372.1_2 Forward -192 -185 16.3621 0.0124
NP_440372.1_2 Reverse -185 -192 16.3621 0.0124
NP_441789.1_7 Reverse -306 -325 -5.50783 0.298
NP_440819.1_5 Reverse -129 -137 7.98423 0.228
NP_439977.1_5 Forward -199 -180 1.17943 0.195
NP_440139.1_1 Reverse -178 -197 6.1935 0.143
NP_441572.1_7 Reverse -178 -197 0.982764 0.157
NP_440267.1_2 Reverse -179 -193 7.07881 0.21
NP_442666.1_4 Reverse -212 -231 16.7939 0.275
NP_442384.1_10 Reverse -184 -197 5.82081 0.118
NP_442384.1_10 Forward -226 -213 2.77255 0.213
NP_441018.1_7 Forward -224 -205 10.6192 0.201
NP_441018.1_7 Forward -124 -105 8.75091 0.241
NP_441018.1_7 Forward -230 -211 8.06259 0.256
NP_441018.1_7 Forward -197 -178 7.47261 0.269
NP_442262.1_10 Forward -192 -185 14.1988 0.0123
NP_442262.1_10 Reverse -185 -192 14.1988 0.0123
NP_441689.1_5 Reverse -182 -192 17.8758 0.0158
NP_440344.1_10 Reverse -204 -221 -3.50107 0.0833
NP_440344.1_10 Reverse -177 -194 -9.49926 0.147
NP_440344.1_10 Reverse -164 -181 -13.9242 0.298
NP_440282.1_10 Reverse -201 -220 -0.0988766 0.205
NP_440531.1_6 Reverse -176 -195 2.85105 0.15
NP_442917.1_1 Reverse -250 -269 18.1898 0.03
NP_440487.1_7 Forward -185 -166 11.5042 0.141
NP_441965.1_3 Reverse -161 -180 -1.86883 0.297
NP_441965.1_10 Reverse -181 -197 11.5633 0.107
NP_442556.1_10 Forward -137 -118 8.35335 0.294
NP_440297.1_9 Forward -219 -209 9.32148 0.0917
NP_440297.1_9 Forward -192 -182 9.22315 0.0917
NP_440297.1_9 Reverse -185 -195 0.176696 0.282
NP_440350.1_5 Forward -137 -118 -5.99873 0.296
NP_441592.1_4 Reverse -211 -230 5.30933 0.135
NP_440999.1_9 Forward -197 -183 -3.63866 0.299
NP_440888.1_2 Forward -193 -179 8.94708 0.142
NP_440600.1_4 Forward -201 -183 -1.06249 0.162
NP_440575.1_1 Forward -22 -3 -0.591301 0.29
NP_441543.1_2 Forward -192 -183 15.9293 0.00518
NP_441543.1_2 Reverse -185 -194 7.37455 0.127
NP_442845.1_2 Reverse -178 -192 5.99778 0.219
NP_442845.1_2 Forward -199 -185 4.71948 0.254
NP_441551.1_5 Forward -197 -181 6.35103 0.273
NP_441918.1_7 Forward -215 -196 -2.55715 0.297
NP_440982.1_1 Reverse -300 -319 4.03023 0.294
NP_442710.1_7 Reverse -256 -275 2.86879 0.147
NP_441469.1_8 Forward -194 -185 6.8829 0.227
NP_441469.1_8 Reverse -183 -192 6.5879 0.227
NP_442578.1_7 Forward -192 -185 14.5921 0.026
NP_442578.1_7 Reverse -185 -192 14.5921 0.026
NP_440710.1_1 Reverse -176 -194 -1.25915 0.179
NP_440071.1_6 Forward -312 -298 15.841 0.235
NP_441462.1_2 Forward -193 -183 10.4031 0.011
NP_441462.1_2 Reverse -184 -194 2.7333 0.0792
NP_443062.1_1 Reverse -184 -202 13.9088 0.0553
NP_442204.1_1 Reverse -180 -191 0.157002 0.283
NP_441560.1_8 Forward -198 -179 13.0709 0.232
NP_440516.1_2 Forward -199 -181 -1.16082 0.276
