Your browser is old and dusty. Try Google Chrome!

Details for slr0769

ORF slr0769
Accession NP_442041.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -293 -307 15.4376 0.104
NP_441061.1_2 Reverse -133 -147 10.0294 0.0651
NP_441061.1_2 Forward -301 -287 7.57108 0.101
NP_441061.1_2 Forward -140 -126 5.99778 0.126
NP_441061.1_2 Forward -212 -198 2.35953 0.177
NP_441061.1_2 Forward -307 -293 0.196253 0.215
NP_440795.1_7 Forward -301 -294 14.6904 0.0123
NP_440795.1_7 Reverse -294 -301 14.6904 0.0123
NP_440795.1_7 Forward -140 -133 14.6904 0.0123
NP_440795.1_7 Reverse -133 -140 14.6904 0.0123
NP_441418.1_6 Forward -302 -283 -3.93378 0.0254
NP_441418.1_6 Forward -150 -131 -20.7484 0.125
NP_441418.1_6 Reverse -195 -214 -20.945 0.133
NP_441418.1_6 Reverse -132 -151 -20.945 0.133
NP_441418.1_6 Forward -141 -122 -22.2233 0.172
NP_441418.1_6 Reverse -281 -300 -30.1882 0.262
NP_441418.1_6 Forward -314 -295 -30.5815 0.286
NP_442291.1_7 Reverse -301 -315 11.3077 0.217
NP_440897.1_6 Forward -302 -283 0.0970122 0.18
NP_441453.1_1 Reverse -125 -143 12.8014 0.0938
NP_441453.1_4 Reverse -293 -301 16.539 0.00633
NP_441453.1_4 Reverse -132 -140 16.539 0.00633
NP_441453.1_4 Forward -302 -294 16.539 0.00633
NP_441453.1_4 Forward -141 -133 16.539 0.00633
NP_442151.1_6 Forward -302 -288 11.5043 0.0981
NP_442151.1_6 Reverse -132 -146 9.04604 0.159
NP_442151.1_6 Reverse -293 -307 7.17775 0.206
NP_441818.1_1 Forward -288 -277 10.3829 0.232
NP_440226.1_1 Forward -141 -122 21.4356 0.00635
NP_440226.1_1 Reverse -132 -151 8.16093 0.0926
NP_440226.1_1 Forward -302 -283 7.66927 0.102
NP_440150.1_6 Reverse -129 -148 0.786102 0.296
NP_442287.1_9 Forward -140 -121 15.1416 0.244
NP_442173.1_1 Forward -301 -293 15.4574 0.00633
NP_442173.1_1 Forward -140 -132 15.4574 0.00633
NP_442173.1_1 Reverse -294 -302 15.4574 0.00633
NP_442173.1_1 Reverse -133 -141 15.4574 0.00633
NP_442752.1_4 Forward -302 -295 13.8055 0.0199
NP_442752.1_4 Reverse -293 -300 13.8055 0.0199
NP_442752.1_4 Forward -141 -134 13.8055 0.0199
NP_442752.1_4 Reverse -132 -139 13.8055 0.0199
NP_442752.1_4 Forward -150 -143 5.25066 0.256
NP_443027.1_4 Reverse -291 -301 13.943 0.0452
NP_443027.1_4 Reverse -130 -140 13.943 0.0452
NP_443027.1_4 Forward -304 -294 13.2547 0.0521
NP_443027.1_4 Forward -143 -133 13.1564 0.0521
NP_442975.1_10 Reverse -289 -303 20.9434 0.00133
NP_442975.1_10 Reverse -128 -142 11.897 0.0482
NP_440784.1_7 Forward -301 -294 15.9687 0.0123
NP_440784.1_7 Reverse -294 -301 15.9687 0.0123
NP_440784.1_7 Forward -140 -133 15.9687 0.0123
NP_440784.1_7 Reverse -133 -140 15.9687 0.0123
NP_440061.1_9 Forward -304 -290 13.372 0.0819
NP_440061.1_9 Reverse -130 -144 10.8154 0.122
NP_440110.1_8 Forward -143 -124 -1.37718 0.238
NP_441054.1_1 Forward -309 -295 15.0442 0.212
NP_441476.1_5 Forward -307 -288 0.786102 0.19
NP_441476.1_5 Forward -146 -127 -1.18052 0.2
NP_441476.1_5 Reverse -288 -307 -1.47551 0.205
NP_442062.1_8 Forward -302 -292 19.4496 0.000558
NP_442062.1_8 Forward -141 -131 19.4496 0.000558
NP_442062.1_8 Reverse -132 -142 17.3846 0.00193
NP_442062.1_8 Reverse -293 -303 10.3048 0.0493
NP_441859.1_3 Forward -303 -284 11.5033 0.108
NP_441859.1_3 Reverse -131 -150 10.9134 0.114
NP_440304.1_4 Forward -304 -294 10.8948 0.051
NP_440304.1_4 Forward -143 -133 9.91146 0.051
NP_440304.1_4 Reverse -291 -301 9.91146 0.051
NP_440304.1_4 Reverse -130 -140 9.91146 0.051
NP_442242.1_4 Forward -301 -294 14.3954 0.0124
NP_442242.1_4 Reverse -294 -301 14.3954 0.0124
NP_442242.1_4 Forward -140 -133 14.3954 0.0124
NP_442242.1_4 Reverse -133 -140 14.3954 0.0124
NP_440044.1_8 Reverse -294 -313 -2.26216 0.261
NP_440044.1_8 Forward -301 -282 -3.44213 0.284
NP_441581.1_6 Reverse -284 -303 12.8799 0.283
NP_439918.1_3 Reverse -290 -309 3.04771 0.271
NP_441352.1_2 Reverse -116 -135 0.786102 0.265
NP_441352.1_2 Forward -175 -156 0.687771 0.268
NP_441208.1_1 Forward -301 -282 3.44104 0.212
NP_441208.1_9 Forward -144 -130 16.4209 0.0669
NP_441208.1_9 Reverse -290 -304 8.25939 0.219
NP_441208.1_9 Forward -305 -291 8.16106 0.219
NP_441594.1_6 Reverse -135 -154 3.44104 0.23
NP_440370.1_10 Forward -150 -131 14.9458 0.094
NP_442276.1_2 Forward -274 -255 7.17762 0.291
NP_442110.1_7 Reverse -293 -307 12.0943 0.0586
NP_442110.1_7 Forward -302 -288 9.93102 0.0684
NP_442110.1_7 Reverse -132 -146 -0.492064 0.291
NP_442726.1_7 Forward -211 -193 -1.75081 0.297
NP_441925.1_4 Forward -214 -195 -15.5375 0.266
NP_440014.1_6 Reverse -284 -303 12.6841 0.221
NP_440014.1_7 Reverse -284 -298 17.6002 0.119
NP_440856.1_4 Forward -309 -290 7.7676 0.0636
NP_440856.1_4 Forward -148 -129 -2.36049 0.209
NP_441083.1_5 Reverse -132 -142 20.3345 0.00053
NP_441083.1_5 Forward -302 -292 11.3864 0.0159
NP_441083.1_5 Forward -141 -131 11.3864 0.0159
NP_441083.1_5 Reverse -293 -303 11.2881 0.0159
NP_442827.1_8 Reverse -285 -304 8.65176 0.0792
NP_442827.1_8 Forward -291 -272 1.96529 0.17
NP_441434.1_7 Forward -139 -125 5.01447 0.225
NP_441738.1_2 Forward -300 -293 15.28 0.0102
NP_441738.1_2 Reverse -295 -302 15.28 0.0102
NP_441738.1_2 Forward -139 -132 15.28 0.0102
NP_441738.1_2 Reverse -134 -141 15.28 0.0102
NP_441558.1_5 Forward -143 -124 12.5858 0.0675
NP_441558.1_5 Forward -304 -285 7.86593 0.167
NP_441955.1_8 Forward -204 -187 11.4452 0.207
NP_440209.1_1 Reverse -293 -301 18.1123 0.00295
NP_440209.1_1 Reverse -132 -140 18.1123 0.00295
NP_440209.1_1 Forward -302 -294 18.1123 0.00295
NP_440209.1_1 Forward -141 -133 18.1123 0.00295
NP_442889.1_8 Reverse -129 -143 11.9953 0.0713
NP_440447.1_1 Forward -307 -289 5.62401 0.194
NP_441713.1_1 Forward -147 -128 -2.26216 0.113
NP_441713.1_1 Forward -308 -289 -16.5201 0.284
NP_441713.1_1 Reverse -287 -306 -16.5201 0.284
NP_441770.1_10 Forward -304 -285 13.7658 0.213
NP_440178.1_7 Reverse -292 -311 -19.5684 0.178
NP_440178.1_7 Forward -142 -123 -20.0601 0.184
NP_442570.1_3 Forward -291 -272 -8.85033 0.294
NP_441716.1_1 Reverse -132 -146 8.84938 0.13
NP_441716.1_1 Forward -302 -288 4.22782 0.256
NP_442111.1_4 Forward -142 -128 18.7808 0.00603
NP_442111.1_4 Forward -303 -289 16.5192 0.0145
NP_442111.1_4 Reverse -292 -306 13.4709 0.0383
NP_441163.1_1 Reverse -285 -302 10.2645 0.217
NP_441387.1_4 Reverse -76 -94 21.2012 0.0559
NP_440906.1_5 Forward -301 -294 15.8704 0.0124
NP_440906.1_5 Reverse -294 -301 15.8704 0.0124
NP_440906.1_5 Forward -140 -133 15.8704 0.0124
NP_440906.1_5 Reverse -133 -140 15.8704 0.0124
NP_440747.1_10 Forward -144 -132 17.2469 0.000522
NP_440747.1_10 Forward -305 -293 17.1486 0.000663
NP_440747.1_10 Reverse -290 -302 -2.02597 0.0196
NP_440747.1_10 Reverse -129 -141 -2.1243 0.0225
NP_441130.1_10 Reverse -130 -144 10.7177 0.112
NP_441130.1_10 Reverse -291 -305 10.0294 0.117
NP_441130.1_10 Forward -304 -290 9.5377 0.124
NP_441130.1_10 Forward -143 -129 8.55439 0.134
NP_441854.1_10 Reverse -291 -310 10.7175 0.139
NP_441486.1_1 Reverse -290 -304 -3.44199 0.178
NP_441486.1_1 Reverse -129 -143 -3.83532 0.183
NP_441486.1_1 Forward -144 -130 -4.13031 0.189
NP_441486.1_1 Reverse -239 -253 -5.31028 0.231
NP_442634.1_4 Reverse -291 -305 6.58777 0.0489
NP_442634.1_4 Forward -304 -290 5.80112 0.051
NP_442634.1_4 Reverse -130 -144 4.91614 0.0699
NP_442634.1_4 Forward -143 -129 -4.81863 0.22
NP_441265.1_3 Reverse -287 -301 2.94952 0.181
NP_440403.1_4 Forward -150 -131 -9.93197 0.288
NP_442848.1_1 Forward -308 -294 -1.5737 0.263
NP_442848.1_1 Reverse -287 -301 -1.96703 0.263
NP_442848.1_1 Forward -147 -133 -2.16369 0.263
NP_442848.1_9 Forward -308 -289 4.22769 0.206
NP_443018.1_3 Forward -301 -294 14.8871 0.0123
NP_443018.1_3 Reverse -294 -301 14.8871 0.0123
NP_443018.1_3 Forward -140 -133 14.8871 0.0123
NP_443018.1_3 Reverse -133 -140 14.8871 0.0123
NP_443018.1_3 Forward -113 -106 7.11894 0.16
