Your browser is old and dusty. Try Google Chrome!

Details for slr0747

ORF slr0747
Accession NP_442929.1
Symbol ggtA
Category glucosylglycerol transport system ATP-binding protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -116 -130 -2.16369 0.285
NP_440815.1_5 Forward -287 -268 12.9791 0.193
NP_440897.1_6 Reverse -197 -216 -3.14789 0.233
NP_441453.1_7 Reverse -330 -337 12.9205 0.23
NP_441623.1_1 Forward -162 -144 2.28076 0.206
NP_442151.1_6 Reverse -197 -211 10.816 0.114
NP_440150.1_6 Reverse -158 -177 0.687771 0.296
NP_442752.1_4 Forward -383 -376 5.44732 0.202
NP_441812.1_2 Forward -399 -380 18.9773 0.222
NP_440061.1_9 Reverse -159 -173 9.83206 0.137
NP_440061.1_9 Reverse -195 -209 7.27547 0.213
NP_441054.1_1 Reverse -196 -210 18.2892 0.129
NP_442062.1_8 Forward -238 -228 8.82982 0.0709
NP_440044.1_8 Reverse -198 -217 -2.16383 0.261
NP_441594.1_6 Forward -294 -275 4.71934 0.214
NP_442276.1_2 Reverse -185 -204 5.01433 0.295
NP_441925.1_4 Reverse -257 -276 -9.04772 0.213
NP_440014.1_2 Forward -391 -373 12.5072 0.236
NP_441083.1_5 Reverse -374 -384 4.79825 0.13
NP_441083.1_5 Reverse -251 -261 4.10993 0.158
NP_441738.1_2 Forward -321 -314 11.8385 0.0469
NP_441738.1_2 Reverse -376 -383 10.2652 0.101
NP_442570.1_3 Reverse -275 -294 -0.197208 0.208
NP_441716.1_1 Reverse -161 -175 6.29277 0.202
NP_441327.1_5 Reverse -1 -10 16.2243 0.164
NP_442111.1_3 Reverse -1 -14 15.245 0.2
NP_440747.1_10 Forward -263 -251 -12.4491 0.282
NP_441486.1_1 Reverse -311 -325 -4.4253 0.198
NP_440403.1_4 Reverse -268 -287 -7.37537 0.241
NP_440842.1_2 Forward -181 -163 13.4905 0.201
NP_441014.1_8 Reverse -258 -277 -9.24366 0.293
NP_443018.1_3 Forward -237 -230 8.49558 0.141
NP_441634.1_8 Reverse -195 -209 -4.62196 0.295
NP_440376.1_1 Reverse -161 -170 3.24465 0.206
NP_440376.1_1 Reverse -277 -286 1.76968 0.242
NP_440376.1_1 Forward -260 -251 1.47469 0.251
NP_440376.1_1 Forward -383 -374 -0.000272808 0.285
NP_441077.1_6 Reverse -20 -36 9.83957 0.164
NP_442530.1_2 Reverse -1 -11 15.2213 0.203
NP_440533.1_9 Forward -203 -184 6.78429 0.189
NP_442658.1_1 Forward -288 -278 8.73102 0.181
NP_440141.1_8 Forward -391 -372 4.916 0.278
NP_441414.1_9 Forward -383 -364 -9.73531 0.266
NP_439968.1_2 Reverse -272 -291 12.7816 0.287
NP_441256.1_8 Forward -389 -370 6.09597 0.268
NP_442321.1_4 Reverse -225 -244 -7.76869 0.284
NP_442836.1_10 Forward -382 -372 13.1564 0.227
NP_440203.1_5 Forward -320 -310 8.82935 0.283