NP_440516.1_8 Reverse -184 -193 9.53783 0.0136
NP_440516.1_8 Forward -193 -184 7.07956 0.0867
NP_442428.1_5 Forward -192 -185 15.8704 0.0124
NP_442428.1_5 Reverse -185 -192 15.8704 0.0124
NP_441443.1_10 Forward -218 -200 1.78836 0.275
NP_440673.1_2 Reverse -201 -220 17.0231 0.0543
NP_440673.1_3 Forward -191 -184 12.4288 0.0426
NP_440673.1_3 Reverse -186 -193 5.34899 0.298
NP_441052.1_2 Reverse -184 -194 10.2065 0.0295
NP_441052.1_2 Reverse -211 -221 4.10993 0.166
NP_441052.1_2 Reverse -217 -227 2.14332 0.216
NP_441052.1_2 Forward -226 -216 1.94665 0.221
NP_441052.1_2 Forward -193 -183 1.84832 0.225
NP_442219.1_9 Reverse -185 -194 10.2261 0.0547
NP_442219.1_9 Forward -192 -183 8.25953 0.0681
NP_442219.1_9 Reverse -172 -181 2.94966 0.21
NP_440436.1_4 Forward -192 -183 9.24241 0.0871
NP_440436.1_4 Reverse -185 -194 8.06244 0.118
NP_442907.1_7 Forward -338 -319 16.5191 0.192
NP_441719.1_4 Forward -192 -185 16.3621 0.0124
NP_441719.1_4 Reverse -185 -192 16.3621 0.0124
NP_442813.1_4 Forward -195 -176 -1.37718 0.239
NP_442813.1_4 Forward -134 -115 -5.50708 0.299
NP_442139.1_7 Forward -231 -212 10.1275 0.22
NP_440296.1_10 Reverse -167 -186 -13.7669 0.269
NP_441115.1_4 Reverse -183 -201 11.4247 0.14
NP_442694.1_4 Forward -142 -133 11.4061 0.277
NP_442206.1_10 Reverse -184 -199 13.1562 0.0799
NP_442854.1_6 Reverse -205 -224 2.65439 0.272
NP_441851.1_10 Forward -194 -184 14.238 0.0196
NP_441851.1_10 Reverse -183 -193 8.33817 0.118
NP_441396.1_5 Reverse -161 -170 7.37455 0.279
NP_440593.1_3 Forward -185 -166 -4.81876 0.253
NP_440593.1_9 Forward -217 -203 7.9644 0.267
NP_442709.1_4 Forward -275 -256 8.26883 0.161
NP_441349.1_10 Forward -203 -184 0.491109 0.0886
NP_441349.1_10 Reverse -174 -193 -1.57384 0.105
NP_441409.1_6 Forward -199 -180 3.24438 0.0501
NP_440432.1_9 Forward -192 -177 7.25639 0.0427
NP_440474.1_8 Forward -192 -178 13.7653 0.0695
NP_440431.1_3 Reverse -183 -202 -3.54046 0.178
NP_442450.1_5 Reverse -182 -192 9.41981 0.115
NP_442168.1_5 Reverse -185 -204 -2.26216 0.264
NP_440588.1_2 Forward -340 -321 -5.50708 0.252
NP_440588.1_2 Forward -229 -210 -5.9004 0.264
NP_440588.1_2 Forward -202 -183 -6.58872 0.285
NP_440040.1_3 Reverse -113 -123 17.3846 0.25
NP_443047.1_7 Forward -192 -173 18.4857 0.0485
NP_441570.1_1 Forward -193 -175 -0.275845 0.0447
NP_441570.1_1 Reverse -184 -202 -14.8288 0.227
NP_440078.1_10 Reverse -184 -203 1.76941 0.297
NP_441078.1_4 Reverse -184 -193 9.93116 0.0203
NP_441078.1_4 Forward -193 -184 9.83282 0.0226
NP_441078.1_4 Forward -220 -211 -1.6719 0.266
NP_441078.1_4 Reverse -211 -220 -1.77023 0.266
NP_442729.1_5 Reverse -210 -220 8.4365 0.248
NP_440539.1_9 Forward -378 -359 -7.27704 0.298