NP_441316.1_7 Reverse -130 -145 13.7462 0.0486
NP_441316.1_7 Reverse -291 -306 4.20813 0.135
NP_441634.1_8 Forward -304 -290 15.8309 0.0248
NP_441634.1_8 Forward -143 -129 6.78443 0.114
NP_440376.1_1 Forward -302 -293 19.4693 0.000692
NP_440376.1_1 Reverse -293 -302 19.4693 0.000692
NP_440376.1_1 Forward -141 -132 19.4693 0.000692
NP_440376.1_1 Reverse -132 -141 19.4693 0.000692
NP_441857.1_5 Reverse -286 -304 3.16574 0.246
NP_442687.1_7 Reverse -292 -302 15.8113 0.0125
NP_442687.1_7 Reverse -131 -141 15.8113 0.0125
NP_442687.1_7 Forward -303 -293 9.02648 0.0994
NP_442687.1_7 Forward -142 -132 8.92815 0.0994
NP_442191.1_4 Reverse -294 -308 16.1318 0.0443
NP_442191.1_4 Forward -301 -287 15.2592 0.0634
NP_442485.1_3 Reverse -288 -307 -0.4922 0.253
NP_442485.1_3 Reverse -130 -149 -2.85214 0.268
NP_440642.1_10 Reverse -160 -174 4.22722 0.259
NP_441013.1_2 Reverse -288 -306 -4.79907 0.299
NP_441422.1_7 Reverse -291 -308 7.41366 0.0992
NP_441422.1_7 Reverse -130 -147 -1.53445 0.194
NP_441422.1_7 Forward -304 -287 -3.5994 0.235
NP_440533.1_9 Reverse -132 -151 4.12936 0.236
NP_442658.1_1 Reverse -291 -301 18.7607 0.00222
NP_442658.1_1 Reverse -130 -140 18.7607 0.00222
NP_442658.1_1 Forward -304 -294 14.2375 0.0237
NP_442658.1_1 Forward -143 -133 9.616 0.147
NP_441855.2_4 Reverse -124 -143 11.8368 0.207
NP_440662.1_2 Reverse -124 -143 -1.67217 0.276
NP_442782.1_2 Reverse -293 -307 11.111 0.173
NP_442782.1_2 Forward -162 -148 0.0979218 0.296
NP_442205.1_9 Reverse -126 -142 -3.38305 0.282
NP_441414.1_9 Forward -141 -122 3.6377 0.0578
NP_441414.1_9 Reverse -132 -151 -2.55715 0.119
NP_441414.1_9 Forward -302 -283 -6.78538 0.203
NP_441487.1_9 Reverse -131 -150 6.68596 0.128
NP_442937.1_5 Forward -158 -139 8.75091 0.212
NP_442937.1_5 Forward -146 -127 8.45592 0.22
NP_442937.1_5 Reverse -127 -146 8.16093 0.231
NP_441958.1_5 Forward -303 -293 21.2195 0.000805
NP_441958.1_5 Reverse -292 -302 12.2714 0.00183
NP_441958.1_5 Forward -142 -132 12.2714 0.00183
NP_441958.1_5 Reverse -131 -141 12.2714 0.00183
NP_441127.1_1 Reverse -259 -273 12.0943 0.215
NP_441127.1_1 Reverse -195 -209 8.94771 0.284
NP_440203.1_5 Reverse -135 -145 11.1893 0.202
NP_439905.1_1 Forward -301 -288 11.819 0.204
NP_439905.1_1 Forward -140 -127 8.67241 0.232
NP_440984.1_7 Reverse -288 -302 13.1759 0.117
NP_440984.1_7 Forward -146 -132 10.3243 0.126
NP_439990.1_5 Forward -307 -294 10.7374 0.128
NP_439990.1_5 Forward -146 -133 9.75405 0.133
NP_442376.1_2 Reverse -288 -307 -4.52377 0.253
NP_442911.1_2 Reverse -122 -141 24.4839 0.00397
NP_442911.1_2 Reverse -283 -302 22.3206 0.00418
NP_442911.1_2 Forward -151 -132 -3.04881 0.107
NP_442911.1_2 Forward -312 -293 -3.14714 0.109
NP_440153.1_5 Forward -301 -287 13.7659 0.0551
NP_440153.1_5 Reverse -294 -308 4.32615 0.199
NP_442064.1_4 Forward -312 -293 6.58682 0.249
NP_442536.1_7 Forward -308 -289 6.29264 0.298
NP_443055.1_6 Reverse -124 -142 8.47483 0.142
NP_443055.1_6 Forward -149 -131 -2.24319 0.291
NP_441891.1_6 Reverse -375 -388 20.5705 0.105
NP_440993.1_2 Forward -307 -291 5.95839 0.234
NP_440993.1_2 Forward -146 -130 4.68009 0.249
NP_440993.1_2 Reverse -127 -143 3.50012 0.258
NP_440993.1_2 Reverse -288 -304 3.20513 0.262
NP_440993.1_3 Reverse -283 -302 8.06178 0.135
NP_440993.1_3 Forward -312 -293 -1.96793 0.292
NP_440934.1_2 Reverse -275 -294 13.1758 0.0813
NP_442210.1_9 Forward -318 -300 9.45892 0.259
NP_440138.1_6 Reverse -294 -313 5.11187 0.23
NP_439975.1_2 Reverse -348 -366 8.7706 0.215
NP_441348.1_3 Reverse -275 -294 9.53756 0.215
NP_441099.1_5 Forward -151 -132 -9.44032 0.223
NP_441099.1_5 Forward -214 -195 -10.4236 0.253
NP_441099.1_5 Reverse -122 -141 -11.0136 0.27
NP_442002.1_5 Forward -48 -30 22.4378 0.0956
NP_442002.1_9 Reverse -292 -299 10.7572 0.185
NP_442002.1_9 Reverse -131 -138 10.7572 0.185
NP_442567.1_3 Forward -400 -384 15.9882 0.156
NP_441294.1_7 Reverse -289 -303 12.9942 0.0767
NP_441294.1_7 Reverse -128 -142 11.2664 0.15
NP_441294.1_7 Reverse -376 -390 9.63458 0.236
NP_441646.1_1 Reverse -125 -144 13.2741 0.0882
NP_441646.1_1 Forward -309 -290 5.80098 0.176
NP_441646.1_1 Reverse -286 -305 1.27776 0.232
NP_442438.1_10 Reverse -288 -302 19.6658 0.0132
NP_442438.1_10 Reverse -127 -141 15.3392 0.0267
NP_442438.1_10 Forward -146 -132 3.44117 0.162
NP_442438.1_10 Forward -307 -293 2.75286 0.168
NP_442438.1_10 Reverse -354 -368 -0.000409212 0.244
NP_441000.1_6 Forward -142 -128 -3.54032 0.224
NP_441000.1_6 Forward -303 -289 -4.03198 0.225
NP_441000.1_6 Reverse -292 -306 -4.03198 0.225
NP_442771.1_1 Forward -143 -125 12.1139 0.0174
NP_441674.1_6 Forward -275 -256 5.211 0.261
NP_440147.1_4 Forward -304 -291 18.4072 0.00407
NP_440147.1_4 Reverse -130 -143 12.8023 0.0326
NP_440147.1_4 Reverse -291 -304 10.4424 0.0355
NP_440147.1_4 Forward -143 -130 10.2457 0.0355
NP_441550.1_8 Forward -143 -133 16.7941 0.00906
NP_441550.1_8 Forward -304 -294 15.8108 0.0132
NP_441550.1_8 Reverse -291 -301 10.501 0.066
NP_441550.1_8 Reverse -130 -140 10.501 0.066
NP_441916.1_7 Reverse -293 -303 18.9579 0.00144
NP_441916.1_7 Forward -302 -292 18.4663 0.00144
NP_441916.1_7 Forward -141 -131 18.4663 0.00144
NP_441916.1_7 Reverse -132 -142 10.3048 0.0261
NP_441041.1_4 Reverse -293 -312 1.76941 0.0792
NP_441041.1_4 Reverse -287 -306 -11.8986 0.254
NP_441041.1_4 Reverse -132 -151 -12.1936 0.26
NP_441041.1_7 Forward -305 -293 13.3454 0.0485
NP_441041.1_7 Reverse -290 -302 10.2357 0.1
NP_441041.1_7 Reverse -129 -141 10.1386 0.102
NP_441041.1_7 Forward -144 -132 9.1668 0.12
NP_442642.1_9 Reverse -125 -142 1.71047 0.208
NP_442396.1_5 Reverse -128 -141 8.67241 0.151
NP_441547.1_2 Forward -125 -107 5.72234 0.215
NP_442004.1_6 Reverse -293 -307 7.27608 0.161
NP_442004.1_6 Reverse -132 -146 4.71948 0.204
NP_440703.1_9 Reverse -306 -319 4.83694 0.293
NP_441725.1_4 Forward -307 -293 22.025 0.00544
NP_441725.1_5 Forward -301 -291 9.02648 0.0553
NP_441725.1_5 Forward -140 -130 9.02648 0.0553
NP_441725.1_5 Reverse -133 -143 9.02648 0.0553
NP_441725.1_5 Reverse -294 -304 1.94665 0.115
NP_441725.1_5 Forward -203 -193 -0.806614 0.271
NP_439966.1_7 Reverse -291 -301 17.4824 0.00636
NP_439966.1_7 Reverse -130 -140 17.4824 0.00636
NP_439966.1_7 Forward -143 -133 14.8275 0.0177
NP_439966.1_7 Forward -304 -294 14.3359 0.0203
NP_439966.1_9 Reverse -291 -300 10.7178 0.0863
NP_439966.1_9 Reverse -130 -139 10.7178 0.0863
NP_439966.1_9 Forward -143 -134 0.884706 0.253
NP_442941.1_3 Reverse -294 -304 19.2529 0.00262
NP_442941.1_3 Reverse -133 -143 10.9931 0.0116
NP_442941.1_3 Forward -301 -291 2.53664 0.14
NP_442941.1_3 Forward -140 -130 2.53664 0.14
NP_440289.1_2 Reverse -129 -142 10.1474 0.0278
NP_440289.1_2 Reverse -290 -303 3.46087 0.078
NP_440289.1_2 Forward -305 -292 -3.52063 0.267
NP_440289.1_2 Forward -144 -131 -4.60227 0.29
NP_440983.1_5 Reverse -135 -154 -4.32711 0.257
NP_440983.1_9 Forward -311 -292 3.14605 0.285
NP_442281.1_1 Forward -307 -293 15.2402 0.0132
NP_442281.1_1 Forward -146 -132 15.0436 0.0144
NP_442281.1_1 Reverse -288 -302 9.14375 0.0736
NP_441334.1_7 Forward -143 -124 -10.9153 0.12
NP_441334.1_7 Forward -304 -285 -11.1119 0.12
NP_441334.1_7 Reverse -291 -310 -18.9784 0.275
NP_441334.1_7 Reverse -130 -149 -20.65 0.277
NP_442256.1_2 Forward -304 -286 -4.40575 0.214
NP_440437.1_1 Forward -308 -289 3.24438 0.124
NP_442500.1_2 Reverse -193 -212 8.75091 0.283
NP_442012.1_1 Forward -147 -128 13.3725 0.058
NP_442012.1_1 Forward -308 -289 11.0125 0.0769
NP_442012.1_1 Reverse -287 -306 2.0644 0.205
NP_441087.1_6 Forward -396 -378 -1.16155 0.264
NP_441457.1_7 Forward -143 -124 2.45773 0.255
NP_441556.1_10 Reverse -288 -302 14.894 0.154
NP_440498.1_1 Forward -150 -132 -0.472507 0.218
NP_442982.1_5 Reverse -283 -302 -3.24547 0.297
NP_441644.1_6 Reverse -293 -303 19.0557 0.000803