NP_441754.1_6 Forward -305 -286 14.2574 0.144
NP_439905.1_1 Reverse -198 -211 14.8673 0.106
NP_440984.1_7 Forward -211 -197 9.34103 0.127
NP_441591.1_10 Forward -278 -259 6.29264 0.286
NP_440993.1_3 Reverse -190 -209 1.57197 0.226
NP_442002.1_1 Forward -392 -374 -0.669169 0.192
NP_442002.1_9 Forward -287 -280 12.2322 0.185
NP_440809.1_9 Forward -96 -78 -9.0273 0.291
NP_440411.1_10 Forward -274 -255 10.0665 0.279
NP_441110.1_1 Forward -269 -250 6.98095 0.242
NP_440147.1_4 Reverse -159 -172 -0.472371 0.287
NP_441550.1_8 Forward -172 -162 4.60114 0.299
NP_441041.1_4 Forward -170 -151 -3.63879 0.124
NP_442004.1_3 Forward -174 -155 16.8141 0.156
NP_440703.1_9 Reverse -257 -270 4.44361 0.298
NP_440674.1_3 Reverse -235 -254 2.16274 0.267
NP_440260.1_8 Forward -222 -204 -1.84914 0.24
NP_440260.1_8 Reverse -152 -170 -5.38906 0.273
NP_440260.1_8 Reverse -247 -265 -6.56903 0.293
NP_442281.1_1 Reverse -192 -206 2.26061 0.272
NP_442281.1_1 Forward -321 -307 1.96562 0.282
NP_440437.1_1 Reverse -255 -274 1.27776 0.153
NP_442012.1_1 Reverse -257 -276 -0.688862 0.265
NP_440498.1_5 Forward -397 -379 25.9359 0.00334
NP_441644.1_6 Forward -206 -196 10.6976 0.0628
NP_441644.1_6 Reverse -197 -207 4.10949 0.249
NP_442215.1_2 Forward -347 -331 3.10679 0.102
NP_442215.1_2 Reverse -321 -337 -1.51476 0.186
NP_442215.1_2 Forward -208 -192 -2.10475 0.192
NP_442215.1_2 Reverse -195 -211 -5.34967 0.249
NP_441346.1_7 Reverse -311 -330 12.2908 0.203
NP_442933.1_1 Forward -27 -8 8.73709 0.253
NP_442933.1_2 Reverse -14 -32 9.74216 0.257
NP_442933.1_3 Forward -29 -10 15.899 0.261
NP_442933.1_5 Forward -123 -104 8.94757 0.289
NP_442671.1_2 Reverse -19 -38 0.501445 0.276
NP_442554.1_8 Reverse -198 -208 6.37155 0.12
NP_442554.1_8 Forward -205 -195 3.42162 0.226
NP_442554.1_8 Reverse -162 -172 2.14332 0.281
NP_442142.1_4 Reverse -127 -140 5.13193 0.201
NP_441020.2_7 Reverse -257 -276 10.52 0.252
NP_441015.1_10 Forward -275 -256 -3.54046 0.19
NP_441731.1_9 Reverse -300 -317 10.7569 0.282
NP_442253.1_7 Forward -221 -207 15.4376 0.226
NP_441637.1_9 Reverse -358 -376 -2.24246 0.292
NP_442868.1_6 Forward -288 -278 2.33998 0.205
NP_441251.1_7 Reverse -387 -400 15.4572 0.266
NP_441251.1_8 Reverse -34 -47 12.8577 0.257
NP_441612.1_2 Forward -206 -196 8.25885 0.228
NP_442559.1_9 Reverse -156 -175 22.123 0.0171
NP_442808.1_1 Reverse -373 -383 7.35439 0.0814
NP_442808.1_1 Reverse -248 -258 3.12618 0.248
