Your browser is old and dusty. Try Google Chrome!

Details for slr0743a

ORF slr0743a
Accession NP_001035870.1
Symbol
Category
Definition
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -147 -133 7.86607 0.0956
NP_441061.1_2 Reverse -140 -154 1.17956 0.193
NP_441061.1_2 Forward -399 -385 0.392915 0.211
NP_440557.1_1 Reverse -140 -159 18.289 0.0473
NP_440795.1_7 Forward -147 -140 14.6904 0.0123
NP_440795.1_7 Reverse -140 -147 14.6904 0.0123
NP_441418.1_6 Forward -148 -129 10.0292 0.00254
NP_441418.1_6 Reverse -139 -158 -2.26216 0.018
NP_442291.1_7 Forward -266 -252 11.996 0.216
NP_441453.1_1 Reverse -132 -150 4.24662 0.262
NP_441453.1_4 Reverse -139 -147 16.539 0.00633
NP_441453.1_4 Forward -148 -140 16.539 0.00633
NP_441453.1_4 Reverse -391 -399 5.23096 0.157
NP_442151.1_6 Reverse -139 -153 19.5675 0.0045
NP_442151.1_6 Forward -400 -386 11.111 0.108
NP_442151.1_10 Forward -150 -132 11.8189 0.289
NP_440226.1_1 Reverse -139 -158 13.8641 0.0344
NP_442744.1_8 Forward -400 -381 -6.98204 0.299
NP_442655.1_1 Reverse -134 -153 -1.27885 0.261
NP_442655.1_10 Forward -151 -132 -18.4868 0.272
NP_442173.1_1 Forward -147 -139 15.4574 0.00633
NP_442173.1_1 Reverse -140 -148 15.4574 0.00633
NP_442173.1_1 Forward -399 -391 9.45919 0.0825
NP_442752.1_4 Forward -148 -141 13.8055 0.0199
NP_442752.1_4 Reverse -139 -146 13.8055 0.0199
NP_443027.1_4 Forward -150 -140 15.3197 0.0437
NP_443027.1_4 Reverse -137 -147 5.87989 0.294
NP_442975.1_10 Forward -152 -138 12.192 0.0477
NP_442975.1_10 Reverse -135 -149 11.7987 0.0482
NP_440784.1_7 Forward -147 -140 15.9687 0.0123
NP_440784.1_7 Reverse -140 -147 15.9687 0.0123
NP_440061.1_9 Reverse -267 -281 10.3237 0.126
NP_440061.1_9 Forward -264 -250 5.89884 0.266
NP_439979.1_2 Forward -148 -129 9.0459 0.242
NP_440878.1_9 Reverse -129 -148 4.42435 0.174
NP_442062.1_3 Forward -84 -65 -2.85214 0.273
NP_442062.1_8 Forward -148 -138 19.4496 0.000558
NP_442062.1_8 Reverse -139 -149 10.3048 0.0493
NP_442062.1_8 Forward -301 -291 7.05986 0.11
NP_442062.1_8 Forward -400 -390 6.27322 0.132
NP_440761.1_4 Forward -153 -134 -13.6686 0.257
NP_441859.1_3 Reverse -138 -157 7.07848 0.165
NP_440304.1_4 Forward -150 -140 18.9579 0.00406
NP_440304.1_4 Reverse -137 -147 1.84832 0.299
NP_442242.1_4 Forward -147 -140 14.3954 0.0124
NP_442242.1_4 Reverse -140 -147 14.3954 0.0124
NP_440044.1_8 Reverse -140 -159 2.65439 0.146
NP_442762.1_10 Reverse -248 -267 -10.817 0.269
NP_442981.1_10 Forward -94 -75 22.1239 0.0335
NP_439918.1_2 Reverse -313 -332 -5.01543 0.295
NP_441352.1_2 Forward -134 -115 10.2259 0.137
NP_441352.1_2 Forward -209 -190 3.53937 0.222
NP_441352.1_2 Forward -188 -169 1.17943 0.257
NP_441200.1_4 Forward -104 -85 8.84924 0.251
NP_441208.1_9 Reverse -136 -150 10.6193 0.182
NP_441208.1_9 Forward -151 -137 4.91614 0.282
NP_441594.1_6 Forward -157 -138 6.29264 0.193
NP_440132.1_1 Reverse -137 -155 8.37728 0.272
NP_442110.1_7 Reverse -139 -153 19.2725 0.0138
NP_440856.1_4 Forward -155 -136 -4.91709 0.27
NP_440856.1_7 Forward -151 -132 -9.047 0.282
NP_441083.1_3 Reverse -246 -256 15.0242 0.138
NP_441083.1_5 Forward -148 -138 11.3864 0.0159
NP_441083.1_5 Reverse -139 -149 11.2881 0.0159
NP_441083.1_5 Forward -400 -390 7.94484 0.048
NP_442827.1_8 Reverse -131 -150 -0.591301 0.231
NP_442827.1_8 Forward -156 -137 -2.55791 0.282
NP_441738.1_2 Forward -146 -139 15.28 0.0102
NP_441738.1_2 Reverse -141 -148 15.28 0.0102
NP_441738.1_2 Reverse -393 -400 13.8051 0.0221
NP_441558.1_5 Forward -150 -131 5.89931 0.236
NP_441558.1_5 Reverse -137 -156 5.30933 0.254
NP_440209.1_1 Reverse -139 -147 18.1123 0.00295
NP_440209.1_1 Forward -148 -140 18.1123 0.00295
NP_442889.1_8 Forward -151 -137 9.34041 0.1
NP_440410.1_5 Forward -338 -319 12.1925 0.251
NP_440056.1_1 Forward -222 -203 16.1257 0.11
NP_440056.1_1 Reverse -248 -267 11.8975 0.174
NP_440056.1_1 Forward -141 -122 7.57094 0.297
NP_440178.1_7 Reverse -213 -232 -21.83 0.241
NP_440178.1_7 Reverse -138 -157 -22.9117 0.282
NP_442059.1_10 Forward -186 -167 11.4058 0.239
NP_440659.1_9 Reverse -130 -149 12.0942 0.204
NP_442570.1_3 Reverse -239 -258 -4.32711 0.23
NP_442570.1_3 Reverse -250 -269 -6.1954 0.257
NP_442111.1_4 Forward -149 -135 16.9125 0.0123
NP_442111.1_4 Reverse -138 -152 4.12949 0.219
NP_441624.1_7 Reverse -247 -261 5.99778 0.296
NP_441163.1_1 Reverse -131 -148 4.85634 0.284
NP_441163.1_4 Reverse -85 -104 12.63 0.284
NP_440906.1_5 Forward -147 -140 15.8704 0.0124
NP_440906.1_5 Reverse -140 -147 15.8704 0.0124
NP_440012.1_6 Reverse -313 -332 11.0125 0.241
NP_440747.1_10 Reverse -136 -148 15.1819 0.00196
NP_440747.1_10 Reverse -388 -400 5.15219 0.0179
NP_440747.1_10 Forward -151 -139 -1.92764 0.0192
NP_441130.1_10 Reverse -137 -151 9.73436 0.12
NP_442973.1_5 Reverse -130 -149 15.2408 0.116
NP_441486.1_1 Forward -151 -137 5.01447 0.0398
NP_441486.1_1 Reverse -136 -150 -3.54032 0.179
NP_441880.2_10 Reverse -263 -281 8.27895 0.279
NP_442634.1_4 Forward -150 -136 6.29277 0.0508
NP_442634.1_4 Reverse -137 -151 -3.34366 0.161
NP_442634.1_4 Forward -276 -262 -5.80194 0.279
NP_441265.1_3 Forward -154 -140 3.04785 0.181
NP_440403.1_10 Reverse -130 -149 1.67108 0.288
NP_440842.1_10 Forward -114 -100 2.06454 0.278
NP_440057.1_1 Forward -141 -122 10.5209 0.232
NP_440057.1_4 Forward -255 -236 12.7203 0.299
NP_440057.1_8 Forward -225 -206 16.5191 0.232
NP_441695.1_8 Reverse -11 -25 9.83269 0.296
NP_441014.1_8 Reverse -359 -378 -9.63698 0.299
NP_441014.1_9 Forward -151 -132 9.73422 0.174
NP_441014.1_10 Reverse -232 -251 -2.8529 0.289
NP_442848.1_1 Forward -154 -140 -3.147 0.263