NP_441644.1_6 Reverse -132 -142 17.3841 0.00127
NP_441644.1_6 Forward -302 -292 10.1076 0.0628
NP_441644.1_6 Forward -141 -131 10.1076 0.0628
NP_441644.1_6 Reverse -204 -214 7.64939 0.121
NP_441644.1_6 Reverse -195 -205 3.32285 0.288
NP_442215.1_2 Reverse -130 -146 0.55019 0.15
NP_442215.1_2 Forward -123 -107 -0.236458 0.164
NP_442215.1_2 Forward -316 -300 -1.80975 0.189
NP_442215.1_2 Reverse -291 -307 -3.38305 0.214
NP_442029.1_6 Forward -307 -288 3.34271 0.282
NP_442247.1_8 Forward -304 -290 11.996 0.247
NP_440253.1_2 Forward -141 -123 6.11567 0.0856
NP_440253.1_2 Forward -302 -284 -1.35749 0.238
NP_440253.1_2 Reverse -132 -150 -1.65248 0.245
NP_440929.1_8 Forward -302 -293 19.2726 0.000701
NP_440929.1_8 Reverse -293 -302 19.2726 0.000701
NP_440929.1_8 Forward -141 -132 19.2726 0.000701
NP_440929.1_8 Reverse -132 -141 19.2726 0.000701
NP_442933.1_10 Forward -302 -293 17.601 0.00325
NP_442933.1_10 Reverse -293 -302 17.601 0.00325
NP_442933.1_10 Forward -141 -132 17.601 0.00325
NP_442933.1_10 Reverse -132 -141 17.601 0.00325
NP_442671.1_2 Reverse -66 -85 7.844 0.104
NP_441751.2_8 Reverse -133 -147 13.7659 0.015
NP_441751.2_8 Reverse -294 -308 5.1128 0.0448
NP_441751.2_8 Forward -140 -126 -2.95034 0.134
NP_442554.1_8 Reverse -133 -143 18.0729 0.00543
NP_442554.1_8 Reverse -294 -304 17.2863 0.00543
NP_442554.1_8 Forward -301 -291 16.008 0.0065
NP_442554.1_8 Forward -140 -130 16.008 0.0065
NP_442554.1_8 Reverse -106 -116 2.92996 0.249
NP_442863.1_3 Reverse -342 -360 15.3588 0.172
NP_441762.1_7 Forward -303 -291 12.527 0.0142
NP_441762.1_7 Forward -142 -130 12.4287 0.0142
NP_441762.1_7 Reverse -131 -143 11.8387 0.0142
NP_441762.1_7 Reverse -292 -304 2.30059 0.0676
NP_442142.1_4 Forward -144 -131 16.0466 0.0264
NP_442142.1_4 Forward -305 -292 15.4566 0.0264
NP_442142.1_4 Reverse -290 -303 6.60689 0.16
NP_442142.1_4 Reverse -129 -142 5.91857 0.178
NP_442292.1_1 Reverse -133 -142 18.486 0.00229
NP_442292.1_1 Reverse -294 -303 17.5026 0.00435
NP_442292.1_1 Forward -301 -292 9.63616 0.0183
NP_442292.1_1 Forward -140 -131 9.63616 0.0183
NP_442292.1_5 Reverse -276 -295 8.25926 0.141
NP_442476.1_6 Reverse -133 -147 19.5675 0.0268
NP_442476.1_6 Forward -140 -126 11.406 0.056
NP_442476.1_6 Forward -301 -287 7.47274 0.112
NP_442476.1_6 Reverse -294 -308 -0.295402 0.294
NP_442381.1_8 Reverse -129 -148 -5.9004 0.151
NP_442381.1_8 Reverse -290 -309 -13.0786 0.267
NP_443009.1_5 Forward -303 -292 19.626 0.00102
NP_443009.1_5 Forward -142 -131 18.3477 0.00265
NP_443009.1_5 Reverse -292 -303 7.82632 0.118
NP_442301.1_2 Forward -211 -192 14.1583 0.117
NP_442301.1_2 Reverse -131 -150 10.6184 0.189
NP_442301.1_2 Reverse -122 -141 5.40686 0.264
NP_442408.2_1 Forward -302 -283 -4.81876 0.267
NP_441715.1_4 Reverse -294 -304 16.7946 0.0106
NP_441715.1_4 Forward -301 -291 9.32148 0.097
NP_441715.1_4 Forward -140 -130 9.32148 0.097
NP_441715.1_4 Reverse -133 -143 7.84651 0.107
NP_440357.1_3 Reverse -130 -149 4.916 0.242
NP_440881.1_10 Reverse -133 -146 13.4906 0.249
NP_440015.1_9 Forward -141 -123 -1.84914 0.296
NP_441468.1_1 Forward -301 -294 15.8704 0.0124
NP_441468.1_1 Reverse -294 -301 15.8704 0.0124
NP_441468.1_1 Forward -140 -133 15.8704 0.0124
NP_441468.1_1 Reverse -133 -140 15.8704 0.0124
NP_442099.1_7 Reverse -123 -137 20.0591 0.253
NP_441020.2_6 Forward -143 -126 19.6067 0.00737
NP_441020.2_6 Reverse -291 -308 17.1484 0.0211
NP_441020.2_6 Reverse -130 -147 7.512 0.229
NP_441015.1_10 Forward -307 -288 10.6192 0.0698
NP_441015.1_10 Forward -146 -127 0.687771 0.165
NP_441015.1_10 Reverse -288 -307 -10.227 0.283
NP_441673.1_1 Forward -302 -293 20.8459 0.000698
NP_441673.1_1 Reverse -293 -302 20.8459 0.000698
NP_441673.1_1 Forward -141 -132 20.8459 0.000698
NP_441673.1_1 Reverse -132 -141 20.8459 0.000698
NP_441731.1_3 Forward -149 -130 -4.91709 0.284
NP_441826.1_2 Reverse -287 -301 12.291 0.0289
NP_441826.1_2 Forward -147 -133 3.34284 0.111
NP_441826.1_2 Forward -210 -196 0.392915 0.187
NP_441826.1_2 Forward -308 -294 -3.73699 0.286
NP_441330.1_1 Forward -307 -288 -12.2919 0.183
NP_442490.1_9 Forward -314 -295 -7.08038 0.275
NP_442868.1_6 Forward -143 -133 17.4829 0.012
NP_442868.1_6 Forward -304 -294 10.4031 0.038
NP_442868.1_6 Reverse -291 -301 8.53483 0.0555
NP_442868.1_6 Reverse -130 -140 8.53483 0.0555
NP_441056.1_1 Reverse -293 -312 -8.35868 0.282
NP_441612.1_2 Reverse -362 -372 9.61423 0.21
NP_441612.1_2 Reverse -132 -142 8.54929 0.21
NP_441612.1_2 Reverse -6 -16 8.25885 0.228
NP_442808.1_1 Reverse -292 -302 18.4657 0.00201
NP_442808.1_1 Reverse -131 -141 18.4657 0.00201
NP_442808.1_1 Reverse -140 -150 13.4509 0.0481
NP_442808.1_1 Forward -303 -293 8.73102 0.0481
NP_442808.1_1 Forward -142 -132 8.63269 0.0481
NP_441101.1_10 Forward -306 -287 -4.32711 0.277
NP_441101.1_10 Forward -145 -126 -7.96535 0.295
NP_440145.1_3 Forward -151 -132 18.584 0.00887
NP_440145.1_3 Forward -312 -293 2.65439 0.115
NP_440145.1_3 Reverse -122 -141 -6.1954 0.292
NP_442542.1_2 Reverse -130 -143 11.819 0.114
NP_442542.1_2 Reverse -291 -304 10.344 0.126
NP_442542.1_2 Reverse -20 -33 6.1158 0.234
NP_442542.1_9 Reverse -286 -300 13.2736 0.108
NP_442113.1_10 Forward -211 -192 -7.76869 0.271
NP_442050.1_5 Forward -304 -294 15.9091 0.0091
NP_442050.1_5 Forward -143 -133 15.6142 0.01
NP_442050.1_5 Reverse -291 -301 8.23937 0.234
NP_442050.1_5 Reverse -130 -140 8.23937 0.234
NP_442050.1_8 Reverse -287 -306 17.8782 0.272
NP_442342.1_9 Reverse -291 -307 11.0716 0.12
NP_442342.1_9 Forward -206 -190 4.77842 0.243
NP_440558.1_2 Forward -311 -292 5.89931 0.137
NP_440558.1_2 Forward -150 -131 -0.787193 0.204
NP_440558.1_2 Reverse -290 -309 -5.01543 0.251
NP_442789.1_4 Forward -143 -124 0.392778 0.192
NP_442789.1_4 Reverse -130 -149 -7.17871 0.292
NP_441518.1_3 Reverse -122 -141 -13.6686 0.264
NP_441878.1_6 Forward -303 -293 10.5014 0.0176
NP_441878.1_6 Reverse -292 -302 10.4031 0.0176
NP_441878.1_6 Forward -142 -132 10.4031 0.0176
NP_441878.1_6 Reverse -131 -141 10.4031 0.0176
NP_441878.1_6 Reverse -304 -314 -7.19813 0.21
NP_441878.1_6 Reverse -194 -204 -7.19813 0.21
NP_441036.1_8 Reverse -292 -302 17.7779 0.000554
NP_441036.1_8 Reverse -131 -141 17.7779 0.000554
NP_441036.1_8 Forward -303 -293 15.713 0.00724
NP_441036.1_8 Reverse -234 -244 10.3048 0.174
NP_441036.1_8 Forward -142 -132 8.33817 0.174
NP_441557.1_5 Forward -302 -293 19.9609 0.000699
NP_441557.1_5 Reverse -293 -302 19.9609 0.000699
NP_441557.1_5 Forward -141 -132 19.9609 0.000699
NP_441557.1_5 Reverse -132 -141 19.9609 0.000699
NP_441445.1_1 Reverse -123 -142 4.71934 0.189
NP_441445.1_1 Forward -150 -131 3.14605 0.218
NP_442066.2_9 Reverse -128 -141 10.639 0.154
NP_442066.2_9 Forward -145 -132 10.5407 0.154
NP_442579.1_6 Forward -206 -187 6.68596 0.252
NP_442419.1_2 Forward -146 -127 -1.18052 0.246
NP_442419.1_2 Forward -307 -288 -1.37718 0.246
NP_442419.1_2 Reverse -288 -307 -1.96717 0.246
NP_441308.1_8 Reverse -291 -301 9.22315 0.226
NP_441308.1_8 Reverse -130 -140 9.22315 0.226
NP_440101.1_3 Reverse -288 -307 19.2723 0.033
NP_441458.1_10 Forward -311 -292 8.84924 0.178
NP_442192.1_8 Reverse -257 -276 15.8307 0.139
NP_442183.1_1 Reverse -132 -146 17.2075 0.0118
NP_442183.1_1 Forward -141 -127 11.3077 0.0724
NP_442183.1_1 Forward -302 -288 9.34103 0.0986
NP_442183.1_1 Reverse -293 -307 7.17775 0.147
NP_442183.1_1 Forward -150 -136 3.73617 0.299
NP_442166.1_7 Reverse -294 -308 12.291 0.175
NP_441574.1_1 Reverse -120 -139 -5.21209 0.26
NP_442444.1_6 Reverse -124 -142 17.6603 0.143
NP_441549.1_9 Forward -145 -127 2.77242 0.0941
NP_441549.1_9 Reverse -289 -307 -5.09406 0.198
NP_442347.1_2 Reverse -133 -142 12.4878 0.056
NP_442347.1_2 Forward -301 -292 11.1111 0.056
NP_442347.1_2 Forward -140 -131 11.1111 0.056