NP_442342.1_9 Forward -172 -156 8.12167 0.194
NP_440558.1_2 Forward -295 -276 -7.4737 0.294
NP_441878.1_6 Reverse -160 -170 0.963343 0.128
NP_441878.1_6 Forward -273 -263 0.963343 0.128
NP_441878.1_6 Forward -207 -197 0.668351 0.139
NP_441878.1_6 Reverse -196 -206 0.57002 0.14
NP_441878.1_6 Forward -171 -161 -0.0199663 0.163
NP_441557.1_2 Reverse -368 -386 13.8838 0.288
NP_441520.1_5 Forward -111 -92 11.3075 0.208
NP_442183.1_1 Forward -383 -369 5.1128 0.231
NP_441574.1_1 Reverse -149 -168 -3.63879 0.241
NP_441638.1_8 Forward -385 -366 16.0274 0.277
NP_442645.1_2 Reverse -306 -325 -19.7651 0.288
NP_442645.1_2 Forward -246 -227 -19.7651 0.288
NP_442888.1_6 Forward -308 -289 2.16274 0.266
NP_441037.1_4 Forward -288 -278 6.05075 0.283
NP_442594.1_8 Forward -392 -373 1.96607 0.295
NP_441633.1_3 Reverse -275 -288 -4.40561 0.195
NP_442998.1_5 Reverse -142 -152 11.8781 0.176
NP_442998.1_5 Reverse -143 -153 10.6981 0.206
NP_442998.1_5 Forward -327 -317 10.3048 0.218
NP_442998.1_5 Forward -288 -278 8.23984 0.267
NP_441799.1_1 Forward -174 -160 6.78381 0.162
NP_441799.1_1 Forward -378 -364 6.58715 0.167
NP_441799.1_1 Forward -327 -313 5.40719 0.21
NP_441799.1_6 Forward -362 -343 14.9458 0.246
NP_442334.1_2 Forward -384 -367 -3.50107 0.2
NP_440256.1_1 Forward -279 -260 -2.55715 0.12
NP_441559.1_8 Reverse -361 -375 -3.93365 0.213
NP_441559.1_8 Reverse -245 -259 -5.60527 0.267
NP_440915.1_6 Reverse -157 -171 2.85119 0.111
NP_441179.1_9 Reverse -128 -138 9.71433 0.28
NP_440717.1_1 Reverse -198 -217 11.0125 0.217
NP_440717.1_3 Reverse -252 -266 11.2087 0.23
NP_442866.1_1 Forward -130 -111 -7.96535 0.274
NP_440026.1_4 Forward -275 -256 8.55425 0.268
NP_439985.1_7 Reverse -276 -295 2.55606 0.289
NP_440677.1_6 Reverse -106 -125 9.14423 0.27
NP_442386.1_9 Reverse -373 -382 7.37413 0.219
NP_442240.1_2 Reverse -268 -287 -19.5684 0.295
NP_440211.1_4 Forward -377 -367 14.1397 0.29
NP_440027.1_3 Reverse -257 -275 20.9628 0.0356
NP_440027.1_3 Forward -286 -268 5.03327 0.249
NP_439984.1_7 Reverse -244 -262 -4.11075 0.271
NP_441665.1_2 Reverse -317 -336 8.35759 0.248
NP_440408.1_7 Reverse -115 -134 9.53756 0.256
NP_440439.1_1 Forward -173 -160 -1.25902 0.259
NP_440378.1_5 Reverse -273 -292 19.3707 0.111
NP_440819.1_5 Reverse -142 -150 7.59091 0.272
NP_440316.1_10 Forward -267 -257 9.32148 0.235
NP_441803.1_2 Reverse -125 -144 1.17943 0.238
NP_441803.1_2 Reverse -169 -188 0.884433 0.243