NP_442848.1_5 Forward -263 -245 -0.472507 0.276
NP_442848.1_9 Reverse -253 -272 6.98095 0.182
NP_441012.1_4 Reverse -186 -199 11.9173 0.252
NP_441012.1_4 Forward -102 -89 7.00078 0.272
NP_443018.1_3 Forward -147 -140 14.8871 0.0123
NP_443018.1_3 Reverse -140 -147 14.8871 0.0123
NP_443018.1_3 Forward -300 -293 8.49558 0.141
NP_441316.1_7 Forward -150 -135 0.176559 0.194
NP_441316.1_7 Reverse -137 -152 -3.16669 0.273
NP_441634.1_8 Reverse -137 -151 -4.4253 0.295
NP_441634.1_9 Reverse -248 -267 12.4867 0.209
NP_440376.1_1 Forward -148 -139 19.4693 0.000692
NP_440376.1_1 Reverse -139 -148 19.4693 0.000692
NP_440376.1_1 Forward -400 -391 12.2911 0.0198
NP_440376.1_1 Forward -268 -259 3.63797 0.2
NP_440376.1_1 Reverse -391 -400 -0.0986038 0.285
NP_441588.1_4 Forward -146 -136 7.35486 0.178
NP_441588.1_4 Reverse -141 -151 6.66654 0.185
NP_442687.1_7 Reverse -138 -148 15.8113 0.0125
NP_442687.1_7 Forward -149 -139 9.02648 0.0994
NP_442191.1_4 Reverse -140 -154 14.8714 0.073
NP_442191.1_4 Reverse -248 -262 13.2231 0.158
NP_442485.1_3 Reverse -128 -147 2.65439 0.209
NP_442485.1_3 Forward -280 -261 -4.13045 0.278
NP_441013.1_2 Reverse -91 -109 0.0191479 0.254
NP_441763.1_10 Forward -159 -140 4.71854 0.3
NP_442658.1_1 Reverse -137 -147 15.9091 0.00966
NP_442658.1_1 Forward -150 -140 15.9091 0.00966
NP_442658.1_1 Forward -204 -194 6.56775 0.224
NP_442161.1_7 Reverse -105 -124 9.93088 0.114
NP_440141.1_8 Forward -211 -192 5.30933 0.276
NP_441855.2_4 Reverse -131 -150 20.3206 0.0167
NP_440656.1_8 Forward -312 -293 -1.37718 0.18
NP_442544.1_2 Reverse -383 -397 -1.8687 0.287
NP_442321.1_1 Forward -150 -131 8.35759 0.0887
NP_441958.1_5 Forward -149 -139 21.2195 0.000805
NP_441958.1_5 Reverse -138 -148 12.2714 0.00183
NP_442486.1_6 Reverse -168 -187 -5.80207 0.279
NP_439905.1_2 Forward -267 -253 11.0127 0.208
NP_443001.1_7 Forward -292 -273 4.916 0.279
NP_440984.1_7 Forward -153 -139 10.7177 0.122
NP_440984.1_7 Reverse -261 -275 5.99778 0.231
NP_441097.1_2 Forward -103 -86 4.46374 0.278
NP_439990.1_3 Forward -240 -221 7.27595 0.216
NP_439990.1_5 Forward -153 -140 8.57408 0.168
NP_442911.1_2 Forward -158 -139 -1.37718 0.0844
NP_442911.1_2 Reverse -129 -148 -9.047 0.249
NP_441580.1_6 Forward -159 -140 3.53937 0.117
NP_441580.1_6 Reverse -273 -292 -2.55715 0.228
NP_440153.1_5 Reverse -140 -154 5.21113 0.191
NP_440153.1_8 Reverse -265 -278 5.52582 0.18
NP_442536.1_7 Reverse -133 -152 7.37428 0.273
NP_443055.1_6 Forward -119 -101 0.805058 0.239
NP_440993.1_2 Forward -153 -137 14.3165 0.0631
NP_440993.1_2 Reverse -134 -150 2.8118 0.262
NP_440993.1_3 Forward -158 -139 7.57013 0.141
NP_440062.1_6 Forward -242 -223 5.30933 0.235
NP_441129.1_4 Reverse -222 -241 15.4374 0.287
NP_441099.1_5 Reverse -129 -148 -2.26216 0.12
NP_441099.1_5 Reverse -381 -400 -6.09707 0.157
NP_442002.1_1 Forward -96 -78 7.4923 0.102
NP_442002.1_9 Reverse -138 -145 10.7572 0.185
NP_440809.1_9 Forward -330 -312 -7.45401 0.225
NP_441646.1_1 Reverse -132 -151 9.73422 0.125
NP_442438.1_10 Forward -153 -139 8.45605 0.0782
NP_442438.1_10 Reverse -134 -148 2.94952 0.168
NP_442431.1_10 Reverse -254 -272 -0.964162 0.298
NP_441000.1_6 Reverse -138 -152 -5.01529 0.257
NP_442771.1_1 Forward -150 -132 -5.97904 0.166
NP_440484.1_3 Forward -150 -136 9.63603 0.258
NP_440147.1_4 Reverse -137 -150 21.4554 0.00117
NP_440147.1_4 Forward -150 -137 2.47756 0.208
NP_441550.1_8 Forward -150 -140 17.4824 0.00754
NP_441550.1_8 Reverse -137 -147 8.3377 0.124
NP_441916.1_7 Reverse -139 -149 18.9579 0.00144
NP_441916.1_7 Forward -148 -138 18.4663 0.00144
NP_441916.1_7 Forward -274 -264 3.22496 0.223
NP_440465.1_10 Forward -151 -132 6.29264 0.199
NP_441041.1_4 Reverse -5 -24 -7.17871 0.182
NP_441041.1_4 Forward -148 -129 -7.37537 0.186
NP_441041.1_7 Forward -151 -139 18.3015 0.00558
NP_441041.1_7 Reverse -136 -148 15.6777 0.0222
NP_441041.1_7 Forward -336 -324 9.36115 0.114
NP_441725.1_4 Reverse -134 -148 3.53891 0.278
NP_441725.1_5 Reverse -140 -150 8.92815 0.0553
NP_441725.1_5 Forward -147 -137 2.04498 0.115
NP_439966.1_7 Forward -150 -140 13.8442 0.0234
NP_439966.1_7 Reverse -137 -147 9.91099 0.0968
NP_439966.1_7 Reverse -267 -277 4.10949 0.289
NP_439966.1_9 Forward -150 -141 0.983037 0.253
NP_439966.1_9 Reverse -137 -146 0.884706 0.253
NP_440736.1_3 Forward -150 -131 -0.983855 0.282
NP_442941.1_3 Reverse -140 -150 10.9931 0.0116
NP_442941.1_3 Forward -147 -137 2.63497 0.14
NP_440289.1_2 Forward -151 -138 5.03416 0.0636
NP_440289.1_2 Reverse -136 -149 -3.71729 0.267
NP_440983.1_9 Forward -103 -84 4.42435 0.285
NP_440260.1_8 Reverse -382 -400 2.28076 0.182
NP_440260.1_8 Reverse -238 -256 -1.45582 0.233
NP_440260.1_8 Forward -271 -253 -2.63579 0.245
NP_440260.1_8 Reverse -130 -148 -5.19239 0.273
NP_440260.1_8 Reverse -92 -110 -6.86402 0.295
NP_441514.1_2 Forward -347 -328 15.6341 0.281
NP_442281.1_1 Reverse -134 -148 21.1401 0.00192
NP_442281.1_1 Forward -153 -139 14.8469 0.0155
NP_442281.1_1 Reverse -188 -202 5.60385 0.152
NP_442281.1_1 Reverse -386 -400 4.91554 0.176
NP_442281.1_1 Forward -109 -95 3.93223 0.213
NP_441334.1_7 Forward -150 -131 -9.14533 0.12
NP_441334.1_7 Reverse -137 -156 -10.4236 0.12
NP_442575.1_8 Forward -104 -85 -0.295539 0.232
NP_442012.1_1 Forward -154 -135 9.93088 0.0878
NP_442012.1_1 Reverse -133 -152 5.11266 0.154
NP_441556.1_7 Forward -21 -2 3.14526 0.265
NP_441556.1_10 Reverse -146 -160 9.92981 0.281
NP_442982.1_5 Forward -158 -139 4.52268 0.172
NP_442982.1_5 Forward -115 -96 2.65439 0.215
NP_441644.1_6 Reverse -139 -149 19.0557 0.000803
NP_441644.1_6 Forward -148 -138 10.1076 0.0628