NP_442347.1_2 Reverse -294 -303 3.34298 0.284
NP_442645.1_2 Reverse -124 -143 -10.7186 0.144
NP_442645.1_2 Forward -310 -291 -12.8819 0.144
NP_442645.1_2 Forward -259 -240 -14.1602 0.171
NP_442645.1_2 Forward -149 -130 -21.1417 0.29
NP_442965.1_2 Reverse -112 -131 3.24438 0.168
NP_442888.1_6 Reverse -225 -244 5.70265 0.228
NP_441037.1_4 Reverse -291 -301 16.2838 0.0168
NP_441037.1_4 Reverse -130 -140 16.2838 0.0168
NP_441037.1_4 Forward -143 -133 9.55921 0.21
NP_441037.1_4 Forward -304 -294 7.22024 0.237
NP_442594.1_8 Reverse -192 -211 18.1907 0.14
NP_441633.1_3 Forward -304 -291 13.3923 0.018
NP_441633.1_3 Forward -143 -130 11.1307 0.0286
NP_441633.1_3 Reverse -130 -143 6.01747 0.0481
NP_441633.1_3 Reverse -291 -304 -3.81562 0.177
NP_440136.1_2 Forward -301 -294 15.9687 0.0123
NP_440136.1_2 Reverse -294 -301 15.9687 0.0123
NP_440136.1_2 Forward -140 -133 15.9687 0.0123
NP_440136.1_2 Reverse -133 -140 15.9687 0.0123
NP_442590.1_10 Reverse -287 -306 10.0292 0.183
NP_442998.1_2 Forward -212 -193 6.48849 0.257
NP_442998.1_10 Forward -300 -293 15.5754 0.0102
NP_442998.1_10 Reverse -295 -302 15.5754 0.0102
NP_442998.1_10 Forward -139 -132 15.5754 0.0102
NP_442998.1_10 Reverse -134 -141 15.5754 0.0102
NP_440899.1_8 Forward -399 -380 -6.39206 0.231
NP_440299.1_1 Reverse -289 -302 17.3249 0.0065
NP_440299.1_1 Reverse -128 -141 16.3416 0.0105
NP_440299.1_1 Forward -145 -132 12.1134 0.0425
NP_440299.1_1 Forward -306 -293 11.1301 0.0518
NP_441799.1_1 Forward -145 -131 17.0102 0.0123
NP_441799.1_1 Forward -306 -292 10.3237 0.0756
NP_441799.1_1 Reverse -128 -142 10.3237 0.0756
NP_441799.1_1 Reverse -289 -303 7.17714 0.149
NP_441007.1_10 Forward -146 -133 18.4072 0.0299
NP_441007.1_10 Reverse -199 -212 7.59077 0.136
NP_441007.1_10 Reverse -127 -140 3.95252 0.182
NP_441007.1_10 Forward -307 -294 3.26421 0.182
NP_441007.1_10 Reverse -288 -301 2.18257 0.195
NP_442201.1_10 Reverse -282 -301 -7.67036 0.201
NP_440256.1_1 Forward -305 -286 19.469 0.00424
NP_440256.1_1 Forward -144 -125 -0.4922 0.0936
NP_440256.1_1 Reverse -290 -309 -8.65367 0.264
NP_442961.1_7 Forward -301 -282 7.86593 0.263
NP_440087.1_1 Forward -150 -131 -1.37718 0.196
NP_441229.1_4 Reverse -19 -38 15.5357 0.263
NP_441512.1_4 Forward -306 -287 9.24257 0.244
NP_441559.1_8 Forward -307 -293 11.0127 0.0574
NP_441559.1_8 Reverse -288 -302 2.45787 0.143
NP_441559.1_8 Forward -294 -280 1.67122 0.155
NP_441559.1_8 Forward -394 -380 -7.08024 0.283
NP_440915.1_6 Reverse -289 -303 16.5192 0.0183
NP_440915.1_6 Reverse -128 -142 12.1926 0.0218
NP_440915.1_6 Forward -306 -292 10.6193 0.0301
NP_440915.1_6 Forward -145 -131 3.73617 0.1
NP_442158.1_4 Forward -69 -59 12.3697 0.253
NP_440717.1_1 Forward -301 -282 13.6675 0.159
NP_442785.1_7 Forward -304 -290 11.3077 0.228
NP_442866.1_1 Reverse -288 -307 -0.983855 0.202
NP_442866.1_1 Reverse -127 -146 -4.32711 0.226
NP_440748.1_5 Forward -311 -292 2.55606 0.218
NP_441464.1_2 Forward -208 -198 17.2863 0.221
NP_441464.1_8 Forward -141 -127 7.57108 0.206
NP_440702.1_2 Reverse -338 -357 -5.50708 0.257
NP_440695.1_5 Reverse -293 -312 8.35759 0.15
NP_441939.1_3 Reverse -294 -313 19.3707 0.0118
NP_441939.1_3 Forward -140 -121 10.2259 0.128
NP_441939.1_3 Forward -301 -282 9.83255 0.133
NP_441199.1_6 Reverse -289 -308 4.62101 0.161
NP_441494.1_6 Forward -307 -294 8.77074 0.227
NP_441494.1_6 Reverse -288 -301 8.27909 0.23
NP_439985.1_7 Reverse -287 -306 2.75272 0.289
NP_442993.1_1 Forward -283 -267 -13.0195 0.283
NP_442993.1_1 Reverse -239 -255 -13.1178 0.286
NP_442993.1_1 Forward -132 -116 -13.3145 0.291
NP_442386.1_9 Reverse -292 -301 15.7322 0.0144
NP_442386.1_9 Reverse -131 -140 15.7322 0.0144
NP_442386.1_9 Forward -142 -133 13.8639 0.0289
NP_442386.1_9 Forward -303 -294 6.39082 0.219
NP_440570.1_5 Reverse -257 -276 -0.295539 0.262
NP_441340.1_5 Forward -301 -294 15.6737 0.0124
NP_441340.1_5 Reverse -294 -301 15.6737 0.0124
NP_441340.1_5 Forward -140 -133 15.6737 0.0124
NP_441340.1_5 Reverse -133 -140 15.6737 0.0124
NP_441947.1_10 Reverse -272 -290 3.75572 0.276
NP_440194.1_3 Forward -151 -132 6.29264 0.271
NP_442240.1_1 Forward -397 -378 6.09517 0.258
NP_442240.1_1 Reverse -285 -304 5.50519 0.264
NP_442240.1_2 Reverse -294 -313 -10.4236 0.137
NP_442240.1_2 Forward -301 -282 -16.2252 0.242
NP_440586.1_8 Forward -301 -294 13.2151 0.026
NP_440586.1_8 Forward -140 -133 13.2151 0.026
NP_440586.1_8 Reverse -294 -301 13.2151 0.026
NP_440586.1_8 Reverse -133 -140 13.2151 0.026
NP_442251.1_6 Forward -301 -294 15.2804 0.0124
NP_442251.1_6 Reverse -294 -301 15.2804 0.0124
NP_442251.1_6 Forward -140 -133 15.2804 0.0124
NP_442251.1_6 Reverse -133 -140 15.2804 0.0124
NP_440192.1_5 Reverse -183 -202 3.04771 0.293
NP_441262.1_3 Reverse -293 -300 14.7888 0.0223
NP_441262.1_3 Reverse -132 -139 14.7888 0.0223
NP_441262.1_3 Forward -302 -295 14.7888 0.0223
NP_441262.1_3 Forward -141 -134 14.7888 0.0223
NP_443051.1_1 Forward -303 -294 19.5676 0.00335
NP_443051.1_1 Reverse -292 -301 10.4228 0.00754
NP_443051.1_1 Reverse -131 -140 10.4228 0.00754
NP_443051.1_1 Forward -142 -133 10.4228 0.00754
NP_439937.1_8 Reverse -196 -215 -0.0988766 0.237
NP_439937.1_9 Forward -303 -286 1.61143 0.0911
NP_439937.1_9 Forward -205 -188 -11.5649 0.257
NP_439937.1_9 Forward -208 -191 -12.7448 0.276
NP_439937.1_9 Reverse -131 -148 -16.0881 0.287
NP_439937.1_9 Forward -142 -125 -16.2847 0.287
NP_440836.1_6 Forward -392 -378 14.0609 0.214
NP_440408.1_7 Reverse -293 -312 8.06259 0.282
NP_440439.1_1 Reverse -290 -303 18.8005 0.0105
NP_440439.1_1 Forward -305 -292 18.1122 0.0105
NP_440439.1_1 Forward -144 -131 8.57408 0.0518
NP_440439.1_1 Reverse -129 -142 2.37923 0.135
NP_440372.1_2 Forward -301 -294 16.3621 0.0124
NP_440372.1_2 Reverse -294 -301 16.3621 0.0124
NP_440372.1_2 Forward -140 -133 16.3621 0.0124
NP_440372.1_2 Reverse -133 -140 16.3621 0.0124
NP_440378.1_3 Forward -206 -187 19.2723 0.0426
NP_440819.1_5 Reverse -379 -387 7.59091 0.272
NP_440819.1_5 Reverse -115 -123 7.59091 0.272
NP_440316.1_10 Reverse -194 -204 7.64985 0.246
NP_441803.1_2 Forward -307 -288 18.7807 0.0309
NP_441803.1_2 Forward -146 -127 4.12936 0.181
NP_439977.1_5 Reverse -126 -145 12.9791 0.0531
NP_439977.1_5 Forward -308 -289 11.8975 0.0634
NP_439977.1_5 Forward -147 -128 -1.86883 0.263
NP_440139.1_1 Reverse -126 -145 11.405 0.0797
NP_441572.1_7 Reverse -287 -306 -0.787193 0.184
NP_442384.1_10 Reverse -293 -306 18.8988 0.00338
NP_442384.1_10 Forward -302 -289 11.229 0.0372
NP_442384.1_10 Reverse -132 -145 9.45906 0.0536
NP_442384.1_10 Forward -141 -128 8.9674 0.059
NP_442114.1_4 Forward -302 -291 12.1534 0.107
NP_442114.1_4 Forward -141 -130 12.1534 0.107
NP_442114.1_8 Reverse -54 -68 7.47213 0.234
NP_441980.1_9 Reverse -125 -144 13.9625 0.298
NP_441877.1_5 Forward -338 -319 -0.295539 0.276
NP_441018.1_7 Reverse -289 -308 9.83255 0.218
NP_442790.1_4 Reverse -284 -303 0.294447 0.0906
NP_442790.1_4 Forward -150 -131 -9.73531 0.192
NP_442262.1_10 Forward -301 -294 14.1988 0.0123
NP_442262.1_10 Reverse -294 -301 14.1988 0.0123
NP_442262.1_10 Forward -140 -133 14.1988 0.0123
NP_442262.1_10 Reverse -133 -140 14.1988 0.0123
NP_442262.1_10 Forward -113 -106 8.20058 0.25
NP_442262.1_10 Reverse -44 -51 7.6106 0.274
NP_441689.1_5 Forward -304 -294 8.3377 0.132
NP_441689.1_5 Forward -143 -133 5.87944 0.197
NP_440344.1_10 Reverse -286 -303 1.12048 0.0317
NP_440344.1_10 Reverse -125 -142 -0.0594896 0.0381
NP_440344.1_10 Forward -309 -292 -7.23765 0.116
NP_440344.1_10 Forward -148 -131 -10.9742 0.197
NP_440344.1_10 Forward -214 -197 -11.2692 0.208
NP_440189.1_2 Forward -310 -291 11.4058 0.25
NP_442641.1_1 Forward -199 -180 -16.3235 0.231
NP_440562.1_3 Reverse -133 -150 13.2152 0.0758
NP_440562.1_3 Forward -275 -258 4.26707 0.199