NP_440139.1_1 Forward -244 -225 3.44025 0.205
NP_442384.1_10 Reverse -161 -174 1.9859 0.24
NP_442262.1_10 Forward -237 -230 8.59391 0.22
NP_440163.1_10 Reverse -200 -210 7.94484 0.297
NP_440531.1_6 Forward -214 -195 -4.13045 0.276
NP_440531.1_8 Forward -288 -269 1.96607 0.298
NP_441679.1_6 Forward -135 -116 -0.787193 0.273
NP_440888.1_2 Reverse -197 -211 5.60385 0.272
NP_440491.1_1 Forward -276 -257 8.0865 0.251
NP_439969.1_3 Reverse -156 -175 6.88262 0.162
NP_441748.1_3 Forward -214 -195 23.0496 0.0111
NP_441469.1_8 Forward -375 -366 5.70292 0.257
NP_441462.1_2 Reverse -161 -171 -0.904945 0.265
NP_440519.1_8 Forward -272 -256 2.71347 0.259
NP_442204.1_1 Forward -280 -269 1.04198 0.281
NP_440516.1_8 Forward -383 -374 -0.590259 0.283
NP_441443.1_1 Forward -384 -365 -2.75381 0.271
NP_442859.1_2 Reverse -230 -249 2.3594 0.28
NP_442120.1_10 Forward -130 -111 -15.1435 0.289
NP_441867.1_2 Forward -392 -373 -12.8819 0.27
NP_440603.1_9 Forward -185 -166 5.80098 0.278
NP_441052.1_2 Reverse -197 -207 11.4848 0.0285
NP_441052.1_2 Forward -206 -196 10.6981 0.0285
NP_442219.1_8 Forward -355 -336 11.8392 0.169
NP_441884.1_9 Reverse -194 -213 -24.2883 0.286
NP_440314.1_9 Reverse -366 -385 -5.99873 0.225
NP_441719.1_6 Reverse -371 -390 6.58682 0.269
NP_441004.1_2 Reverse -167 -186 -3.3438 0.277
NP_441004.1_5 Forward -387 -373 7.07942 0.292
NP_442813.1_4 Forward -148 -129 -7.17871 0.299
NP_442873.1_3 Reverse -241 -260 10.0284 0.176
NP_440296.1_10 Forward -261 -242 -6.29373 0.225
NP_443054.1_2 Forward -172 -158 -0.000409212 0.283
NP_441668.1_4 Forward -384 -365 2.0644 0.205
NP_441683.1_5 Reverse -111 -130 9.43923 0.248
NP_441349.1_10 Forward -184 -165 -9.83364 0.297
NP_442843.1_1 Forward -382 -363 -11.3086 0.288
NP_440431.1_4 Reverse -15 -34 -7.11457 0.262
NP_440431.1_4 Reverse -23 -42 -7.49654 0.262
NP_442450.1_5 Reverse -261 -271 9.7148 0.115
NP_442168.1_5 Reverse -278 -297 -1.57384 0.264
NP_440195.1_4 Forward -145 -126 5.11266 0.29
NP_442006.1_2 Forward -339 -322 3.0871 0.0846
NP_441003.1_9 Reverse -188 -207 9.14423 0.218
NP_441003.1_9 Forward -215 -196 8.84924 0.224
NP_442243.1_1 Forward -212 -194 0.0184138 0.238
NP_441570.1_1 Forward -286 -268 -11.3872 0.194
NP_441078.1_4 Forward -206 -197 -1.47524 0.266
NP_441078.1_4 Reverse -197 -206 -1.77023 0.266
NP_441078.1_4 Reverse -161 -170 -1.86856 0.272
NP_442348.1_2 Reverse -314 -323 7.17789 0.285
NP_442443.1_1 Forward -266 -247 -5.50708 0.282