NP_441644.1_6 Forward -400 -390 3.8145 0.261
NP_442215.1_2 Reverse -137 -153 10.285 0.0501
NP_442215.1_2 Reverse -382 -398 -1.3181 0.183
NP_442215.1_2 Forward -150 -134 -2.89139 0.206
NP_442215.1_2 Reverse -93 -109 -6.43131 0.271
NP_442177.1_5 Reverse -142 -156 7.66941 0.293
NP_442247.1_8 Reverse -267 -281 10.6193 0.247
NP_440253.1_2 Reverse -139 -157 4.24738 0.106
NP_440253.1_2 Forward -202 -184 4.14905 0.106
NP_440253.1_2 Forward -148 -130 0.117479 0.196
NP_440929.1_8 Forward -148 -139 19.2726 0.000701
NP_440929.1_8 Reverse -139 -148 19.2726 0.000701
NP_440929.1_8 Reverse -391 -400 6.78456 0.082
NP_442933.1_10 Forward -148 -139 17.601 0.00325
NP_442933.1_10 Reverse -139 -148 17.601 0.00325
NP_441751.2_8 Reverse -140 -154 -4.4253 0.173
NP_442554.1_8 Reverse -140 -150 19.1546 0.00369
NP_442554.1_8 Forward -147 -137 13.2547 0.0187
NP_442554.1_8 Reverse -248 -258 5.5849 0.145
NP_442554.1_8 Forward -399 -389 3.71661 0.215
NP_441762.1_7 Reverse -138 -150 11.7404 0.0142
NP_441762.1_7 Forward -149 -137 10.2654 0.0142
NP_441762.1_7 Reverse -192 -204 -6.15587 0.276
NP_442142.1_4 Reverse -136 -149 14.4733 0.0311
NP_442142.1_4 Forward -151 -138 14.1783 0.0311
NP_442142.1_4 Forward -259 -246 3.65697 0.248
NP_442142.1_4 Reverse -250 -263 2.28034 0.295
NP_442292.1_1 Reverse -140 -149 17.5026 0.00435
NP_442292.1_1 Forward -147 -138 9.63616 0.0183
NP_442143.1_8 Reverse -131 -150 11.8967 0.223
NP_442381.1_8 Forward -151 -132 -5.70374 0.148
NP_441711.1_4 Forward -157 -138 24.8772 0.0208
NP_443009.1_5 Forward -149 -138 19.626 0.00102
NP_443009.1_5 Reverse -138 -149 7.82632 0.118
NP_442301.1_2 Reverse -264 -283 5.30853 0.265
NP_441715.1_4 Forward -147 -137 9.41981 0.097
NP_441715.1_4 Reverse -140 -150 7.25653 0.108
NP_442076.1_8 Forward -159 -140 8.55425 0.262
NP_441198.1_5 Reverse -141 -154 14.2767 0.206
NP_441198.1_8 Forward -150 -140 15.4199 0.0427
NP_440379.1_5 Forward -271 -252 9.0459 0.133
NP_440379.1_5 Forward -265 -246 -6.68705 0.238
NP_440379.1_5 Reverse -262 -281 -9.14533 0.259
NP_441468.1_1 Forward -147 -140 15.8704 0.0124
NP_441468.1_1 Reverse -140 -147 15.8704 0.0124
NP_441618.1_6 Forward -180 -161 11.3075 0.3
NP_441020.2_6 Forward -150 -133 23.4416 0.00119
NP_441020.2_6 Reverse -137 -154 13.2152 0.0765
NP_441020.2_7 Forward -255 -236 17.8948 0.146
NP_441015.1_10 Forward -261 -242 5.70265 0.112
NP_441015.1_10 Forward -153 -134 -3.54046 0.19
NP_441015.1_10 Reverse -248 -267 -3.93378 0.195
NP_441673.1_1 Forward -148 -139 20.8459 0.000698
NP_441673.1_1 Reverse -139 -148 20.8459 0.000698
NP_441673.1_1 Forward -400 -391 1.27803 0.155
NP_441673.1_1 Reverse -391 -400 1.27803 0.155
NP_441826.1_2 Forward -154 -140 7.17775 0.0899
NP_441826.1_2 Reverse -133 -147 1.96621 0.137
NP_441330.1_1 Forward -153 -134 -3.04881 0.0791
NP_441393.1_2 Forward -397 -378 10.8286 0.293
NP_442490.1_9 Reverse -127 -146 -4.42544 0.266
NP_442490.1_9 Forward -160 -141 -7.08038 0.275
NP_441764.1_8 Forward -338 -328 10.8322 0.297
NP_442868.1_6 Forward -150 -140 8.63316 0.0555
NP_442868.1_6 Reverse -137 -147 0.865012 0.205
NP_442868.1_6 Forward -276 -266 -0.0199663 0.255
NP_442361.1_3 Reverse -133 -146 15.7522 0.0825
NP_442361.1_3 Forward -154 -141 10.639 0.272
NP_442808.1_1 Reverse -138 -148 18.4657 0.00201
NP_442808.1_1 Forward -149 -139 8.73102 0.0481
NP_441101.1_1 Forward -150 -132 17.7187 0.226
NP_442542.1_9 Forward -155 -141 19.5668 0.0195
NP_442050.1_5 Forward -150 -140 17.1874 0.00812
NP_442903.1_2 Forward -218 -199 7.78217 0.165
NP_442342.1_9 Reverse -137 -153 1.92682 0.296
NP_440342.1_2 Forward -271 -252 9.24257 0.261
NP_440558.1_2 Forward -325 -306 -3.3438 0.234
NP_440558.1_2 Reverse -244 -263 -4.52377 0.246
NP_440558.1_2 Forward -265 -246 -7.08038 0.287
NP_442789.1_4 Forward -150 -131 -7.96535 0.299
NP_442789.1_4 Reverse -137 -156 -8.06369 0.299
NP_441518.1_3 Forward -158 -139 -11.8003 0.261
NP_441878.1_6 Forward -149 -139 10.5014 0.0176
NP_441878.1_6 Reverse -138 -148 10.4031 0.0176
NP_441878.1_6 Reverse -246 -256 -0.118297 0.167
NP_441878.1_6 Forward -275 -265 -7.00147 0.201
NP_441036.1_8 Reverse -138 -148 17.7779 0.000554
NP_441036.1_8 Forward -149 -139 15.713 0.00724
NP_441557.1_5 Forward -148 -139 19.9609 0.000699
NP_441557.1_5 Reverse -139 -148 19.9609 0.000699
NP_441557.1_5 Forward -400 -391 0.393051 0.166
NP_441557.1_5 Reverse -391 -400 0.393051 0.166
NP_441557.1_8 Reverse -86 -96 12.5659 0.236
NP_442267.1_4 Reverse -251 -270 0.392778 0.285
NP_442267.1_4 Reverse -212 -231 -0.39387 0.29
NP_442066.2_4 Reverse -139 -158 -9.14533 0.296
NP_442066.2_9 Forward -152 -139 9.85238 0.159
NP_441739.1_2 Forward -335 -319 5.07273 0.23
NP_441308.1_8 Forward -150 -140 12.4681 0.218
NP_441458.1_10 Reverse -130 -149 6.88262 0.196
NP_441458.1_10 Forward -265 -246 5.11266 0.224
NP_442183.1_1 Reverse -139 -153 10.521 0.0829
NP_442183.1_1 Forward -148 -134 10.3243 0.0857
NP_442166.1_7 Reverse -346 -360 9.14437 0.204
NP_442166.1_7 Forward -147 -133 7.76774 0.271
NP_441574.1_1 Forward -274 -255 8.94757 0.11
NP_442347.1_2 Forward -147 -138 11.1111 0.056
NP_442347.1_2 Reverse -140 -149 3.34298 0.284
NP_442645.1_2 Reverse -316 -335 -15.8318 0.213
NP_442888.1_6 Forward -159 -140 8.65258 0.195
NP_441037.1_4 Forward -150 -140 16.5761 0.0168
NP_441037.1_4 Reverse -137 -147 14.7245 0.028
NP_440151.1_5 Reverse -90 -109 12.3892 0.131
NP_440151.1_5 Reverse -307 -326 4.12936 0.271
NP_442317.1_6 Reverse -134 -153 3.34271 0.263
NP_441633.1_3 Reverse -137 -150 13.0973 0.018
NP_441633.1_3 Forward -150 -137 -5.78224 0.236
NP_440136.1_2 Forward -147 -140 15.9687 0.0123