NP_441965.1_10 Reverse -129 -145 16.9715 0.0438
NP_441965.1_10 Reverse -290 -306 11.4649 0.107
NP_440297.1_9 Forward -203 -193 0.176696 0.282
NP_440297.1_9 Forward -301 -291 -0.216628 0.282
NP_440297.1_9 Forward -140 -130 -0.216628 0.282
NP_440297.1_9 Forward -113 -103 -0.216628 0.282
NP_440297.1_9 Reverse -294 -304 -0.216628 0.282
NP_440297.1_9 Reverse -133 -143 -0.216628 0.282
NP_441592.1_4 Reverse -293 -312 -0.4922 0.244
NP_441592.1_4 Reverse -132 -151 -2.95047 0.274
NP_441896.1_3 Reverse -284 -303 2.45773 0.194
NP_441896.1_3 Reverse -123 -142 1.47442 0.214
NP_440700.1_8 Reverse -380 -394 15.3392 0.23
NP_440894.1_10 Reverse -288 -307 10.4225 0.155
NP_440999.1_9 Reverse -289 -303 19.1741 0.0136
NP_440999.1_9 Reverse -128 -142 5.30946 0.113
NP_440999.1_9 Forward -306 -292 1.17956 0.169
NP_440999.1_9 Forward -145 -131 0.786239 0.177
NP_440999.1_9 Forward -208 -194 -0.983719 0.223
NP_440888.1_2 Forward -302 -288 20.6484 0.000502
NP_440888.1_2 Forward -141 -127 18.7801 0.00187
NP_440888.1_2 Reverse -293 -307 14.1586 0.02
NP_440888.1_2 Reverse -132 -146 13.2736 0.0307
NP_442892.1_9 Forward -23 -9 19.8618 0.0567
NP_442892.1_9 Forward -397 -383 14.8469 0.293
NP_442892.1_9 Forward -24 -10 11.9953 0.296
NP_440491.1_1 Forward -144 -125 14.2263 0.113
NP_439969.1_3 Reverse -288 -307 1.86774 0.249
NP_442948.1_2 Reverse -197 -216 6.98095 0.229
NP_442277.1_4 Reverse -284 -303 28.3179 0.000534
NP_442033.1_10 Reverse -130 -149 8.65258 0.0533
NP_442033.1_10 Reverse -291 -310 1.67108 0.0882
NP_442871.1_4 Forward -128 -109 -9.83437 0.283
NP_441917.1_2 Forward -332 -314 4.83737 0.288
NP_441543.1_2 Forward -301 -292 18.486 0.00236
NP_441543.1_2 Forward -140 -131 18.486 0.00236
NP_441543.1_2 Reverse -133 -142 16.9127 0.00359
NP_441543.1_2 Reverse -294 -303 15.9293 0.00518
NP_442845.1_2 Forward -147 -133 12.9793 0.1
NP_442845.1_2 Forward -314 -300 4.81781 0.251
NP_441304.1_10 Reverse -390 -399 12.8811 0.276
NP_441551.1_5 Reverse -289 -305 13.7258 0.119
NP_441178.1_6 Forward -214 -195 7.96345 0.26
NP_441319.1_6 Forward -304 -285 14.0608 0.255
NP_441469.1_8 Reverse -292 -301 16.126 0.00797
NP_441469.1_8 Reverse -131 -140 16.126 0.00797
NP_441469.1_8 Forward -303 -294 6.5879 0.227
NP_441469.1_8 Forward -142 -133 6.48957 0.227
NP_443064.1_6 Reverse -132 -142 12.5669 0.0796
NP_443064.1_6 Reverse -293 -303 10.8217 0.13
NP_442578.1_7 Forward -301 -294 14.5921 0.026
NP_442578.1_7 Forward -140 -133 14.5921 0.026
NP_442578.1_7 Reverse -294 -301 14.5921 0.026
NP_442578.1_7 Reverse -133 -140 14.5921 0.026
NP_440710.1_1 Reverse -124 -142 -1.25915 0.179
NP_440071.1_1 Reverse -379 -396 10.5595 0.253
NP_441462.1_2 Reverse -293 -303 20.2362 0.000805
NP_441462.1_2 Forward -302 -292 11.5831 0.00406
NP_441462.1_2 Forward -141 -131 11.5831 0.00406
NP_441462.1_2 Reverse -132 -142 11.5831 0.00406
NP_441621.1_7 Reverse -130 -144 16.3225 0.0266
NP_441621.1_7 Reverse -291 -305 14.0609 0.0266
NP_441621.1_7 Forward -143 -129 6.48943 0.068
NP_441621.1_7 Forward -304 -290 -3.34366 0.188
NP_443062.1_1 Reverse -293 -311 13.8113 0.0569
NP_443062.1_1 Reverse -132 -150 6.30325 0.204
NP_440519.1_8 Reverse -195 -211 2.8118 0.256
NP_442204.1_1 Forward -306 -295 21.1015 0.0035
NP_442204.1_1 Forward -118 -107 2.81194 0.266
NP_442204.1_1 Reverse -289 -300 0.648657 0.281
NP_442204.1_2 Reverse -283 -302 6.29264 0.287
NP_442204.1_5 Reverse -283 -302 15.4374 0.0439
NP_441560.1_8 Forward -307 -288 13.5579 0.205
NP_440544.1_5 Reverse -166 -173 13.8024 0.28
NP_440516.1_8 Forward -302 -293 16.9127 0.00442
NP_440516.1_8 Reverse -293 -302 16.9127 0.00442
NP_440516.1_8 Forward -141 -132 16.9127 0.00442
NP_440516.1_8 Reverse -132 -141 16.9127 0.00442
NP_442428.1_5 Forward -301 -294 15.8704 0.0124
NP_442428.1_5 Reverse -294 -301 15.8704 0.0124
NP_442428.1_5 Forward -140 -133 15.8704 0.0124
NP_442428.1_5 Reverse -133 -140 15.8704 0.0124
NP_441790.1_3 Forward -301 -282 -4.42544 0.291
NP_441790.1_3 Forward -140 -121 -5.31042 0.291
NP_442120.1_10 Forward -282 -263 -4.32711 0.199
NP_442120.1_10 Reverse -287 -306 -14.8485 0.289
NP_440673.1_2 Reverse -185 -204 12.1455 0.153
NP_440673.1_3 Forward -300 -293 12.4288 0.0426
NP_440673.1_3 Forward -139 -132 12.4288 0.0426
NP_440673.1_3 Reverse -295 -302 12.4288 0.0426
NP_440673.1_3 Reverse -134 -141 12.4288 0.0426
NP_440673.1_3 Reverse -90 -97 8.29892 0.221
NP_440673.1_7 Reverse -282 -301 9.93088 0.111
NP_440673.1_7 Forward -300 -281 3.34271 0.205
NP_440865.1_9 Forward -308 -289 -2.16383 0.182
NP_441052.1_2 Reverse -132 -142 19.9412 0.00106
NP_441052.1_2 Forward -302 -292 10.5014 0.0285
NP_441052.1_2 Forward -141 -131 10.5014 0.0285
NP_441052.1_2 Reverse -293 -303 10.4031 0.0285
NP_441052.1_2 Reverse -305 -315 1.06167 0.252
NP_441052.1_2 Reverse -141 -151 -0.609952 0.288
NP_442219.1_8 Forward -151 -132 8.55364 0.245
NP_442219.1_9 Reverse -133 -142 17.7976 0.00718
NP_442219.1_9 Forward -301 -292 8.35786 0.0681
NP_442219.1_9 Forward -140 -131 8.35786 0.0681
NP_442219.1_9 Reverse -294 -303 8.25953 0.0681
NP_440436.1_4 Forward -301 -292 18.1905 0.00233
NP_440436.1_4 Forward -140 -131 18.1905 0.00233
NP_440436.1_4 Reverse -133 -142 17.2072 0.00233
NP_440436.1_4 Reverse -294 -303 9.24241 0.0871
NP_441884.1_8 Reverse -292 -311 7.66927 0.0541
NP_441884.1_9 Reverse -129 -148 -6.1954 0.0594
NP_441884.1_9 Forward -305 -286 -12.4886 0.138
NP_442864.1_3 Reverse -281 -300 6.68596 0.298
NP_440314.1_9 Reverse -133 -152 12.2908 0.0261
NP_441719.1_4 Forward -301 -294 16.3621 0.0124
NP_441719.1_4 Reverse -294 -301 16.3621 0.0124
NP_441719.1_4 Forward -140 -133 16.3621 0.0124
NP_441719.1_4 Reverse -133 -140 16.3621 0.0124
NP_441733.1_10 Forward -144 -131 17.2272 0.0382
NP_441733.1_10 Reverse -129 -142 7.88576 0.148
NP_441733.1_10 Forward -305 -292 5.82081 0.203
NP_441004.1_1 Reverse -112 -131 -7.57203 0.199
NP_441004.1_1 Reverse -195 -214 -12.8819 0.251
NP_441004.1_1 Reverse -189 -208 -17.1101 0.289
NP_441004.1_1 Reverse -287 -306 -18.1918 0.298
NP_442813.1_4 Reverse -285 -304 -4.91709 0.299
NP_442366.1_3 Reverse -292 -310 6.70565 0.0773
NP_442366.1_3 Forward -303 -285 -0.669169 0.197
NP_442366.1_5 Forward -153 -143 10.796 0.233
NP_441115.1_4 Forward -303 -285 21.7494 0.00196
NP_441115.1_4 Reverse -292 -310 8.86816 0.234
NP_442206.1_10 Reverse -132 -147 14.3362 0.0799
NP_442206.1_10 Reverse -293 -308 1.74985 0.219
NP_440328.1_4 Reverse -287 -306 8.45592 0.114
NP_443054.1_2 Forward -304 -290 10.226 0.0761
NP_443054.1_2 Forward -143 -129 3.14618 0.24
NP_442430.1_4 Reverse -291 -310 11.8975 0.296
NP_441851.1_10 Reverse -292 -302 16.008 0.00552
NP_441851.1_10 Reverse -131 -141 16.008 0.00552
NP_441851.1_10 Forward -142 -132 15.8113 0.00552
NP_441851.1_10 Forward -303 -293 8.53483 0.114
NP_442208.1_5 Reverse -291 -310 -9.83364 0.295
NP_442011.1_1 Reverse -131 -150 -2.45882 0.273
NP_442515.1_1 Forward -142 -128 6.88276 0.097
NP_442515.1_1 Reverse -131 -145 4.62115 0.107
NP_442515.1_1 Forward -303 -289 -3.93365 0.298
NP_441683.1_7 Forward -181 -162 -8.85033 0.284
NP_441683.1_7 Forward -173 -154 -11.5053 0.284
NP_440593.1_3 Reverse -256 -275 9.14423 0.107
NP_440593.1_3 Reverse -288 -307 3.73603 0.151
NP_440593.1_3 Forward -256 -237 -4.52377 0.251
NP_440593.1_9 Forward -144 -130 9.34103 0.254
NP_440165.1_5 Reverse -131 -150 -0.688862 0.179
NP_441349.1_10 Forward -312 -293 4.81767 0.0493
NP_441349.1_10 Forward -151 -132 -7.27704 0.247
NP_440432.1_9 Forward -140 -125 -0.610089 0.166
NP_439960.1_10 Forward -309 -291 -3.52077 0.275
NP_440474.1_8 Forward -140 -126 18.9768 0.0423
NP_440474.1_8 Forward -301 -287 7.27547 0.207
NP_440588.1_2 Forward -311 -292 15.5357 0.0132
NP_440588.1_2 Forward -150 -131 -2.75381 0.172
NP_441570.1_1 Reverse -293 -311 0.314141 0.0395
NP_441570.1_1 Reverse -274 -292 -2.63579 0.0668