NP_441432.1_8 Forward -207 -198 3.14632 0.259
NP_441333.1_1 Forward -34 -24 13.5918 0.217
NP_440760.1_1 Forward -374 -355 -22.2233 0.252
NP_442407.1_6 Forward -290 -271 8.94757 0.296
NP_440280.1_10 Reverse -163 -177 23.0083 0.0547
NP_440713.1_9 Forward -387 -368 15.4374 0.212
NP_442489.1_7 Reverse -161 -170 -1.37691 0.195
NP_442489.1_7 Forward -206 -197 -1.6719 0.235
NP_442489.1_7 Reverse -197 -206 -1.77023 0.247
NP_442913.1_10 Reverse -188 -207 3.14605 0.114
NP_442913.1_10 Forward -215 -196 -4.03212 0.225
NP_440708.1_6 Reverse -269 -288 -8.85033 0.259
NP_442346.1_5 Forward -207 -197 11.3864 0.0681
NP_442346.1_5 Reverse -196 -206 10.3048 0.101
NP_442929.1_10 Forward -381 -362 20.2548 0.131
NP_440486.1_6 Forward -273 -254 8.75091 0.235
NP_441653.1_3 Forward -218 -204 18.2892 0.145
NP_440010.1_4 Reverse -190 -209 -0.197979 0.25
NP_441943.1_8 Reverse -326 -345 -3.54046 0.183
NP_442551.1_4 Forward -208 -193 5.09311 0.242
NP_442551.1_4 Forward -347 -332 -1.69173 0.247
NP_440170.1_6 Forward -130 -111 18.3873 0.0959
NP_441329.1_6 Reverse -31 -50 -0.143661 0.266
NP_441329.1_6 Reverse -20 -39 -0.430137 0.275
NP_440671.1_4 Reverse -109 -123 9.34103 0.184
NP_442914.1_8 Forward -281 -262 11.2092 0.223
NP_441813.1_3 Forward -303 -284 14.8191 0.238
NP_441813.1_7 Forward -317 -303 10.1271 0.235
NP_442028.1_1 Forward -28 -15 7.03268 0.292
NP_440567.1_1 Reverse -278 -292 -0.590395 0.293
NP_441239.1_9 Forward -172 -160 5.05386 0.231
NP_441239.1_9 Reverse -159 -171 4.66053 0.248
NP_441892.1_1 Forward -247 -230 -4.38605 0.26
NP_442044.1_1 Reverse -116 -135 2.0644 0.147
NP_442193.1_1 Forward -345 -327 17.1287 0.117
NP_442193.1_8 Reverse -232 -251 11.3067 0.267
NP_440546.1_4 Reverse -161 -171 9.17338 0.151
NP_440675.1_1 Forward -276 -257 3.6377 0.251
NP_442340.1_3 Reverse -199 -218 -9.63698 0.275
NP_442840.1_5 Forward -394 -375 14.4541 0.159
NP_442402.1_2 Reverse -364 -378 12.6836 0.269
NP_442402.1_6 Forward -263 -254 13.4711 0.284
NP_442402.1_10 Forward -151 -141 13.4509 0.202
NP_442402.1_10 Reverse -368 -378 12.7626 0.204
NP_440696.1_3 Forward -276 -258 5.32902 0.198
NP_442679.1_1 Reverse -13 -32 -5.80207 0.298
NP_442409.1_10 Reverse -320 -334 16.7152 0.253
NP_440160.1_9 Reverse -115 -134 12.8808 0.216
NP_442053.1_1 Forward -170 -161 5.70292 0.172
NP_440505.1_3 Forward -262 -252 4.79825 0.266
NP_441959.1_8 Forward -400 -387 8.13085 0.298
NP_441252.1_6 Forward -378 -371 11.6422 0.288