NP_442348.1_2 Forward -143 -134 12.2911 0.218
NP_440526.1_3 Reverse -185 -196 6.44969 0.201
NP_440526.1_3 Forward -192 -181 1.82816 0.267
NP_441432.1_8 Reverse -183 -192 16.8143 0.00595
NP_441432.1_8 Forward -194 -185 6.98123 0.112
NP_441432.1_9 Reverse -148 -161 8.11358 0.294
NP_442320.1_8 Reverse -178 -192 -4.4253 0.168
NP_441732.1_2 Reverse -180 -196 -16.6577 0.186
NP_442003.1_4 Reverse -185 -204 9.53756 0.3
NP_440199.1_10 Reverse -181 -191 14.238 0.0861
NP_440199.1_10 Reverse -208 -218 6.56821 0.296
NP_440913.1_1 Forward -222 -204 13.8838 0.131
NP_442489.1_7 Reverse -184 -193 10.4228 0.0151
NP_442489.1_7 Forward -193 -184 10.3245 0.0193
NP_442489.1_7 Forward -220 -211 -1.47524 0.203
NP_442489.1_7 Reverse -211 -220 -1.77023 0.247
NP_440757.1_7 Reverse -163 -181 1.78911 0.269
NP_442079.1_7 Reverse -185 -204 5.80098 0.168
NP_440559.1_1 Reverse -185 -194 16.5193 0.00851
NP_440559.1_1 Forward -192 -183 8.65285 0.0586
NP_441659.2_8 Reverse -184 -194 14.828 0.00801
NP_441659.2_8 Forward -193 -183 11.3864 0.0184
NP_441659.2_8 Reverse -211 -221 3.02829 0.177
NP_440779.1_5 Forward -193 -176 -5.86102 0.152
NP_442346.1_5 Reverse -183 -193 15.0247 0.00889
NP_442346.1_5 Reverse -210 -220 14.6313 0.0115
NP_442346.1_5 Forward -194 -184 7.25653 0.176
NP_442346.1_5 Forward -221 -211 4.99491 0.267
NP_440545.1_3 Forward -197 -180 -0.944468 0.161
NP_441856.1_3 Reverse -181 -200 -0.197208 0.216
NP_440486.1_6 Reverse -171 -190 7.66927 0.261
NP_440459.1_2 Reverse -202 -219 7.41366 0.291
NP_441943.1_8 Reverse -123 -142 -6.29373 0.261
NP_442551.1_4 Forward -365 -350 -2.38005 0.259
NP_440034.1_3 Reverse -8 -27 18.3915 0.206
NP_441833.1_4 Forward -192 -185 15.9687 0.0124
NP_441833.1_4 Reverse -185 -192 15.9687 0.0124
NP_442436.1_6 Forward -238 -219 13.1758 0.0356
NP_441112.1_6 Reverse -174 -193 -2.95047 0.296
NP_442162.1_9 Forward -192 -185 16.2637 0.0124
NP_442162.1_9 Reverse -185 -192 16.2637 0.0124
NP_440671.1_4 Reverse -178 -192 5.80112 0.271
NP_440224.1_1 Reverse -173 -192 0.982764 0.132
NP_442943.1_1 Reverse -258 -273 8.27363 0.194
NP_442140.1_3 Reverse -185 -195 13.2547 0.0609
NP_442140.1_3 Reverse -212 -222 4.0116 0.265
NP_440875.1_9 Forward -191 -181 7.59334 0.255
NP_441813.1_5 Reverse -182 -192 15.9097 0.01
NP_441813.1_5 Forward -195 -185 7.84651 0.0573
NP_441490.1_2 Forward -105 -93 19.5079 0.195
NP_440590.1_4 Forward -192 -179 -5.78224 0.289
NP_440567.1_1 Forward -192 -178 15.8309 0.0166
NP_442497.1_10 Forward -192 -183 17.601 0.00813
NP_442497.1_10 Reverse -185 -194 8.55452 0.0294
NP_440821.1_4 Reverse -182 -192 11.0914 0.0146
NP_440821.1_4 Forward -195 -185 8.82982 0.0395
NP_440227.1_6 Reverse -256 -270 16.8182 0.212