NP_441570.1_1 Reverse -132 -150 -17.6804 0.287
NP_440078.1_10 Forward -299 -280 8.94757 0.196
NP_440078.1_10 Reverse -293 -312 3.83436 0.257
NP_441078.1_4 Forward -302 -293 19.6659 0.0007
NP_441078.1_4 Reverse -293 -302 19.6659 0.0007
NP_441078.1_4 Forward -141 -132 19.6659 0.0007
NP_441078.1_4 Reverse -132 -141 19.6659 0.0007
NP_442729.1_5 Reverse -194 -204 15.9097 0.199
NP_442729.1_8 Reverse -128 -141 10.1474 0.125
NP_442729.1_8 Forward -145 -132 9.95071 0.125
NP_442729.1_8 Reverse -289 -302 8.47575 0.125
NP_441528.1_2 Forward -318 -299 9.7334 0.255
NP_440707.1_8 Forward -212 -193 14.2574 0.294
NP_440526.1_3 Reverse -133 -144 17.7577 0.0398
NP_440526.1_3 Forward -140 -129 2.51647 0.267
NP_440526.1_3 Forward -301 -290 2.41814 0.267
NP_441432.1_8 Forward -303 -294 16.8143 0.00595
NP_441432.1_8 Forward -142 -133 16.8143 0.00595
NP_441432.1_8 Reverse -292 -301 8.25953 0.0755
NP_441432.1_8 Reverse -131 -140 8.25953 0.0755
NP_441432.1_9 Reverse -156 -169 9.47098 0.278
NP_442320.1_8 Reverse -126 -140 7.9644 0.0185
NP_442320.1_8 Reverse -287 -301 6.29277 0.029
NP_442320.1_8 Forward -147 -133 5.30946 0.0394
NP_442344.1_7 Reverse -133 -152 -7.08038 0.177
NP_441732.1_2 Forward -306 -290 13.0382 0.00384
NP_441732.1_2 Reverse -128 -144 -15.2811 0.145
NP_441732.1_2 Reverse -289 -305 -15.9694 0.164
NP_441732.1_2 Forward -145 -129 -15.9694 0.164
NP_440629.1_4 Reverse -369 -388 11.5042 0.217
NP_440629.1_6 Forward -308 -289 17.0922 0.0793
NP_442815.1_2 Reverse -196 -214 2.77242 0.291
NP_440760.1_1 Forward -141 -122 -0.983855 0.0282
NP_440760.1_1 Reverse -293 -312 -3.14714 0.034
NP_440760.1_1 Reverse -132 -151 -22.9117 0.274
NP_440760.1_1 Forward -302 -283 -23.1083 0.283
NP_441057.1_4 Reverse -194 -212 -0.177514 0.26
NP_442353.1_4 Forward -295 -276 1.57197 0.242
NP_440713.1_4 Forward -312 -293 13.0775 0.102
NP_440713.1_4 Forward -293 -274 7.47261 0.18
NP_442489.1_2 Forward -319 -300 0.687771 0.297
NP_442489.1_7 Forward -302 -293 20.1576 0.000695
NP_442489.1_7 Reverse -293 -302 20.1576 0.000695
NP_442489.1_7 Forward -141 -132 20.1576 0.000695
NP_442489.1_7 Reverse -132 -141 20.1576 0.000695
NP_440757.1_7 Reverse -190 -208 -3.12744 0.285
NP_442079.1_7 Reverse -133 -152 1.47442 0.251
NP_440559.1_1 Reverse -133 -142 17.4043 0.00658
NP_440559.1_1 Forward -301 -292 8.75118 0.0586
NP_440559.1_1 Forward -140 -131 8.75118 0.0586
NP_440559.1_1 Reverse -294 -303 8.65285 0.0586
NP_441659.2_8 Reverse -293 -303 20.9245 0.000805
NP_441659.2_8 Reverse -132 -142 18.1713 0.00133
NP_441659.2_8 Forward -302 -292 11.9764 0.0147
NP_441659.2_8 Forward -141 -131 11.9764 0.0147
NP_440860.1_6 Forward -149 -130 11.9958 0.293
NP_442913.1_10 Reverse -284 -303 7.37428 0.0546
NP_442913.1_10 Forward -377 -358 1.17943 0.146
NP_442913.1_10 Forward -311 -292 -2.55715 0.187
NP_441040.1_2 Forward -397 -378 -5.11376 0.174
NP_442008.1_2 Forward -305 -286 12.2908 0.102
NP_442008.1_2 Reverse -290 -309 3.34271 0.257
NP_440708.1_6 Forward -312 -293 -7.96535 0.255
NP_440708.1_6 Reverse -295 -314 -8.35868 0.258
NP_441800.1_3 Forward -313 -295 3.95239 0.289
NP_441800.1_7 Forward -212 -194 7.39397 0.12
NP_442776.1_1 Forward -313 -294 5.70265 0.241
NP_440779.1_5 Forward -302 -285 -5.56602 0.149
NP_442346.1_5 Forward -142 -132 16.6963 0.00248
NP_442346.1_5 Forward -303 -293 16.303 0.00248
NP_442346.1_5 Reverse -292 -302 9.02648 0.118
NP_442346.1_5 Reverse -131 -141 9.02648 0.118
NP_442346.1_5 Forward -263 -253 4.79825 0.272
NP_442346.1_10 Forward -143 -124 -1.27885 0.288
NP_440545.1_3 Reverse -289 -306 17.3451 0.0111
NP_440545.1_3 Forward -306 -289 17.0501 0.0111
NP_440545.1_3 Forward -145 -128 6.13536 0.0568
NP_440545.1_3 Reverse -128 -145 2.00546 0.108
NP_440545.1_3 Forward -208 -191 -7.13932 0.298
NP_440459.1_7 Reverse -291 -305 17.3641 0.0994
NP_440010.1_3 Reverse -281 -300 -2.26216 0.25
NP_440010.1_4 Forward -214 -195 -1.47628 0.267
NP_440010.1_4 Forward -306 -287 -2.06626 0.273
NP_440010.1_4 Forward -145 -126 -2.55791 0.284
NP_440010.1_10 Forward -153 -134 14.1591 0.18
NP_440010.1_10 Forward -274 -255 4.12936 0.248
NP_442603.1_7 Reverse -132 -146 14.1586 0.0731
NP_442603.1_7 Forward -302 -288 12.8803 0.0937
NP_441888.1_7 Reverse -288 -302 4.12949 0.225
NP_441888.1_7 Forward -307 -293 3.93283 0.225
NP_441888.1_7 Forward -294 -280 1.17956 0.263
NP_440449.1_6 Reverse -285 -303 25.0823 0.00225
NP_441948.1_4 Forward -309 -291 -1.35749 0.146
NP_441948.1_4 Reverse -286 -304 -1.84914 0.154
NP_440170.1_2 Forward -308 -289 5.30933 0.296
NP_440170.1_6 Forward -307 -288 11.9958 0.283
NP_441502.1_3 Forward -304 -285 10.0292 0.21
NP_441833.1_4 Forward -301 -294 15.9687 0.0124
NP_441833.1_4 Reverse -294 -301 15.9687 0.0124
NP_441833.1_4 Forward -140 -133 15.9687 0.0124
NP_441833.1_4 Reverse -133 -140 15.9687 0.0124
NP_441329.1_6 Reverse -51 -70 1.38421 0.239
NP_442162.1_9 Forward -301 -294 16.2637 0.0124
NP_442162.1_9 Reverse -294 -301 16.2637 0.0124
NP_442162.1_9 Forward -140 -133 16.2637 0.0124
NP_442162.1_9 Reverse -133 -140 16.2637 0.0124
NP_440671.1_4 Forward -308 -294 9.73436 0.172
NP_442199.1_5 Forward -310 -291 1.96607 0.156
NP_442199.1_5 Reverse -124 -143 -5.31042 0.244
NP_442140.1_3 Forward -301 -291 17.4829 0.0159
NP_442140.1_3 Forward -140 -130 17.4829 0.0159
NP_442140.1_3 Reverse -133 -143 13.5497 0.0542
NP_442140.1_3 Reverse -294 -304 4.69992 0.238
NP_442140.1_3 Reverse -196 -206 4.69992 0.238
NP_440875.1_9 Reverse -295 -305 16.5483 0.0145
NP_440875.1_9 Forward -300 -290 15.2829 0.0295
NP_440875.1_9 Forward -139 -129 9.44274 0.233
NP_440875.1_9 Reverse -134 -144 9.3454 0.233
NP_441813.1_5 Forward -304 -294 18.1713 0.00743
NP_441813.1_5 Reverse -291 -301 10.0098 0.0208
NP_441813.1_5 Reverse -130 -140 10.0098 0.0208
NP_441813.1_5 Forward -143 -133 8.73149 0.0367
NP_440590.1_4 Forward -301 -288 22.0454 0.00377
NP_440590.1_4 Forward -140 -127 10.344 0.0283
NP_440590.1_4 Reverse -294 -307 4.44418 0.0601
NP_440590.1_4 Forward -212 -199 -1.16069 0.212
NP_440590.1_4 Reverse -133 -146 -4.01229 0.257
NP_440567.1_1 Forward -140 -126 20.4524 0.012
NP_440567.1_1 Forward -301 -287 18.8791 0.0136
NP_440567.1_1 Reverse -133 -147 15.8309 0.0166
NP_440567.1_1 Reverse -294 -308 0.392915 0.246
NP_442497.1_10 Reverse -294 -303 17.601 0.00813
NP_442497.1_10 Forward -301 -292 10.4228 0.0087
NP_442497.1_10 Forward -140 -131 10.4228 0.0087
NP_442497.1_10 Reverse -133 -142 10.4228 0.0087
NP_440821.1_4 Reverse -291 -301 18.7612 0.00422
NP_440821.1_4 Reverse -130 -140 18.7612 0.00422
NP_440821.1_4 Forward -143 -133 17.9746 0.00497
NP_440821.1_4 Forward -304 -294 2.24165 0.131
NP_440927.1_1 Reverse -281 -300 19.8623 0.0721
NP_441239.1_9 Reverse -291 -303 16.0669 0.0175
NP_441239.1_9 Reverse -130 -142 16.0669 0.0175
NP_441239.1_9 Forward -304 -292 15.5753 0.0186
NP_441239.1_9 Forward -143 -131 9.67541 0.0987
NP_441239.1_9 Reverse -251 -263 2.98891 0.3
NP_441951.1_4 Reverse -255 -274 6.29264 0.273
NP_441009.1_4 Reverse -293 -312 11.1109 0.26
NP_441727.1_3 Forward -148 -129 5.30933 0.254
NP_441727.1_8 Reverse -127 -146 11.7008 0.112
NP_441892.1_1 Reverse -284 -301 2.79211 0.135
NP_441892.1_1 Forward -311 -294 -0.157821 0.179
NP_440604.1_6 Reverse -293 -312 5.50599 0.117
NP_442044.1_1 Reverse -127 -146 2.55606 0.142
NP_442044.1_1 Forward -307 -288 -11.1119 0.271
NP_442193.1_8 Reverse -290 -309 15.5349 0.211
NP_442193.1_8 Reverse -271 -290 9.24175 0.299
NP_441508.1_1 Reverse -65 -84 11.1342 0.26
NP_441508.1_4 Reverse -379 -393 14.7174 0.277
NP_442643.1_1 Reverse -126 -145 -10.7186 0.231
NP_442138.1_9 Reverse -380 -399 11.8967 0.202
NP_440546.1_4 Reverse -293 -303 13.5365 0.0459
NP_440546.1_4 Forward -302 -292 11.8882 0.0679
NP_440546.1_4 Forward -141 -131 11.8882 0.0679
NP_440546.1_4 Reverse -132 -142 10.046 0.109