NP_440914.1_1 Forward -286 -276 9.68861 0.178
NP_442533.1_1 Forward -275 -256 -17.7001 0.293
NP_442533.1_6 Forward -206 -197 13.9627 0.0155
NP_442533.1_6 Forward -170 -161 11.8978 0.0362
NP_442533.1_6 Reverse -197 -206 6.68623 0.105
NP_442533.1_6 Reverse -263 -272 4.42462 0.179
NP_442541.1_10 Reverse -257 -271 3.04726 0.254
NP_442541.1_10 Reverse -197 -211 1.67063 0.282
NP_443016.1_1 Reverse -191 -210 -5.80207 0.251
NP_441028.1_6 Reverse -244 -254 5.48612 0.255
NP_441028.1_6 Forward -150 -140 5.19112 0.265
NP_441527.1_4 Reverse -8 -27 -13.1306 0.298
NP_440115.1_6 Forward -289 -279 6.37155 0.186
NP_441680.1_4 Reverse -128 -147 0.196116 0.246
NP_441972.1_5 Forward -287 -268 -10.227 0.3
NP_440429.1_9 Forward -287 -268 0.884433 0.296
NP_441286.1_1 Reverse -276 -288 -6.15587 0.251
NP_441705.1_4 Forward -278 -259 8.45592 0.256
NP_441930.1_2 Forward -259 -249 11.2881 0.298
NP_440886.1_7 Reverse -373 -383 11.2876 0.0805
NP_440886.1_7 Reverse -250 -260 3.51951 0.279
NP_441399.1_10 Forward -273 -254 14.7491 0.209
NP_441753.1_10 Forward -179 -160 3.24438 0.219
NP_442022.1_4 Forward -142 -123 10.6192 0.224
NP_440907.2_8 Reverse -375 -385 3.91283 0.289
NP_441962.1_4 Forward -211 -192 -11.0136 0.236
NP_441431.1_2 Forward -173 -159 5.50552 0.298
NP_441858.1_10 Forward -344 -325 2.94938 0.292
NP_440287.1_5 Reverse -367 -386 6.48849 0.292
NP_442087.1_2 Forward -383 -364 17.1812 0.117
NP_441801.1_4 Reverse -253 -263 2.63497 0.29
NP_441332.1_6 Reverse -373 -383 13.7766 0.184
NP_442509.1_9 Forward -71 -61 7.35439 0.225
NP_442509.1_9 Reverse -374 -384 7.15773 0.234
NP_443037.1_7 Reverse -302 -321 -5.21209 0.276
NP_442439.1_8 Reverse -196 -215 8.45592 0.253
NP_442514.1_5 Forward -178 -159 -0.29631 0.182
NP_442862.1_3 Forward -400 -383 10.7569 0.202
NP_442341.1_7 Forward -171 -157 7.07942 0.111
NP_442341.1_7 Forward -207 -193 3.53951 0.22
NP_442341.1_7 Reverse -248 -262 1.08123 0.299
NP_441173.1_9 Reverse -370 -378 12.507 0.206
NP_441173.1_9 Forward -149 -141 10.9338 0.242
NP_442275.1_2 Reverse -261 -280 3.73603 0.265
NP_442451.1_2 Reverse -269 -288 -8.85033 0.254
NP_441122.1_1 Reverse -310 -325 11.9763 0.185
NP_440149.1_8 Forward -276 -257 -7.67036 0.29
NP_440216.1_1 Reverse -161 -175 -11.3085 0.178
NP_440216.1_6 Reverse -256 -272 6.84337 0.189
NP_440172.1_1 Reverse -314 -324 3.81494 0.216
NP_442371.1_1 Reverse -141 -151 15.4175 0.146
NP_440305.1_1 Reverse -22 -36 14.0489 0.233