NP_440136.1_2 Reverse -140 -147 15.9687 0.0123
NP_442590.1_10 Reverse -89 -108 6.68596 0.239
NP_442998.1_5 Forward -385 -375 13.353 0.158
NP_442998.1_5 Forward -252 -242 10.4031 0.214
NP_442998.1_10 Forward -146 -139 15.5754 0.0102
NP_442998.1_10 Reverse -141 -148 15.5754 0.0102
NP_442998.1_10 Reverse -393 -400 6.23397 0.157
NP_440899.1_2 Forward -159 -140 9.24175 0.184
NP_440299.1_1 Reverse -135 -148 20.1765 0.00128
NP_440299.1_1 Forward -152 -139 4.44361 0.207
NP_440299.1_1 Forward -18 -5 4.24695 0.213
NP_440299.1_1 Reverse -387 -400 3.46031 0.243
NP_441799.1_1 Reverse -135 -149 8.55376 0.112
NP_441799.1_1 Forward -152 -138 7.47213 0.141
NP_441007.1_10 Forward -153 -140 12.409 0.0499
NP_442201.1_10 Reverse -258 -277 -4.42544 0.152
NP_442333.2_5 Forward -159 -140 -7.96535 0.234
NP_440256.1_1 Reverse -136 -155 9.24257 0.021
NP_440256.1_1 Forward -151 -132 1.27776 0.077
NP_440256.1_1 Reverse -309 -328 -7.17871 0.231
NP_440256.1_1 Forward -259 -240 -9.047 0.273
NP_441090.1_6 Forward -400 -386 13.4709 0.127
NP_441559.1_8 Reverse -134 -148 2.45787 0.143
NP_441559.1_8 Reverse -386 -400 -6.49025 0.279
NP_441559.1_8 Forward -153 -139 -7.57189 0.295
NP_440915.1_6 Reverse -135 -149 14.6509 0.0183
NP_440915.1_6 Forward -152 -138 14.0609 0.0187
NP_442855.1_3 Forward -103 -84 12.6841 0.237
NP_441296.1_9 Reverse -120 -133 8.67183 0.294
NP_441704.1_8 Reverse -380 -399 9.43841 0.182
NP_442866.1_1 Reverse -90 -109 -7.27704 0.266
NP_441113.1_3 Forward -244 -230 14.5519 0.27
NP_441939.1_3 Reverse -140 -159 18.584 0.0154
NP_441199.1_6 Reverse -135 -154 12.8808 0.0532
NP_441199.1_6 Reverse -147 -166 3.24438 0.183
NP_441494.1_6 Forward -153 -140 7.09911 0.267
NP_441494.1_6 Forward -204 -191 5.62415 0.298
NP_442993.1_1 Forward -274 -258 -11.8395 0.26
NP_440677.1_1 Reverse -130 -149 8.94757 0.196
NP_440677.1_1 Forward -157 -138 5.70265 0.294
NP_440677.1_6 Reverse -130 -149 8.35759 0.277
NP_442386.1_9 Reverse -138 -147 15.7322 0.0144
NP_442386.1_9 Forward -149 -140 6.39082 0.219
NP_442386.1_9 Reverse -390 -399 6.29249 0.226
NP_441750.1_1 Forward -193 -174 -9.34199 0.3
NP_441750.1_4 Reverse -135 -154 8.94757 0.159
NP_441340.1_5 Forward -147 -140 15.6737 0.0124
NP_441340.1_5 Reverse -140 -147 15.6737 0.0124
NP_441340.1_5 Forward -399 -392 3.97235 0.274
NP_441340.1_9 Forward -66 -56 7.00193 0.297
NP_440168.1_2 Reverse -179 -198 -3.3438 0.276
NP_440168.1_9 Reverse -94 -113 -2.85214 0.285
NP_440059.1_9 Forward -249 -230 18.3873 0.132
NP_442240.1_1 Reverse -231 -250 3.14526 0.293
NP_442240.1_2 Reverse -140 -159 -12.6852 0.163
NP_440161.1_3 Forward -150 -131 10.4225 0.23
NP_440586.1_8 Forward -147 -140 13.2151 0.026
NP_440586.1_8 Reverse -140 -147 13.2151 0.026
NP_442251.1_6 Forward -147 -140 15.2804 0.0124
NP_442251.1_6 Reverse -140 -147 15.2804 0.0124
NP_440192.1_4 Forward -273 -254 8.4274 0.298
NP_440684.1_3 Forward -138 -119 15.8307 0.219
NP_440684.1_3 Forward -141 -122 14.9458 0.246
NP_440684.1_9 Reverse -133 -147 8.55439 0.226
NP_441262.1_3 Reverse -139 -146 14.7888 0.0223
NP_441262.1_3 Forward -148 -141 14.7888 0.0223
NP_441262.1_3 Forward -400 -393 11.5438 0.0584
NP_440027.1_8 Reverse -309 -328 5.30853 0.28
NP_443051.1_1 Forward -149 -140 19.5676 0.00335
NP_443051.1_1 Reverse -138 -147 10.4228 0.00754
NP_443051.1_9 Forward -271 -257 12.8809 0.29
NP_439937.1_8 Forward -195 -176 -1.7705 0.249
NP_439937.1_8 Reverse -254 -273 -2.55715 0.26
NP_439937.1_8 Forward -150 -131 -3.63879 0.271
NP_440626.1_1 Reverse -140 -159 8.35677 0.299
NP_440439.1_1 Forward -151 -138 10.344 0.0369
NP_440439.1_1 Reverse -136 -149 8.27909 0.0547
NP_440439.1_1 Reverse -266 -279 1.59258 0.148
NP_442239.1_8 Reverse -259 -278 17.2074 0.178
NP_439943.1_2 Forward -224 -205 10.7175 0.259
NP_440372.1_2 Forward -147 -140 16.3621 0.0124
NP_440372.1_2 Reverse -140 -147 16.3621 0.0124
NP_440171.1_3 Forward -254 -235 13.4708 0.177
NP_441138.1_5 Forward -44 -31 2.92653 0.297
NP_441181.1_6 Forward -147 -129 20.9636 0.0388
NP_440316.1_10 Reverse -145 -155 6.07655 0.271
NP_442663.1_1 Reverse -40 -59 2.26028 0.241
NP_441803.1_2 Reverse -134 -153 16.0274 0.0361
NP_439977.1_5 Reverse -133 -152 5.30933 0.15
NP_439977.1_6 Forward -109 -91 19.587 0.167
NP_439977.1_6 Forward -220 -202 15.4571 0.286
NP_441572.1_7 Forward -154 -135 5.11266 0.0892
NP_442384.1_10 Forward -148 -135 15.7522 0.00946
NP_442384.1_10 Reverse -139 -152 1.9859 0.24
NP_442384.1_10 Forward -321 -308 1.10092 0.268
NP_442114.1_8 Reverse -29 -43 9.14375 0.234
NP_441018.1_7 Reverse -91 -110 9.3409 0.227
NP_440399.1_10 Reverse -134 -152 17.3698 0.25
NP_442790.1_4 Reverse -130 -149 -4.81876 0.135
NP_442262.1_10 Forward -147 -140 14.1988 0.0123
NP_442262.1_10 Reverse -140 -147 14.1988 0.0123
NP_442262.1_10 Forward -300 -293 8.59391 0.22
NP_441689.1_5 Forward -150 -140 8.43603 0.132
NP_440344.1_10 Forward -155 -138 6.82368 0.0165
NP_440344.1_10 Reverse -132 -149 6.33202 0.0183
NP_440531.1_6 Forward -156 -137 6.98095 0.102
NP_440562.1_3 Reverse -140 -157 6.23369 0.15
NP_440562.1_3 Forward -27 -10 2.30045 0.295
NP_440562.1_10 Reverse -382 -400 12.3105 0.206
NP_440562.1_10 Reverse -130 -148 7.19731 0.284
NP_441965.1_10 Forward -151 -135 11.1699 0.107
NP_442750.1_3 Forward -205 -186 -3.44213 0.204
NP_442693.1_6 Forward -111 -92 1.0811 0.278
NP_440297.1_9 Forward -147 -137 -0.118297 0.282
NP_440297.1_9 Reverse -140 -150 -0.314959 0.282
NP_440350.1_5 Reverse -118 -137 -4.91709 0.288
NP_440350.1_5 Reverse -112 -131 -5.60541 0.292
NP_442280.1_10 Reverse -243 -261 20.0645 0.071
NP_442280.1_10 Forward -266 -248 9.64264 0.232