NP_440546.1_6 Forward -312 -293 8.35759 0.259
NP_442041.1_2 Forward -315 -297 18.702 0.153
NP_442041.1_3 Forward -214 -196 20.767 0.0477
NP_441230.1_5 Reverse -288 -307 13.3725 0.0635
NP_440462.1_6 Forward -304 -294 18.7612 0.00454
NP_440462.1_6 Reverse -291 -301 17.9746 0.00578
NP_440462.1_6 Reverse -130 -140 17.9746 0.00578
NP_440462.1_6 Forward -143 -133 10.3048 0.0396
NP_440462.1_6 Reverse -16 -26 1.74999 0.294
NP_442611.1_1 Forward -307 -288 4.52268 0.194
NP_442611.1_1 Reverse -293 -312 4.52268 0.194
NP_442611.1_1 Reverse -132 -151 -1.27885 0.279
NP_440868.1_4 Forward -145 -133 16.4603 0.0149
NP_440868.1_4 Reverse -289 -301 12.527 0.0235
NP_440868.1_4 Reverse -128 -140 9.97041 0.0405
NP_440868.1_4 Forward -306 -294 8.00379 0.0602
NP_442499.1_1 Reverse -133 -152 7.17762 0.203
NP_442499.1_3 Reverse -131 -149 22.4386 0.0396
NP_442499.1_3 Forward -372 -354 3.65739 0.289
NP_441879.1_1 Forward -218 -199 2.45773 0.237
NP_442402.1_2 Forward -369 -355 10.5204 0.292
NP_441084.1_6 Reverse -384 -398 13.9981 0.114
NP_441084.1_6 Forward -304 -290 11.768 0.188
NP_440653.1_10 Forward -313 -294 6.98095 0.203
NP_440696.1_3 Reverse -289 -307 -2.73412 0.279
NP_440696.1_6 Forward -319 -300 4.71934 0.285
NP_442039.1_4 Forward -301 -294 15.1821 0.0124
NP_442039.1_4 Reverse -294 -301 15.1821 0.0124
NP_442039.1_4 Forward -140 -133 15.1821 0.0124
NP_442039.1_4 Reverse -133 -140 15.1821 0.0124
NP_441811.1_8 Reverse -126 -140 5.60446 0.294
NP_442837.1_3 Forward -301 -294 15.7721 0.0124
NP_442837.1_3 Reverse -294 -301 15.7721 0.0124
NP_442837.1_3 Forward -140 -133 15.7721 0.0124
NP_442837.1_3 Reverse -133 -140 15.7721 0.0124
NP_442053.1_1 Forward -302 -293 18.3876 0.0007
NP_442053.1_1 Reverse -293 -302 18.3876 0.0007
NP_442053.1_1 Forward -141 -132 18.3876 0.0007
NP_442053.1_1 Reverse -132 -141 18.3876 0.0007
NP_440505.1_3 Forward -304 -294 17.188 0.00332
NP_440505.1_3 Forward -143 -133 16.598 0.00683
NP_440505.1_3 Reverse -291 -301 14.1397 0.0235
NP_440505.1_3 Reverse -130 -140 14.1397 0.0235
NP_440505.1_3 Forward -291 -281 10.4031 0.108
NP_440505.1_7 Forward -393 -374 6.98095 0.162
NP_440505.1_7 Reverse -286 -305 4.52268 0.197
NP_440505.1_7 Forward -306 -287 0.982764 0.253
NP_441203.1_1 Reverse -294 -313 -12.7836 0.145
NP_441203.1_1 Forward -301 -282 -20.2567 0.297
NP_442471.1_6 Reverse -154 -173 16.6174 0.159
NP_442532.1_7 Forward -141 -127 8.16106 0.171
NP_442532.1_7 Forward -302 -288 7.86607 0.171
NP_441408.2_7 Reverse -291 -310 -4.6221 0.283
NP_440914.1_1 Reverse -132 -142 17.5935 0.000537
NP_440914.1_1 Reverse -293 -303 16.3248 0.00196
NP_440914.1_1 Forward -302 -292 8.6151 0.186
NP_440914.1_1 Forward -141 -131 8.6151 0.186
NP_441011.1_8 Forward -301 -292 16.9127 0.00602
NP_441011.1_8 Forward -140 -131 16.9127 0.00602
NP_441011.1_8 Reverse -294 -303 16.6177 0.00602
NP_441011.1_8 Reverse -133 -142 8.25953 0.144
NP_442533.1_6 Forward -302 -293 17.2076 0.00137
NP_442533.1_6 Reverse -293 -302 17.2076 0.00137
NP_442533.1_6 Forward -141 -132 17.2076 0.00137
NP_442533.1_6 Reverse -132 -141 17.2076 0.00137
NP_442533.1_6 Forward -262 -253 1.96635 0.28
NP_442232.1_3 Forward -310 -291 1.96607 0.11
NP_442232.1_3 Reverse -285 -304 -13.3736 0.282
NP_441482.1_7 Forward -308 -294 25.8606 0.00249
NP_441482.1_7 Reverse -126 -140 -10.6202 0.211
NP_441482.1_7 Forward -147 -133 -10.7185 0.213
NP_439944.1_9 Reverse -133 -143 19.1546 0.00329
NP_439944.1_9 Forward -301 -291 10.4031 0.0887
NP_439944.1_9 Forward -140 -130 10.4031 0.0887
NP_439944.1_9 Reverse -294 -304 9.12481 0.1
NP_441028.1_6 Reverse -166 -176 6.76441 0.23
NP_442202.1_4 Forward -143 -129 15.9379 0.161
NP_441527.1_4 Reverse -51 -70 -2.81744 0.161
NP_441527.1_4 Reverse -7 -26 -7.40105 0.232
NP_440115.1_6 Forward -144 -134 18.9579 0.0139
NP_440115.1_6 Forward -305 -295 14.0414 0.0615
NP_440115.1_6 Reverse -290 -300 9.61647 0.115
NP_440007.1_9 Reverse -270 -284 7.37441 0.211
NP_440007.1_9 Forward -306 -292 2.06454 0.281
NP_439965.1_1 Forward -311 -292 -6.09707 0.211
NP_441680.1_4 Forward -304 -285 -0.885524 0.256
NP_441347.1_5 Forward -147 -133 14.0603 0.238
NP_442492.1_2 Reverse -293 -312 0.687771 0.241
NP_440608.1_6 Reverse -133 -152 4.91521 0.256
NP_441602.1_3 Forward -307 -288 11.2092 0.111
NP_441602.1_3 Reverse -288 -307 5.30933 0.142
NP_441602.1_3 Forward -146 -127 -0.983855 0.226
NP_441602.1_3 Reverse -127 -146 -3.14714 0.241
NP_441972.1_5 Forward -301 -282 -6.68705 0.233
NP_441972.1_5 Reverse -294 -313 -6.68705 0.233
NP_441106.1_1 Forward -303 -294 18.486 0.0028
NP_441106.1_1 Reverse -292 -301 18.191 0.0028
NP_441106.1_1 Reverse -131 -140 18.191 0.0028
NP_441106.1_1 Forward -142 -133 9.63616 0.0311
NP_440429.1_2 Forward -307 -288 12.2908 0.218
NP_439903.1_6 Reverse -271 -290 2.45694 0.226
NP_442588.1_6 Forward -332 -313 3.24438 0.219
NP_442306.1_10 Forward -146 -127 -10.227 0.11
NP_442306.1_10 Forward -307 -288 -19.0768 0.197
NP_441186.1_4 Reverse -5 -15 15.3192 0.238
NP_441286.1_1 Forward -142 -130 14.7886 0.00418
NP_441286.1_1 Reverse -131 -143 12.1337 0.0104
NP_441286.1_1 Forward -303 -291 5.34885 0.0259
NP_441286.1_1 Reverse -292 -304 -3.59927 0.145
NP_440670.1_8 Forward -302 -293 18.3876 0.000699
NP_440670.1_8 Reverse -293 -302 18.3876 0.000699
NP_440670.1_8 Forward -141 -132 18.3876 0.000699
NP_440670.1_8 Reverse -132 -141 18.3876 0.000699
NP_440670.1_8 Forward -213 -204 3.44131 0.267
NP_440886.1_7 Reverse -292 -302 17.7774 0.0011
NP_440886.1_7 Reverse -131 -141 17.7774 0.0011
NP_440886.1_7 Forward -303 -293 8.04271 0.0805
NP_440886.1_7 Forward -142 -132 7.94438 0.0805
NP_440886.1_7 Forward -245 -235 7.64939 0.0865
NP_440886.1_7 Forward -208 -198 6.17443 0.141
NP_440828.1_4 Forward -214 -195 -3.83621 0.245
NP_442614.1_2 Reverse -132 -146 9.2427 0.242
NP_440404.1_9 Forward -176 -157 9.97848 0.218
NP_442072.1_9 Forward -142 -124 -12.4689 0.0852
NP_442072.1_9 Forward -303 -285 -12.9605 0.095
NP_442401.1_2 Forward -214 -195 7.96345 0.254
NP_441753.1_10 Reverse -371 -390 6.39097 0.186
NP_441753.1_10 Reverse -123 -142 3.93269 0.204
NP_441808.1_8 Reverse -195 -214 5.80098 0.295
NP_442022.1_4 Reverse -195 -214 5.40766 0.286
NP_440907.2_8 Forward -301 -291 17.4824 0.00685
NP_440907.2_8 Forward -140 -130 17.4824 0.00685
NP_440907.2_8 Reverse -133 -143 10.8943 0.0969
NP_440907.2_8 Reverse -294 -304 9.616 0.103
NP_442264.1_2 Forward -151 -134 13.0185 0.156
NP_441463.1_3 Forward -151 -132 -2.26216 0.152
NP_441463.1_3 Reverse -122 -141 -10.1286 0.289
NP_441463.1_6 Forward -143 -129 5.83613 0.287
NP_441626.1_2 Forward -301 -294 15.7721 0.0124
NP_441626.1_2 Reverse -294 -301 15.7721 0.0124
NP_441626.1_2 Forward -140 -133 15.7721 0.0124
NP_441626.1_2 Reverse -133 -140 15.7721 0.0124
NP_442365.1_5 Reverse -133 -152 6.09597 0.296
NP_442365.1_7 Forward -145 -126 14.1591 0.0723
NP_442365.1_7 Forward -306 -287 -2.16383 0.199
NP_442794.1_1 Forward -306 -294 10.5604 0.0721
NP_442794.1_1 Forward -145 -133 3.18557 0.286
NP_442794.1_5 Reverse -290 -304 12.1926 0.275
NP_442615.1_1 Forward -150 -132 4.54237 0.0452
NP_442615.1_1 Forward -311 -293 1.88744 0.0783
NP_442615.1_1 Reverse -123 -141 0.609134 0.0999
NP_442615.1_1 Reverse -284 -302 -0.865831 0.122
NP_441962.1_4 Reverse -127 -146 14.5524 0.0362
NP_441962.1_4 Reverse -196 -215 -6.09707 0.175
NP_441962.1_4 Forward -146 -127 -6.29373 0.175
NP_441962.1_4 Forward -307 -288 -7.86702 0.195
NP_440387.1_1 Forward -141 -125 24.4446 0.00118
NP_440387.1_1 Reverse -132 -148 13.3332 0.00865
NP_440387.1_1 Forward -302 -286 7.53169 0.0282
NP_440387.1_1 Reverse -293 -309 5.36841 0.0325
NP_441431.1_2 Forward -305 -291 13.1753 0.0952
NP_441431.1_2 Reverse -290 -304 11.1104 0.146
NP_441431.1_2 Forward -144 -130 8.16044 0.222
NP_441431.1_2 Reverse -129 -143 8.06211 0.226