NP_442379.1_10 Reverse -307 -324 -4.28772 0.291
NP_442417.1_5 Forward -170 -156 5.1128 0.275
NP_440416.1_9 Reverse -256 -275 -7.37537 0.0996
NP_440416.1_9 Forward -267 -248 -10.7186 0.145
NP_440416.1_9 Reverse -154 -173 -15.3402 0.189
NP_442403.1_8 Forward -225 -206 4.71934 0.226
NP_440591.1_9 Forward -267 -249 4.54237 0.275
NP_442154.1_1 Forward -188 -170 -6.07737 0.129
NP_440261.1_5 Reverse -198 -211 -4.9956 0.183
NP_440988.1_10 Reverse -195 -209 10.8044 0.187
NP_440988.1_10 Reverse -255 -269 10.1267 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATTAATCCAAGATTTGGGGGATTGGGGAAATCACGGTAACTTAGTGGTGTATGTGGACAGTTCCCAGGGGGAGGTGAAAAATCGCCAACCTCTACAACTAGAAACCGTGGCGGGGCAAACCCAAGTGGTGGCTGGCCCTGGGGATATGCGGGACAGGGAAGAGCCATTGAAGATCAATGTGGCTTTTCCTGGTGGCCATGACCAATATGTAGCGGCGTTTAAGCAGGCGGCCCAGCGCCGAAGAGTCCATTTTTCCCAGTAGTTATGGTGGTGAAGCCATTCTCCGTGGTCGAATTAAGTACCCATTAAGTACCTAATCTCCGGGTAGTATGAACGGGGTTACACCGGTTAGTTTTAACCGTTTGATTTTAATTTTTTGTTGTATCGTAATTTTTGCCT

CDS

ATGGCCAGTGTCAGTTTTGAACAGGTAACTAAACAGTTTGATGATTATGTTGCCGTTAATAACTTGAATTTGGAAATTGAGGACGGGGAGTTTTTAGTTTTTGTGGGGCCGTCTGGTTGCGGCAAAACTACCTCCCTACGACTTTTAGCCGGGCTGGAAACCGTTAGTCAAGGACAAATCTGCATTGGCGATCGCCGGGTGAATGAACTATCTCCCAAAGACCGGGACATTGCCATGGTATTCCAGTCCTATGCCCTCTATCCCCACATGAGTGTTTATGAAAATATGGCCTTTAGCCTCGACTTACAGGGCAAACCCAAAGAAGAAATTAGGCAAAGGGTCTGTAGCGCCGCTGAATTGTTGGGCATCGAAAAATTACTGCATCGTAAACCCAAGGAATTGTCGGGGGGACAGCGGCAACGGGTGGCAGTGGGGAGAGCCATTGTCCGTAAACCCTCTGTGTTTTTGATGGATGAACCCCTTTCTAATCTGGATGCCATGCTCCGGGTGCAAGCCCGCAAAGAAATCAGTAAACTCCATAGCGACCTGGCCACTACTTTCATTTACGTTACCCATGACCAGGTGGAAGCTATGACCATGGGCGATCGCATTGCTGTGATGAAGGATGGCATTTTGCAACAGGTGGACAGTCCAGCTAATTTGTACAATCAGCCCGCTAACCTATTTGTGGCTGGTTTCATTGGCAGTCCCGCCATGAACTTTTTTCAGGTGGAAAGATTAAGTCAGGAAGGAAAAGAAAAGCTGAGTTTGGACGGTGTTGTTTTACCAATGCCAGACAGTGTAGCCAAAAACGGCGATCGCCCCCTAACCCTCGGTATTCGCCCTGAAAATATTTACCATCCCCAATATTTGCCCTTGGAAATTGAACCCATGGAGTTGCCAGCCACAGTTAACCTAGTGGAAATGATGGGCAATGAATTAATTGTTTATGCCCAAACTCCTGCCGGTACAGAATTTGTGGCCCGCATTGACCCCAGGGTAAATATTAAGCAGAAAGACTCAGTTAAATTTGTGGTTGATACCCAACGTTTTTACTATTTTGACCGGGAAATGGAAACGGCGATCTTTTAA

Protein

MASVSFEQVTKQFDDYVAVNNLNLEIEDGEFLVFVGPSGCGKTTSLRLLAGLETVSQGQICIGDRRVNELSPKDRDIAMVFQSYALYPHMSVYENMAFSLDLQGKPKEEIRQRVCSAAELLGIEKLLHRKPKELSGGQRQRVAVGRAIVRKPSVFLMDEPLSNLDAMLRVQARKEISKLHSDLATTFIYVTHDQVEAMTMGDRIAVMKDGILQQVDSPANLYNQPANLFVAGFIGSPAMNFFQVERLSQEGKEKLSLDGVVLPMPDSVAKNGDRPLTLGIRPENIYHPQYLPLEIEPMELPATVNLVEMMGNELIVYAQTPAGTEFVARIDPRVNIKQKDSVKFVVDTQRFYYFDREMETAIF