NP_441239.1_9 Reverse -182 -194 8.00379 0.145
NP_441239.1_9 Forward -195 -183 3.38223 0.285
NP_441009.1_4 Reverse -184 -203 12.9791 0.219
NP_441727.1_3 Forward -200 -181 2.65439 0.299
NP_441892.1_1 Reverse -202 -219 2.98877 0.133
NP_440604.1_6 Forward -193 -174 -5.80207 0.287
NP_442193.1_1 Reverse -151 -169 9.85225 0.233
NP_441017.1_6 Reverse -207 -221 15.5352 0.102
NP_440833.1_6 Reverse -236 -250 6.88214 0.296
NP_440949.1_7 Reverse -197 -216 18.7798 0.108
NP_442138.1_6 Reverse -118 -136 19.9803 0.189
NP_442041.1_2 Forward -338 -320 8.96727 0.283
NP_440462.1_6 Reverse -182 -192 16.893 0.00853
NP_440868.1_4 Forward -197 -185 7.11881 0.0756
NP_440868.1_4 Reverse -180 -192 6.23383 0.0878
NP_441497.1_3 Forward -170 -151 -11.5053 0.294
NP_442479.1_5 Forward -272 -253 9.21106 0.222
NP_441084.1_6 Reverse -209 -223 9.53803 0.278
NP_439942.1_2 Forward -166 -147 14.3465 0.228
NP_440696.1_3 Forward -72 -54 -2.73412 0.279
NP_440696.1_6 Forward -225 -206 5.50599 0.275
NP_442023.1_2 Reverse -203 -222 5.99764 0.279
NP_442039.1_4 Forward -192 -185 15.1821 0.0124
NP_442039.1_4 Reverse -185 -192 15.1821 0.0124
NP_440825.1_7 Reverse -185 -195 16.1302 0.152
NP_442837.1_3 Forward -192 -185 15.7721 0.0124
NP_442837.1_3 Reverse -185 -192 15.7721 0.0124
NP_442053.1_1 Reverse -184 -193 9.34117 0.0666
NP_442053.1_1 Forward -193 -184 8.84951 0.072
NP_440505.1_3 Reverse -182 -192 15.123 0.014
NP_441536.1_8 Reverse -89 -108 16.0274 0.266
NP_441203.1_1 Forward -192 -173 -2.95047 0.0655
NP_441203.1_2 Forward -314 -295 -3.83545 0.209
NP_440914.1_1 Reverse -184 -194 15.3489 0.00527
NP_440914.1_1 Forward -193 -183 7.24882 0.242
NP_441011.1_8 Forward -192 -183 16.6177 0.00602
NP_442533.1_6 Reverse -184 -193 7.86621 0.0862
NP_442533.1_6 Forward -193 -184 7.37455 0.0898
NP_442533.1_6 Forward -220 -211 6.98123 0.0992
NP_442533.1_6 Reverse -211 -220 6.68623 0.105
NP_442533.1_6 Reverse -217 -226 2.458 0.255
NP_442541.1_10 Reverse -211 -225 4.52221 0.252
NP_440263.1_5 Forward -136 -122 7.57108 0.294
NP_441482.1_7 Reverse -23 -37 -4.7203 0.156
NP_441482.1_7 Reverse -178 -192 -10.9151 0.222
NP_439944.1_9 Forward -192 -182 17.6796 0.00347
NP_439944.1_9 Reverse -185 -195 8.23984 0.114
NP_441697.1_5 Forward -274 -255 -9.02441 0.268
NP_441028.1_6 Forward -91 -81 10.1076 0.21
NP_441527.1_4 Reverse -121 -140 -12.2711 0.285
NP_441527.1_5 Reverse -182 -201 12.0176 0.297
NP_440007.1_9 Reverse -180 -194 18.4858 0.15
NP_441602.1_3 Forward -225 -206 0.196116 0.219
NP_441106.1_1 Reverse -183 -192 18.486 0.0028
NP_440429.1_4 Reverse -177 -196 10.4225 0.299
NP_441286.1_1 Forward -194 -182 13.117 0.00815
NP_441286.1_1 Forward -221 -209 -5.36923 0.197