NP_442280.1_10 Reverse -381 -399 8.47384 0.258
NP_442280.1_10 Reverse -238 -256 7.40243 0.268
NP_441896.1_3 Forward -157 -138 5.80098 0.116
NP_440700.1_8 Forward -98 -84 10.226 0.292
NP_440990.1_7 Reverse -127 -146 3.73603 0.292
NP_440894.1_10 Reverse -134 -153 9.43923 0.16
NP_440894.1_10 Forward -153 -134 5.50599 0.229
NP_443036.1_8 Reverse -254 -273 13.7658 0.268
NP_440999.1_2 Forward -261 -242 8.94757 0.288
NP_440999.1_9 Reverse -135 -149 10.521 0.0516
NP_440999.1_9 Forward -152 -138 4.91614 0.114
NP_440999.1_9 Reverse -267 -281 -0.590395 0.212
NP_440888.1_2 Reverse -139 -153 19.9601 0.000906
NP_440888.1_2 Reverse -193 -207 8.94708 0.142
NP_440888.1_2 Forward -148 -134 7.17714 0.205
NP_440600.1_4 Reverse -131 -149 -8.04399 0.294
NP_440491.1_1 Reverse -136 -155 12.5695 0.15
NP_441345.1_9 Reverse -357 -376 13.2741 0.232
NP_440052.1_5 Reverse -128 -147 1.27776 0.165
NP_442948.1_2 Forward -149 -130 7.17762 0.229
NP_442277.1_4 Forward -157 -138 17.1082 0.0313
NP_442277.1_4 Reverse -130 -149 5.40686 0.175
NP_440575.1_1 Reverse -70 -89 1.27698 0.27
NP_441543.1_2 Forward -147 -138 18.486 0.00236
NP_441543.1_2 Reverse -140 -149 15.9293 0.00518
NP_442845.1_2 Forward -154 -140 3.8345 0.275
NP_441469.1_8 Reverse -138 -147 16.126 0.00797
NP_441469.1_8 Forward -203 -194 10.5211 0.212
NP_441469.1_8 Forward -149 -140 6.5879 0.227
NP_443064.1_6 Reverse -139 -149 10.8217 0.13
NP_442578.1_7 Forward -147 -140 14.5921 0.026
NP_442578.1_7 Reverse -140 -147 14.5921 0.026
NP_440071.1_6 Forward -97 -83 14.1927 0.25
NP_441462.1_2 Reverse -139 -149 20.2362 0.000805
NP_441462.1_2 Forward -148 -138 11.5831 0.00406
NP_441462.1_2 Forward -400 -390 -0.0199663 0.177
NP_441621.1_7 Forward -150 -136 6.58777 0.068
NP_441621.1_7 Reverse -137 -151 4.12949 0.0934
NP_441621.1_7 Reverse -128 -142 -4.4253 0.223
NP_443062.1_6 Reverse -131 -150 4.03102 0.224
NP_442204.1_1 Forward -260 -249 9.59678 0.0736
NP_442204.1_1 Reverse -135 -146 8.7118 0.0852
NP_442204.1_1 Forward -152 -141 2.61528 0.266
NP_442204.1_2 Forward -158 -139 5.99764 0.292
NP_441560.1_10 Reverse -131 -150 6.39097 0.291
NP_441351.1_8 Forward -141 -122 0.392778 0.288
NP_442537.1_3 Forward -20 -1 12.6841 0.25
NP_440516.1_6 Forward -20 -6 7.07881 0.284
NP_440516.1_8 Forward -148 -139 16.9127 0.00442
NP_440516.1_8 Reverse -139 -148 16.9127 0.00442
NP_440516.1_8 Forward -400 -391 7.07956 0.0867
NP_440516.1_8 Reverse -391 -400 5.11294 0.118
NP_442428.1_4 Reverse -138 -157 4.62101 0.224
NP_442428.1_5 Forward -147 -140 15.8704 0.0124
NP_442428.1_5 Reverse -140 -147 15.8704 0.0124
NP_440618.1_1 Forward -389 -370 -10.6203 0.297
NP_442120.1_10 Forward -274 -255 1.96607 0.156
NP_440673.1_2 Forward -272 -253 9.31652 0.248
NP_440673.1_3 Forward -146 -139 12.4288 0.0426
NP_440673.1_3 Reverse -141 -148 12.4288 0.0426
NP_441714.1_3 Forward -155 -137 20.0778 0.0252
NP_440865.1_9 Forward -154 -135 -7.96535 0.254
NP_441052.1_2 Forward -148 -138 10.5014 0.0285
NP_441052.1_2 Reverse -139 -149 10.4031 0.0285
NP_441052.1_2 Forward -400 -390 0.766681 0.256
NP_442219.1_9 Forward -147 -138 8.35786 0.0681
NP_442219.1_9 Reverse -140 -149 8.25953 0.0681
NP_440592.1_8 Forward -244 -225 17.2074 0.139
NP_440436.1_4 Forward -147 -138 18.1905 0.00233
NP_440436.1_4 Reverse -140 -149 9.24241 0.0871
NP_440436.1_4 Forward -399 -390 4.42421 0.265
NP_441884.1_9 Reverse -136 -155 -3.54046 0.0594
NP_441884.1_9 Forward -151 -132 -4.13045 0.0594
NP_441719.1_4 Forward -147 -140 16.3621 0.0124
NP_441719.1_4 Reverse -140 -147 16.3621 0.0124
NP_441733.1_10 Forward -151 -138 18.1122 0.0292
NP_441004.1_1 Forward -154 -135 -7.57203 0.199
NP_441004.1_1 Forward -286 -267 -16.5201 0.286
NP_441004.1_1 Reverse -254 -273 -16.8151 0.287
NP_441004.1_1 Forward -193 -174 -17.1101 0.289
NP_442366.1_3 Forward -149 -131 9.55725 0.0552
NP_442366.1_3 Reverse -138 -156 -3.42244 0.247
NP_442366.1_5 Reverse -136 -146 11.9759 0.148
NP_442139.1_7 Forward -285 -266 10.7175 0.198
NP_440129.1_10 Reverse -132 -146 6.78443 0.177
NP_440296.1_10 Reverse -136 -155 -5.01543 0.214
NP_440296.1_10 Forward -151 -132 -15.3402 0.294
NP_441115.1_4 Reverse -138 -156 16.0463 0.0323
NP_442206.1_10 Forward -148 -133 11.8779 0.0949
NP_440328.1_4 Reverse -133 -152 -1.18052 0.299
NP_443054.1_2 Reverse -137 -151 3.24451 0.24
NP_443054.1_2 Forward -150 -136 1.86788 0.245
NP_443054.1_2 Reverse -264 -278 0.294584 0.269
NP_441851.1_10 Reverse -138 -148 16.008 0.00552
NP_441851.1_10 Forward -149 -139 8.53483 0.114
NP_442622.1_1 Forward -149 -130 -12.7836 0.276
NP_442515.1_1 Reverse -46 -60 -4.62196 0.298
NP_441683.1_7 Forward -94 -75 -5.70374 0.264
NP_440593.1_3 Forward -153 -134 9.63589 0.107
NP_440593.1_3 Forward -267 -248 -6.78538 0.28
NP_442689.1_8 Forward -46 -29 -6.05768 0.28
NP_441349.1_10 Reverse -259 -278 -3.14714 0.134
NP_441394.1_7 Reverse -85 -99 19.8624 0.119
NP_440432.1_9 Reverse -140 -155 16.8928 0.00961
NP_442843.1_1 Forward -103 -84 -4.32711 0.237
NP_442843.1_1 Reverse -254 -273 -5.60541 0.244
NP_439960.1_6 Reverse -247 -266 10.0292 0.22
NP_440474.1_8 Reverse -140 -154 7.86545 0.196
NP_441150.1_5 Forward -394 -376 14.6705 0.24
NP_442450.1_5 Reverse -137 -147 7.55152 0.13
NP_440588.1_2 Reverse -130 -149 -0.590531 0.151
NP_440195.1_4 Forward -327 -308 7.47261 0.257
NP_440195.1_4 Forward -261 -242 7.27595 0.26
NP_440943.1_5 Reverse -289 -303 10.9143 0.288
NP_442006.1_2 Forward -142 -125 -6.94266 0.169
NP_442006.1_2 Forward -148 -131 -7.33598 0.171
NP_442006.1_2 Forward -256 -239 -7.53264 0.176
NP_442006.1_2 Forward -223 -206 -16.6774 0.261
NP_441003.1_9 Reverse -93 -112 14.4541 0.213