NP_441488.1_7 Forward -308 -289 6.39097 0.142
NP_441488.1_8 Forward -307 -293 9.04542 0.169
NP_441836.1_2 Reverse -126 -145 24.4839 0.00577
NP_441836.1_2 Reverse -287 -306 0.0977854 0.208
NP_440634.1_8 Forward -204 -185 12.0933 0.111
NP_441993.1_1 Reverse -287 -306 4.38312 0.221
NP_441174.1_2 Forward -305 -291 19.8624 0.00567
NP_441174.1_2 Forward -144 -130 19.1741 0.0138
NP_440114.1_10 Forward -141 -127 12.1926 0.0885
NP_442323.1_7 Forward -307 -288 5.60352 0.203
NP_442323.1_7 Reverse -288 -307 1.6703 0.278
NP_440766.1_4 Reverse -289 -303 8.06273 0.0871
NP_440766.1_4 Forward -306 -292 7.76774 0.0871
NP_440766.1_4 Forward -145 -131 7.57108 0.09
NP_440766.1_5 Reverse -4 -16 11.8574 0.252
NP_439988.1_7 Forward -139 -125 15.8302 0.292
NP_439988.1_7 Reverse -131 -145 13.4703 0.292
NP_439988.1_7 Forward -300 -286 12.192 0.292
NP_441237.1_9 Reverse -133 -143 14.9263 0.0242
NP_442743.1_4 Forward -301 -282 -0.0988766 0.174
NP_442743.1_4 Reverse -294 -313 -1.08219 0.187
NP_440457.1_1 Reverse -128 -140 7.90546 0.101
NP_440457.1_1 Forward -306 -294 7.70879 0.101
NP_440457.1_1 Reverse -289 -301 7.21714 0.105
NP_440457.1_1 Reverse -191 -203 4.95553 0.15
NP_440457.1_1 Forward -145 -133 -0.452677 0.263
NP_440798.1_6 Forward -301 -288 13.3923 0.0445
NP_440798.1_6 Forward -140 -127 2.87088 0.159
NP_440801.1_10 Reverse -191 -210 4.62101 0.289
NP_442509.1_9 Forward -302 -292 16.2041 0.00739
NP_442509.1_9 Forward -141 -131 16.2041 0.00739
NP_442509.1_9 Reverse -132 -142 8.14104 0.192
NP_442509.1_9 Reverse -293 -303 8.04271 0.192
NP_441489.1_3 Reverse -4 -18 8.89237 0.232
NP_442514.1_5 Reverse -297 -316 -0.29631 0.182
NP_442514.1_5 Reverse -252 -271 -8.85106 0.29
NP_440554.1_4 Reverse -294 -304 17.9746 0.0131
NP_440554.1_4 Forward -301 -291 13.943 0.0218
NP_440554.1_4 Forward -140 -130 13.943 0.0218
NP_440554.1_4 Reverse -133 -143 6.37155 0.123
NP_442737.1_5 Reverse -81 -100 14.2364 0.199
NP_441885.1_5 Reverse -132 -142 20.9245 0.000538
NP_441885.1_5 Forward -302 -292 11.4848 0.00668
NP_441885.1_5 Forward -141 -131 11.4848 0.00668
NP_441885.1_5 Reverse -293 -303 11.3864 0.00668
NP_440478.1_4 Forward -306 -287 10.7175 0.267
NP_440478.1_10 Reverse -291 -305 14.5526 0.107
NP_440478.1_10 Reverse -130 -144 7.47274 0.262
NP_442341.1_7 Reverse -131 -145 14.6509 0.0277
NP_442341.1_7 Forward -303 -289 13.1759 0.0376
NP_442341.1_7 Forward -142 -128 11.6026 0.0534
NP_442341.1_7 Reverse -292 -306 1.67122 0.282
NP_441756.1_5 Reverse -289 -308 4.32602 0.199
NP_441756.1_5 Reverse -287 -306 -5.11376 0.298
NP_441173.1_9 Forward -122 -114 10.9338 0.242
NP_442395.2_4 Reverse -292 -311 16.9115 0.042
NP_443000.1_7 Forward -304 -294 20.3345 0.00223
NP_443000.1_7 Forward -143 -133 10.4031 0.0345
NP_443000.1_7 Reverse -291 -301 2.04498 0.226
NP_443000.1_7 Reverse -130 -140 2.04498 0.226
NP_440507.2_3 Forward -150 -131 13.2733 0.145
NP_441842.1_1 Forward -300 -287 16.2433 0.0484
NP_441842.1_10 Reverse -286 -300 22.5174 0.00642
NP_441842.1_10 Reverse -125 -139 9.04604 0.2
NP_440275.1_3 Reverse -291 -301 17.9746 0.0082
NP_440275.1_3 Reverse -130 -140 17.9746 0.0082
NP_440275.1_3 Forward -143 -133 17.6796 0.0102
NP_440275.1_3 Forward -304 -294 16.1063 0.0155
NP_440275.1_3 Forward -215 -205 1.84832 0.282
NP_440091.1_1 Reverse -128 -140 12.7237 0.0353
NP_440091.1_1 Reverse -289 -301 10.1671 0.0498
NP_440091.1_1 Forward -145 -133 1.41561 0.197
NP_443010.1_10 Reverse -129 -146 6.15298 0.192
NP_441359.1_5 Forward -305 -286 8.16093 0.167
NP_442451.1_2 Forward -310 -291 -7.86702 0.24
NP_442451.1_2 Reverse -285 -304 -10.227 0.265
NP_439962.1_4 Reverse -285 -304 -0.197208 0.197
NP_439962.1_4 Reverse -124 -143 -5.9004 0.28
NP_439962.1_4 Forward -310 -291 -7.76869 0.29
NP_440175.1_7 Reverse -289 -307 12.0957 0.228
NP_442495.1_4 Reverse -297 -307 14.4347 0.16
NP_440149.1_8 Forward -302 -283 -5.70374 0.231
NP_440149.1_8 Reverse -293 -312 -8.16202 0.3
NP_441105.1_3 Forward -313 -294 8.45592 0.0484
NP_441105.1_3 Reverse -282 -301 5.80098 0.0654
NP_440216.1_1 Forward -302 -288 8.55439 0.00592
NP_440216.1_1 Reverse -293 -307 7.27608 0.00942
NP_440216.1_1 Forward -141 -127 6.58777 0.0145
NP_440216.1_1 Reverse -132 -146 -10.4235 0.145
NP_440216.1_6 Reverse -286 -302 15.2998 0.0619
NP_440678.1_9 Reverse -127 -146 8.16093 0.279
NP_440172.1_1 Reverse -293 -303 17.5813 0.00421
NP_440172.1_1 Reverse -132 -142 15.0247 0.00945
NP_440172.1_1 Forward -302 -292 8.73149 0.0586
NP_440172.1_1 Forward -141 -131 8.73149 0.0586
NP_441008.1_4 Forward -213 -194 15.2521 0.295
NP_442015.1_10 Forward -306 -293 13.4906 0.0354
NP_442015.1_10 Reverse -289 -302 12.9006 0.0365
NP_442015.1_10 Reverse -301 -314 2.96921 0.187
NP_442015.1_10 Forward -145 -132 2.37923 0.193
NP_441226.1_7 Forward -301 -294 14.4934 0.0123
NP_441226.1_7 Reverse -294 -301 14.4934 0.0123
NP_441226.1_7 Forward -140 -133 14.4934 0.0123
NP_441226.1_7 Reverse -133 -140 14.4934 0.0123
NP_441226.1_7 Forward -244 -237 5.64364 0.286
NP_441111.1_7 Forward -301 -293 18.7023 0.00294
NP_441111.1_7 Forward -140 -132 18.7023 0.00294
NP_441111.1_7 Reverse -294 -302 18.7023 0.00294
NP_441111.1_7 Reverse -133 -141 18.7023 0.00294
NP_442379.1_10 Reverse -125 -142 0.137172 0.223
NP_442379.1_10 Reverse -286 -303 -2.91109 0.245
NP_441766.1_2 Forward -302 -293 17.5026 0.00297
NP_441766.1_2 Reverse -293 -302 17.5026 0.00297
NP_441766.1_2 Forward -141 -132 17.5026 0.00297
NP_441766.1_2 Reverse -132 -141 17.5026 0.00297
NP_442417.1_5 Reverse -293 -307 6.98109 0.197
NP_440416.1_1 Reverse -132 -151 -5.40875 0.154
NP_440416.1_1 Reverse -293 -312 -11.7019 0.272
NP_440416.1_9 Reverse -286 -305 4.42435 0.0355
NP_440416.1_9 Forward -309 -290 4.03102 0.0355
NP_440416.1_9 Reverse -125 -144 -14.8485 0.18
NP_443052.1_8 Forward -151 -132 -1.57384 0.0805
NP_443052.1_8 Reverse -122 -141 -5.01543 0.125
NP_443052.1_8 Reverse -283 -302 -5.21209 0.127
NP_442403.1_9 Forward -153 -134 6.29264 0.193
NP_440591.1_9 Reverse -286 -304 4.14905 0.288
NP_442154.1_1 Reverse -196 -214 -5.29072 0.127
NP_442154.1_1 Forward -149 -131 -15.4188 0.218
NP_442154.1_1 Reverse -193 -211 -15.8121 0.225
NP_442154.1_1 Forward -158 -140 -18.4671 0.282
NP_442154.1_6 Reverse -191 -210 0.982764 0.296
NP_441430.1_6 Reverse -288 -307 15.4374 0.143
NP_440261.1_5 Reverse -133 -146 8.37742 0.0263
NP_440261.1_5 Forward -301 -288 6.80412 0.0316
NP_440261.1_5 Reverse -294 -307 -2.73398 0.0924
NP_440261.1_5 Forward -140 -127 -10.5021 0.201
NP_440988.1_10 Reverse -130 -144 8.4809 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAATTGCCGCTGGTTTTTGCCGCCTGACTGGTTATGTTCTCCACCCCCAAGCATTACAACGAGTTAAAGATACCCAAGCTCTGTTTGGTCTTAGCCCAGGCGATCGCCGCCGGGAATTGCAATCAGCTTTAGCCACGGGGCCAGGGTTTAACACTCGCCGACCCTGGTTGATTTTGGATGATATTATTACGACCGGCACCACCGCCCTAGAAGCCCGACGGATAATGGAAGAAAAGGGAGCTAAAGTGTTGGGTATCGTGGCGATCGCCGCACCGTCTTTTTCCCAGCCCATGGAACTTAGACAGCAATGATAATGATCATTTAACATAATATTTCTGTTGGTCTGTATTCAATCTCGTATTGTTAAAGCCCTATCGTTCCCTTTATTTTTGTCAATCCT

CDS

ATGCAGAAACAAGTCTCTCCCCTAGCCCGTGTCGCCCTTTGGTTGGGTGGTGTTAGTTTGACTGCAACCAGCTTGGTCATTCCCACCGCGGCCCAGGCCCAAAGTAGTCTCAATGGAGGTAGTGCCATTCCTCCTTTGAAGCCGATTCCCGAATCTACCTACACTCCTCCTGCTGCTCCCACCAGTACCCCTAGCAATCCAACTAGCCAGGCCTTGGCCACCCATATTGTGCTGGTACTGGGAGAACGGAAAGTTTACGCCTACCAAAACGATAAAGTTTTAGCAAGTTACCCGGTGGCAGTGGGCAAAAAAGGCTGGGAAACACCCCAAGGCAATTTCCAAGTAATCCAAATGGTGGAAAATCCCGTGTGGGAAAATCCCTGGAATGGCAAAAAAGTGGCCGCCAGCTTGGATGGTCCCATCGGTATCCGTTGGATCGGTTTTTGGAGTGACGGTAAAAATACCATTGGTTTCCATGGCACCCCGAAAAAACATGAGCATTTCCTGGGCACAGCGGCTTCCCACGGTTGCGTCAGAATGCGAAATCAAGATGTGGTGGCTTTGTTCAACATGGTGCAAAATGGCACCCCAGTGCGGGTAGTGCAGAAAAAATAG

Protein

MQKQVSPLARVALWLGGVSLTATSLVIPTAAQAQSSLNGGSAIPPLKPIPESTYTPPAAPTSTPSNPTSQALATHIVLVLGERKVYAYQNDKVLASYPVAVGKKGWETPQGNFQVIQMVENPVWENPWNGKKVAASLDGPIGIRWIGFWSDGKNTIGFHGTPKKHEHFLGTAASHGCVRMRNQDVVALFNMVQNGTPVRVVQKK