NP_441286.1_1 Reverse -183 -195 -5.66422 0.213
NP_442674.1_3 Forward -222 -203 5.60352 0.264
NP_440670.1_8 Reverse -184 -193 16.3227 0.00291
NP_440670.1_8 Forward -193 -184 15.1427 0.00768
NP_442881.1_1 Reverse -252 -271 12.29 0.198
NP_442908.1_1 Forward -198 -179 0.884433 0.277
NP_442463.1_3 Forward -226 -207 15.8307 0.194
NP_440886.1_7 Reverse -299 -309 3.8145 0.265
NP_442614.1_2 Reverse -184 -198 19.6658 0.0419
NP_442614.1_2 Reverse -211 -225 6.09611 0.293
NP_442382.1_9 Reverse -141 -160 8.16011 0.286
NP_442072.1_2 Forward -112 -96 21.8872 0.146
NP_442072.1_9 Forward -194 -176 -21.5153 0.209
NP_442401.1_2 Forward -187 -168 6.78348 0.282
NP_440907.2_8 Forward -192 -182 9.51767 0.103
NP_440907.2_8 Forward -179 -169 6.0761 0.179
NP_440907.2_8 Reverse -185 -195 5.78111 0.188
NP_442264.1_2 Forward -224 -207 13.5102 0.144
NP_440326.1_5 Forward -195 -182 13.9823 0.229
NP_440666.1_3 Reverse -293 -312 14.2574 0.107
NP_441463.1_3 Forward -203 -184 -1.27885 0.138
NP_441626.1_2 Forward -192 -185 15.7721 0.0124
NP_441626.1_2 Reverse -185 -192 15.7721 0.0124
NP_442365.1_7 Forward -218 -199 -2.26216 0.199
NP_442794.1_1 Forward -197 -185 10.8554 0.0721
NP_442615.1_1 Reverse -175 -193 -2.14413 0.139
NP_442615.1_1 Forward -202 -184 -3.81576 0.17
NP_441962.1_4 Reverse -348 -367 -12.1936 0.253
NP_441836.1_2 Forward -226 -207 -3.24547 0.236
NP_440114.1_10 Forward -193 -179 9.63603 0.168
NP_440935.1_4 Forward -95 -77 16.7346 0.22
NP_441237.1_9 Reverse -185 -195 14.3364 0.0399
NP_442743.1_4 Forward -192 -173 9.53756 0.0547
NP_442743.1_5 Forward -192 -173 2.65439 0.293
NP_440457.1_1 Reverse -180 -192 9.67541 0.092
NP_440798.1_6 Forward -192 -179 3.46087 0.151
NP_440801.1_9 Forward -122 -108 13.611 0.27
NP_441984.1_3 Forward -224 -206 8.86894 0.218
NP_441332.1_4 Reverse -254 -273 7.66927 0.234
NP_442509.1_9 Forward -180 -170 10.9926 0.15
NP_442582.1_6 Reverse -250 -269 20.4416 0.0365
NP_441496.1_1 Forward -268 -254 14.5264 0.265
NP_442514.1_10 Forward -226 -207 7.47261 0.258
NP_440185.1_9 Reverse -159 -176 19.705 0.0855
NP_440554.1_4 Forward -192 -182 16.1063 0.0189
NP_442737.1_5 Forward -221 -202 11.4246 0.289
NP_441885.1_5 Reverse -184 -194 11.7798 0.00668
NP_441885.1_5 Forward -193 -183 1.55333 0.109
NP_442341.1_9 Reverse -182 -196 10.1271 0.137
NP_442341.1_9 Forward -195 -181 4.71887 0.294
NP_443000.1_7 Reverse -182 -192 17.4829 0.00719
NP_443000.1_7 Forward -195 -185 1.25834 0.26
NP_440507.2_3 Forward -223 -204 9.93006 0.213
NP_441842.1_10 Reverse -177 -191 14.8476 0.0511
NP_440275.1_3 Reverse -182 -192 9.12481 0.055
NP_440275.1_3 Forward -195 -185 8.1415 0.0602
NP_440091.1_1 Reverse -180 -192 10.8554 0.0429
NP_443060.1_5 Reverse -373 -392 8.94676 0.197