NP_441570.1_1 Reverse -139 -157 -1.16082 0.0543
NP_441570.1_1 Forward -148 -130 -8.33898 0.109
NP_441078.1_4 Forward -148 -139 19.6659 0.0007
NP_441078.1_4 Reverse -139 -148 19.6659 0.0007
NP_441078.1_4 Reverse -391 -400 0.589713 0.174
NP_441078.1_4 Forward -400 -391 0.589713 0.174
NP_442729.1_5 Forward -143 -133 13.648 0.228
NP_441663.1_8 Forward -111 -92 -3.14714 0.276
NP_440526.1_3 Reverse -140 -151 11.6612 0.0646
NP_441432.1_8 Forward -149 -140 16.8143 0.00595
NP_441432.1_8 Reverse -138 -147 8.25953 0.0755
NP_441432.1_8 Reverse -390 -399 7.96454 0.0953
NP_442320.1_8 Forward -154 -140 5.60446 0.0334
NP_442320.1_8 Reverse -133 -147 -3.34366 0.117
NP_441732.1_2 Reverse -135 -151 2.12349 0.0253
NP_441732.1_2 Forward -152 -136 -15.0844 0.145
NP_441732.1_2 Reverse -255 -271 -16.8544 0.207
NP_440760.1_1 Reverse -139 -158 -23.1083 0.283
NP_442797.1_1 Reverse -261 -280 4.42435 0.19
NP_442797.1_7 Forward -374 -356 4.54237 0.221
NP_439900.1_1 Forward -179 -160 12.9791 0.251
NP_440913.1_1 Reverse -137 -155 4.9357 0.253
NP_442400.1_10 Forward -345 -332 10.7569 0.255
NP_440713.1_4 Reverse -308 -327 9.14423 0.155
NP_442489.1_7 Forward -148 -139 20.1576 0.000695
NP_442489.1_7 Reverse -139 -148 20.1576 0.000695
NP_442489.1_7 Forward -400 -391 7.86621 0.0448
NP_442489.1_7 Reverse -391 -400 0.786375 0.152
NP_440565.1_7 Reverse -254 -273 0.786102 0.246
NP_440386.1_3 Forward -171 -152 -6.09707 0.261
NP_440559.1_1 Forward -147 -138 8.75118 0.0586
NP_440559.1_1 Reverse -140 -149 8.65285 0.0586
NP_440559.1_1 Forward -399 -390 4.81794 0.193
NP_441659.2_8 Reverse -139 -149 20.9245 0.000805
NP_441659.2_8 Forward -148 -138 11.9764 0.0147
NP_441659.2_8 Reverse -265 -275 2.63497 0.195
NP_442913.1_10 Forward -157 -138 -5.31042 0.262
NP_439956.1_7 Reverse -307 -326 15.8307 0.14
NP_440708.1_6 Reverse -249 -268 -3.83545 0.225
NP_440779.1_5 Reverse -139 -156 -5.36936 0.149
NP_442346.1_5 Forward -149 -139 16.303 0.00248
NP_442346.1_5 Reverse -138 -148 9.02648 0.118
NP_442346.1_10 Reverse -236 -255 -2.26216 0.294
NP_442346.1_10 Forward -204 -185 -3.3438 0.294
NP_440545.1_3 Forward -152 -135 8.49531 0.0444
NP_440545.1_3 Reverse -135 -152 7.70866 0.0488
NP_440545.1_3 Reverse -255 -272 -6.746 0.287
NP_440025.1_1 Reverse -135 -154 10.9142 0.157
NP_440025.1_3 Reverse -106 -120 10.3203 0.29
NP_440831.1_1 Forward -274 -255 11.7992 0.277
NP_441629.1_3 Forward -155 -136 7.96345 0.178
NP_441629.1_3 Reverse -258 -277 -4.32786 0.29
NP_440004.1_5 Forward -153 -134 19.0757 0.119
NP_440486.1_6 Forward -149 -130 9.73422 0.224
NP_440459.1_2 Reverse -238 -255 9.28195 0.23
NP_441653.1_2 Forward -159 -140 8.0714 0.198
NP_441888.1_7 Reverse -134 -148 13.2743 0.0743
NP_441888.1_7 Reverse -90 -104 8.94771 0.173
NP_440946.1_6 Reverse -84 -103 0.982764 0.295
NP_440449.1_6 Reverse -252 -270 15.6478 0.0851
NP_440449.1_6 Forward -156 -138 7.08868 0.232
NP_441948.1_4 Reverse -132 -150 -0.472507 0.139
NP_441833.1_4 Forward -147 -140 15.9687 0.0124
NP_441833.1_4 Reverse -140 -147 15.9687 0.0124
NP_442799.1_8 Forward -120 -101 13.5441 0.172
NP_442162.1_9 Forward -147 -140 16.2637 0.0124
NP_442162.1_9 Reverse -140 -147 16.2637 0.0124
NP_442162.1_9 Forward -399 -392 9.28223 0.0694
NP_442796.1_10 Forward -142 -123 8.35759 0.267
NP_440788.1_8 Forward -248 -229 16.5191 0.154
NP_440671.1_5 Reverse -242 -256 14.9452 0.236
NP_440224.1_1 Forward -159 -140 0.491109 0.133
NP_442199.1_5 Forward -156 -137 -1.47551 0.181
NP_442140.1_3 Forward -147 -137 16.2046 0.0255
NP_442140.1_3 Reverse -140 -150 7.94484 0.124
NP_440875.1_9 Reverse -141 -151 16.8403 0.0145
NP_440875.1_9 Forward -146 -136 9.15072 0.233
NP_440875.1_9 Forward -259 -249 6.81464 0.297
NP_441813.1_5 Reverse -137 -147 9.91146 0.021
NP_441813.1_5 Forward -150 -140 8.73149 0.0367
NP_441813.1_7 Reverse -268 -282 9.24208 0.259
NP_440590.1_4 Reverse -140 -153 12.704 0.013
NP_440590.1_4 Forward -147 -134 4.54251 0.0601
NP_440590.1_4 Forward -399 -386 2.67422 0.0835
NP_440567.1_1 Reverse -140 -154 16.0275 0.0166
NP_440567.1_1 Forward -147 -133 12.4876 0.023
NP_442497.1_10 Reverse -140 -149 17.601 0.00813
NP_442497.1_10 Forward -147 -138 10.4228 0.0087
NP_440821.1_4 Forward -150 -140 10.7964 0.0146
NP_440821.1_4 Reverse -137 -147 10.2065 0.0163
NP_441239.1_9 Forward -150 -138 17.4436 0.0146
NP_441239.1_9 Reverse -137 -149 12.3303 0.0477
NP_441239.1_9 Reverse -245 -257 11.4454 0.0607
NP_441239.1_9 Forward -204 -192 8.00379 0.145
NP_441892.1_1 Forward -157 -140 13.3135 0.0401
NP_441892.1_1 Reverse -130 -147 -4.48438 0.261
NP_442044.1_1 Forward -119 -100 -8.94866 0.262
NP_442044.1_9 Reverse -139 -158 3.24438 0.265
NP_442193.1_2 Reverse -248 -266 18.0137 0.259
NP_442270.1_9 Reverse -128 -147 -7.96535 0.215
NP_441017.1_6 Forward -108 -94 12.3887 0.221
NP_440354.1_5 Reverse -309 -328 3.34271 0.239
NP_442138.1_9 Forward -161 -142 7.37347 0.299
NP_442138.1_10 Reverse -139 -158 1.57275 0.122
NP_442052.1_7 Reverse -255 -269 13.5693 0.234
NP_440546.1_4 Reverse -139 -149 13.5365 0.0459
NP_440546.1_4 Forward -148 -138 11.8882 0.0679
NP_440546.1_4 Reverse -312 -322 8.39772 0.192
NP_439974.1_4 Forward -159 -140 15.2408 0.159
NP_439974.1_4 Forward -243 -224 9.83255 0.246
NP_442041.1_5 Forward -327 -308 0.196116 0.257
NP_441230.1_5 Forward -153 -134 13.5691 0.0635
NP_440462.1_6 Forward -150 -140 19.4496 0.00371
NP_440462.1_6 Reverse -137 -147 9.02648 0.0498
NP_442340.1_3 Forward -191 -172 -1.57384 0.188
NP_442340.1_3 Reverse -249 -268 -6.49039 0.223
NP_442340.1_3 Forward -200 -181 -7.67036 0.238
NP_442340.1_3 Reverse -177 -196 -10.817 0.293
NP_440868.1_4 Reverse -135 -147 8.6921 0.0582