NP_442638.1_3 Forward -278 -259 10.8379 0.298
NP_441122.1_1 Reverse -377 -392 6.86307 0.28
NP_441122.1_1 Forward -342 -327 2.92983 0.29
NP_440175.1_7 Forward -224 -206 14.6331 0.144
NP_440175.1_7 Forward -209 -191 13.1692 0.193
NP_441105.1_3 Forward -225 -206 -0.295539 0.134
NP_441105.1_3 Forward -231 -212 -0.787193 0.142
NP_441105.1_3 Reverse -200 -219 -9.44032 0.289
NP_440216.1_1 Forward -193 -179 7.27608 0.00942
NP_440216.1_9 Forward -167 -158 10.4228 0.286
NP_440172.1_1 Reverse -184 -194 8.4365 0.0621
NP_440172.1_1 Forward -193 -183 7.74818 0.0738
NP_442015.1_10 Forward -197 -184 12.3107 0.0372
NP_441226.1_7 Forward -192 -185 14.4934 0.0123
NP_441226.1_7 Reverse -185 -192 14.4934 0.0123
NP_441111.1_7 Forward -192 -184 18.7023 0.00294
NP_441111.1_7 Reverse -185 -193 8.96754 0.0463
NP_442379.1_10 Reverse -177 -194 -3.8944 0.272
NP_440244.1_1 Forward -317 -298 -7.76869 0.287
NP_440244.1_1 Forward -316 -297 -8.85033 0.287
NP_441766.1_2 Forward -193 -184 16.2243 0.0047
NP_441766.1_2 Reverse -184 -193 9.14451 0.0337
NP_440416.1_9 Forward -215 -196 -17.4051 0.239
NP_440072.1_5 Reverse -162 -180 -4.20908 0.296
NP_442403.1_9 Forward -205 -186 8.35759 0.191
NP_442403.1_9 Forward -226 -207 4.32602 0.24
NP_442403.1_10 Reverse -67 -86 9.73422 0.266
NP_442154.1_1 Reverse -346 -364 -16.3038 0.238
NP_442226.1_2 Forward -22 -8 17.8952 0.279
NP_442226.1_8 Forward -125 -115 15.8113 0.167
NP_440261.1_5 Reverse -185 -198 -3.12731 0.115
NP_440261.1_5 Forward -192 -179 -10.6988 0.203
NP_440988.1_10 Reverse -182 -196 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTAATCAATTGTTAATCGTTAACCCATACTAGCAAAGAAGCAGTGCCCACACCGCAGTGTTTGGTTCTTGGCCAAGTCGGTCTAGTTGTCAGGGGACAGGGGAATGTATAGATTAGTGTGTAAGGATAAACTTTTAGGAATTTTTTAGATTATGGAAAGTGTTGCTTACATTCTGGTGCTGACCATGGCCCTTGCGGTCCTTTTCTTTGCGATCGCCTTTCGGGAACCCCCCCGCATCGAAAAATAGTCCAATTAAAGGGTCTTTTTTCCAGGTGTTTTTTGCCTGGACACTCCCTTAAAACCCCAGTTTTTACCTCTGTTTCAACCGTGGGCTAGCTTGACTTTGACGCAACATTCTTGTATGCGTTAGGTTGGGCTAAGCTCATTTTTTGTAGCCATT

CDS

ATGCAATGTCCTCACTGTCAGCACCACAATAGTCGAGTCCTTGAATCCCGTTCCAGCGAAGGTGGCCAAAGTATTAGGCGGCGGCGGGAATGTTTGGAATGTAAACACCGTTTCACCACCTACGAACGGCTGGAGTTGTTACCCGTCACGGTCATTAAACAAGATGGGGAACGGCAAGCCTTTGACCGCTCCAAACTGCTGCGGGGTATGGTGCGGGCCTGTGAAAAAACTGATATTAATTTCCAGCGCCTAGAACACATTGTTGAAGAAATTGAGGCCAACTTACAGCAACAGCCAAAACGGGAAATTCACAGCGAGGCAATCGGGCAAATGGTGTTGCAATATTTACGCCAGGAAAGCGAAGTGGCCTATATCCGTTTTGCTTCTGTTTATGGGCGATTTCAAGGCATTGCAGATTTCGTTGATACCCTAGAGCAACTGCAACGAGAACAATATCCTGAACGGCAATATTTGACCATGACTTAG

Protein

MQCPHCQHHNSRVLESRSSEGGQSIRRRRECLECKHRFTTYERLELLPVTVIKQDGERQAFDRSKLLRGMVRACEKTDINFQRLEHIVEEIEANLQQQPKREIHSEAIGQMVLQYLRQESEVAYIRFASVYGRFQGIADFVDTLEQLQREQYPERQYLTMT