NP_440868.1_4 Forward -152 -140 0.432302 0.212
NP_440653.1_10 Reverse -140 -159 2.0644 0.29
NP_440696.1_3 Reverse -243 -261 -1.35749 0.257
NP_440696.1_6 Reverse -248 -267 4.32602 0.288
NP_440843.1_8 Forward -274 -255 13.6675 0.297
NP_442023.1_2 Forward -112 -93 11.8975 0.199
NP_442039.1_4 Forward -147 -140 15.1821 0.0124
NP_442039.1_4 Reverse -140 -147 15.1821 0.0124
NP_442039.1_4 Forward -399 -392 10.8555 0.109
NP_442679.1_1 Forward -134 -115 5.70265 0.147
NP_440825.1_7 Forward -147 -137 12.4217 0.155
NP_442837.1_3 Forward -147 -140 15.7721 0.0124
NP_442837.1_3 Reverse -140 -147 15.7721 0.0124
NP_442053.1_1 Forward -148 -139 18.3876 0.0007
NP_442053.1_1 Reverse -139 -148 18.3876 0.0007
NP_442053.1_1 Reverse -391 -400 6.8829 0.111
NP_440505.1_3 Forward -150 -140 15.418 0.0114
NP_440505.1_3 Reverse -137 -147 6.76487 0.169
NP_441102.1_1 Reverse -140 -159 16.0274 0.097
NP_441203.1_1 Reverse -140 -159 -12.8819 0.146
NP_442844.1_5 Reverse -74 -93 2.9486 0.26
NP_442471.1_7 Reverse -308 -326 20.1484 0.125
NP_441408.2_7 Forward -150 -131 1.0811 0.215
NP_440914.1_1 Reverse -139 -149 16.3248 0.00196
NP_440914.1_1 Forward -148 -138 8.6151 0.186
NP_440914.1_1 Forward -161 -151 6.46809 0.279
NP_441011.1_8 Forward -147 -138 16.9127 0.00602
NP_441011.1_8 Reverse -140 -149 16.6177 0.00602
NP_442533.1_1 Reverse -5 -24 -14.0619 0.239
NP_442533.1_6 Forward -148 -139 17.2076 0.00137
NP_442533.1_6 Reverse -139 -148 17.2076 0.00137
NP_442533.1_6 Reverse -391 -400 5.70292 0.132
NP_442533.1_6 Forward -256 -247 4.52295 0.179
NP_442533.1_6 Reverse -253 -262 2.458 0.255
NP_442533.1_6 Forward -274 -265 2.16301 0.27
NP_442533.1_6 Reverse -357 -366 1.47469 0.298
NP_442541.1_10 Forward -56 -42 1.08065 0.292
NP_442232.1_3 Reverse -354 -373 -7.08038 0.194
NP_442322.1_4 Reverse -83 -100 4.56135 0.189
NP_442322.1_4 Reverse -82 -99 0.529798 0.21
NP_442322.1_4 Forward -28 -11 -8.31994 0.286
NP_442229.1_1 Forward -150 -136 17.5018 0.0765
NP_442229.1_1 Forward -204 -190 7.07881 0.198
NP_441482.1_7 Reverse -133 -147 -0.983719 0.0612
NP_441482.1_7 Forward -262 -248 -3.147 0.11
NP_441482.1_7 Forward -154 -140 -10.2268 0.209
NP_441235.1_5 Forward -141 -122 10.1275 0.297
NP_439944.1_8 Forward -185 -166 16.8141 0.238
NP_439944.1_9 Reverse -140 -150 17.7779 0.00341
NP_440816.1_7 Forward -152 -133 9.43923 0.252
NP_441028.1_6 Forward -16 -6 4.10949 0.278
NP_440116.1_5 Reverse -136 -153 5.9387 0.172
NP_441527.1_4 Forward -140 -121 -9.88384 0.262
NP_441527.1_4 Forward -248 -229 -10.0748 0.264
NP_440115.1_6 Forward -151 -141 7.84651 0.146
NP_441059.1_10 Forward -137 -124 11.819 0.254
NP_441602.1_3 Reverse -134 -153 -1.27885 0.226
NP_441602.1_4 Forward -159 -140 11.1109 0.278
NP_441972.1_5 Reverse -140 -159 9.43923 0.065
NP_441106.1_1 Forward -149 -140 18.486 0.0028
NP_441106.1_1 Reverse -138 -147 18.191 0.0028
NP_441106.1_1 Forward -257 -248 2.75299 0.261
NP_439903.1_6 Forward -151 -132 9.63507 0.12
NP_442588.1_1 Reverse -172 -191 6.19431 0.272
NP_442588.1_6 Reverse -8 -27 6.19431 0.175
NP_001035870.1_1 Forward -354 -335 30.4821 0.00023
NP_001035870.1_2 Forward -387 -368 25.4672 0.00251
NP_001035870.1_10 Forward -135 -116 19.1693 0.0813
NP_442306.1_10 Forward -282 -263 -21.83 0.291
NP_440797.1_8 Reverse -99 -118 16.8093 0.268
NP_441286.1_1 Reverse -138 -150 5.15219 0.0259
NP_441286.1_1 Forward -149 -137 -3.40261 0.145
NP_440670.1_8 Forward -148 -139 18.3876 0.000699
NP_440670.1_8 Reverse -139 -148 18.3876 0.000699
NP_440670.1_8 Forward -400 -391 14.8477 0.00987
NP_440670.1_8 Reverse -391 -400 6.09625 0.127
NP_440886.1_6 Forward -99 -80 14.3558 0.195
NP_440886.1_7 Reverse -138 -148 17.7774 0.0011
NP_440886.1_7 Forward -149 -139 8.04271 0.0805
NP_440886.1_7 Reverse -84 -94 5.09279 0.201
NP_440886.1_7 Reverse -390 -400 4.10949 0.253
NP_440083.1_2 Forward -144 -125 3.53937 0.154
NP_442614.1_2 Reverse -358 -372 6.58777 0.291
NP_439995.1_3 Reverse -89 -108 12.7825 0.229
NP_442072.1_9 Reverse -138 -156 6.60732 0.0124
NP_441753.1_10 Forward -157 -138 4.52268 0.198
NP_440907.2_8 Reverse -140 -150 19.1541 0.00362
NP_440907.2_8 Forward -147 -137 14.2375 0.0312
NP_440907.2_9 Forward -326 -307 15.5349 0.0803
NP_441905.1_9 Forward -232 -213 9.24257 0.288
NP_441021.1_1 Reverse -140 -159 -5.60541 0.177
NP_441021.1_1 Forward -273 -254 -11.6036 0.27
NP_441021.1_8 Forward -207 -189 4.05072 0.225
NP_440176.1_3 Reverse -384 -398 18.0918 0.219
NP_442842.1_4 Reverse -140 -159 5.211 0.247
NP_442893.1_3 Reverse -81 -100 16.5182 0.158
NP_441626.1_2 Forward -147 -140 15.7721 0.0124
NP_441626.1_2 Reverse -140 -147 15.7721 0.0124
NP_442211.1_9 Reverse -260 -279 5.11266 0.225
NP_441589.1_5 Reverse -246 -265 16.8542 0.262
NP_442794.1_1 Reverse -387 -399 17.4436 0.0205
NP_442794.1_1 Reverse -135 -147 12.4287 0.0721
NP_442615.1_1 Reverse -130 -148 0.314141 0.105
NP_442615.1_1 Forward -157 -139 -1.94747 0.136
NP_441962.1_4 Forward -153 -134 -0.590531 0.117
NP_440387.1_1 Forward -148 -132 14.6115 0.00635
NP_440387.1_1 Reverse -259 -275 2.32015 0.0827
NP_440387.1_1 Reverse -139 -155 0.156866 0.131
NP_440387.1_1 Forward -274 -258 -4.07137 0.174
NP_441431.1_2 Forward -151 -137 15.0436 0.0537
NP_441431.1_2 Reverse -136 -150 13.8636 0.0784
NP_441431.1_2 Reverse -266 -280 9.14375 0.192
NP_441431.1_2 Reverse -190 -204 9.14375 0.192
NP_441431.1_2 Forward -226 -212 6.29216 0.275
NP_441836.1_1 Reverse -128 -147 17.3433 0.077
NP_441836.1_2 Reverse -10 -29 -2.65548 0.23
NP_441993.1_1 Forward -280 -261 6.13735 0.186
NP_441993.1_1 Reverse -259 -278 2.53143 0.257
NP_441993.1_1 Reverse -139 -158 1.4594 0.276
NP_441993.1_1 Forward -154 -135 0.679741 0.294
NP_440467.1_3 Reverse -140 -159 12.2328 0.246
NP_440114.1_10 Reverse -139 -153 10.226 0.151
NP_442090.1_10 Reverse -352 -365 11.4257 0.261
NP_442698.1_10 Forward -92 -73 7.86593 0.233
NP_442698.1_10 Forward -137 -118 5.89931 0.233
NP_442698.1_10 Forward -167 -148 0.294447 0.297
NP_441853.1_5 Forward -274 -255 1.17943 0.279
NP_440293.1_3 Reverse -251 -270 -5.01543 0.269
NP_440293.1_3 Reverse -245 -264 -6.09707 0.286
NP_440766.1_4 Forward -152 -138 16.7159 0.0256
NP_440766.1_5 Forward -386 -374 6.89186 0.291
NP_439988.1_3 Forward -273 -259 7.37441 0.277
NP_441237.1_9 Forward -300 -290 11.4848 0.176
NP_442743.1_4 Forward -147 -128 -7.57203 0.279
NP_441311.1_2 Forward -154 -140 12.8803 0.23
NP_442867.1_8 Reverse -245 -264 9.24257 0.227
NP_442867.1_8 Reverse -240 -259 5.80098 0.275
NP_442867.1_8 Forward -264 -245 4.03102 0.293
NP_440457.1_1 Forward -152 -140 5.44718 0.141
NP_440457.1_1 Reverse -135 -147 -0.452677 0.263
NP_440798.1_6 Forward -147 -134 3.26421 0.151
NP_440798.1_6 Reverse -140 -153 1.9859 0.188
NP_440801.1_9 Reverse -211 -225 14.2897 0.257
NP_440142.1_7 Forward -399 -380 9.3409 0.214
NP_441332.1_6 Reverse -267 -277 11.0659 0.277
NP_442509.1_7 Reverse -261 -280 17.2074 0.267
NP_442509.1_9 Forward -148 -138 16.2041 0.00739
NP_442509.1_9 Reverse -139 -149 8.04271 0.192
NP_440734.1_9 Forward -364 -345 12.2908 0.24
NP_440554.1_4 Reverse -140 -150 15.418 0.0199
NP_440554.1_4 Forward -147 -137 7.35486 0.103
NP_441885.1_5 Forward -148 -138 11.4848 0.00668
NP_441885.1_5 Reverse -139 -149 11.3864 0.00668
NP_441885.1_5 Forward -400 -390 8.82982 0.0308
NP_440478.1_10 Reverse -245 -259 6.48943 0.291
NP_442310.1_1 Reverse -245 -264 10.3242 0.284
NP_442341.1_2 Forward -387 -369 19.9803 0.244
NP_442341.1_7 Reverse -138 -152 12.7826 0.0415
NP_442341.1_7 Forward -149 -135 9.34103 0.0751
NP_442341.1_9 Reverse -137 -151 5.1122 0.279
NP_442341.1_9 Forward -150 -136 4.62054 0.296
NP_441756.1_5 Reverse -135 -154 6.98095 0.167
NP_441756.1_5 Reverse -93 -112 2.85105 0.206
NP_441173.1_9 Forward -265 -257 9.75379 0.284
NP_443000.1_3 Forward -256 -237 11.4255 0.255
NP_443000.1_7 Forward -150 -140 10.7964 0.0345
NP_443000.1_7 Reverse -137 -147 1.94665 0.226
NP_442513.1_5 Forward -156 -137 9.63507 0.266
NP_441842.1_10 Forward -155 -141 18.2892 0.0173
NP_441842.1_10 Reverse -132 -146 7.9644 0.238
NP_440275.1_3 Forward -150 -140 18.6629 0.0082
NP_440275.1_3 Reverse -137 -147 8.33817 0.0602
NP_440091.1_1 Forward -152 -140 3.2839 0.163
NP_441307.1_6 Forward -148 -129 7.57094 0.217
NP_441397.1_8 Forward -136 -123 14.0991 0.219
NP_440679.1_10 Forward -146 -127 -17.2085 0.275
NP_439962.1_4 Reverse -257 -276 -1.37718 0.214
NP_439962.1_4 Forward -270 -251 -5.70374 0.28
NP_439962.1_4 Reverse -131 -150 -5.99873 0.28
NP_439962.1_4 Reverse -357 -376 -7.08038 0.287
NP_439962.1_4 Reverse -185 -204 -8.94866 0.298
NP_440175.1_6 Reverse -175 -194 14.3558 0.113
NP_440175.1_7 Reverse -91 -109 21.0741 0.0483
NP_440149.1_8 Forward -148 -129 1.57275 0.122
NP_440149.1_8 Forward -400 -381 -6.98204 0.268
NP_440149.1_10 Forward -274 -255 -11.1119 0.285
NP_441875.1_3 Forward -112 -93 17.0099 0.252
NP_441105.1_3 Forward -159 -140 -8.06369 0.265
NP_441105.1_3 Reverse -242 -261 -9.73531 0.295
NP_440216.1_1 Reverse -139 -153 7.9644 0.00737
NP_440216.1_1 Forward -148 -134 -2.16369 0.0482
NP_440172.1_1 Reverse -139 -149 17.5813 0.00421
NP_440172.1_1 Forward -148 -138 8.73149 0.0586
NP_440172.1_1 Forward -400 -390 2.24165 0.279
NP_441064.1_7 Forward -147 -128 15.1099 0.204
NP_441852.1_6 Forward -204 -185 9.53756 0.273
NP_442015.1_10 Reverse -135 -148 20.1771 0.00366
NP_442015.1_10 Reverse -387 -400 7.59077 0.0819
NP_441226.1_7 Forward -147 -140 14.4934 0.0123
NP_441226.1_7 Reverse -140 -147 14.4934 0.0123
NP_441226.1_7 Reverse -365 -372 6.52862 0.253
NP_440198.1_2 Forward -150 -131 16.6583 0.206
NP_441757.1_6 Forward -260 -241 15.2408 0.0841
NP_441111.1_7 Forward -147 -139 18.7023 0.00294
NP_441111.1_7 Reverse -140 -148 18.7023 0.00294
NP_442379.1_10 Forward -155 -138 -2.02611 0.224
NP_441766.1_2 Forward -148 -139 17.5026 0.00297
NP_441766.1_2 Reverse -139 -148 17.5026 0.00297
NP_441766.1_2 Reverse -391 -400 4.22796 0.193
NP_442417.1_5 Forward -148 -134 19.3708 0.0179
NP_440416.1_9 Reverse -132 -151 -13.3736 0.165
NP_440416.1_9 Forward -155 -136 -16.3235 0.212
NP_440416.1_9 Reverse -240 -259 -18.8801 0.266
NP_440416.1_9 Forward -374 -355 -21.83 0.297
NP_443052.1_9 Reverse -267 -286 2.55606 0.171
NP_443052.1_9 Reverse -78 -97 1.47442 0.185
NP_442403.1_10 Forward -257 -238 10.9142 0.246
NP_442154.1_1 Forward -288 -270 -15.9105 0.228
NP_440261.1_5 Reverse -140 -153 -1.16069 0.0662
NP_440261.1_5 Forward -147 -134 -10.4038 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGCGATTGGCAAGGAGGGACAAAACGTCCGGTTGGCGGCCCGCCTAACCGGTTGGAAAATTGACATCAAAGATCCCGAAACCTATGCCCGGGATAAGGAAGCCATTGAACAATCTATTTTGGAGCGGGCGGCGGCTTCAGCCCAGGCCAGGGCAGAACGGGAAGCAGCAGAACAGGAGGCCCAAGCTAAATTAGAAGCGGAAATGGCTGCTTTGGAAGCCGAGGAAGCTGAAGAGTTAGAGGAAACCCCAGAGGCGATCGCCGAGGTGGAAGAAGAAGTAGAGGAATGGGACCAAGACCAAGGGCCGGAGTTAGGGGAGGAAGAAGAGTTAAGCTAGGAAAGGTTGATAATGCCAGCTTTGTGCTAATTTGTCCTGACCACTCCTTGCCCACCGTTGACC

CDS

ATGGCCCCTGGATACCGTCGTTGCCTCAGCTGTCGCAAAGTAGGCGATCGCCGACAATTTTGGCGAATTGTCCGAGTCTATCCATCTCGAACTGTACAATTAGATCACGGTGCGGGGCGATCGGCTTATTTATGTCCGACCCATGACTGTCTGCGTAAAGCTCGCCACAAAAATCTGTTGGGGCGGGCCCTCCGAGCCCCAGTTCCCAGCCATCTCTTTGAGCAACTAGAAGCCCGTCTTCTCACCACTCCCTGA

Protein

MAPGYRRCLSCRKVGDRRQFWRIVRVYPSRTVQLDHGAGRSAYLCPTHDCLRKARHKNLLGRALRAPVPSHLFEQLEARLLTTP