Your browser is old and dusty. Try Google Chrome!

Details for slr0740

ORF slr0740
Accession NP_440011.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -108 -122 12.586 0.209
NP_441061.1_2 Forward -170 -156 -0.787057 0.239
NP_441061.1_2 Reverse -156 -170 -1.08205 0.249
NP_441061.1_2 Forward -293 -279 -1.77037 0.272
NP_440795.1_7 Forward -116 -109 14.6904 0.0123
NP_440795.1_7 Reverse -109 -116 14.6904 0.0123
NP_441418.1_6 Reverse -108 -127 -19.0768 0.0844
NP_441418.1_6 Forward -117 -98 -20.65 0.121
NP_443032.1_10 Reverse -275 -294 22.2223 0.0189
NP_442291.1_5 Forward -86 -70 -4.75968 0.283
NP_441453.1_4 Reverse -108 -116 16.539 0.00633
NP_441453.1_4 Forward -117 -109 16.539 0.00633
NP_441453.1_7 Forward -373 -366 12.1338 0.295
NP_441623.1_1 Forward -138 -120 -0.472507 0.23
NP_441960.1_3 Reverse -153 -172 16.9475 0.155
NP_442151.1_6 Forward -117 -103 7.66941 0.192
NP_442151.1_6 Reverse -108 -122 7.57108 0.194
NP_440226.1_1 Forward -117 -98 15.9291 0.0222
NP_440226.1_1 Reverse -108 -127 14.8474 0.0289
NP_441630.1_3 Forward -125 -106 1.47442 0.245
NP_442655.1_1 Reverse -103 -122 7.66927 0.114
NP_442173.1_1 Forward -116 -108 15.4574 0.00633
NP_442173.1_1 Reverse -109 -117 15.4574 0.00633
NP_442752.1_4 Forward -117 -110 13.8055 0.0199
NP_442752.1_4 Reverse -108 -115 13.8055 0.0199
NP_442752.1_4 Reverse -122 -129 5.54565 0.194
NP_443027.1_4 Forward -119 -109 13.2547 0.0521
NP_443027.1_4 Reverse -74 -84 8.04317 0.219
NP_443027.1_4 Reverse -106 -116 5.87989 0.294
NP_441812.1_3 Reverse -107 -121 6.88276 0.287
NP_442975.1_10 Reverse -104 -118 19.0751 0.00482
NP_442975.1_10 Forward -166 -152 4.42388 0.245
NP_442975.1_10 Reverse -35 -49 2.65393 0.269
NP_440784.1_7 Forward -116 -109 15.9687 0.0123
NP_440784.1_7 Reverse -109 -116 15.9687 0.0123
NP_442909.1_1 Reverse -325 -344 15.3391 0.112
NP_440061.1_9 Reverse -106 -120 10.6187 0.124
NP_440061.1_9 Forward -356 -342 6.0955 0.261
NP_441054.1_2 Reverse -113 -132 10.5209 0.284
NP_442062.1_8 Forward -117 -107 19.4496 0.000558
NP_442062.1_8 Reverse -108 -118 10.3048 0.0493
NP_442062.1_8 Forward -165 -155 4.89658 0.193
NP_442062.1_8 Reverse -236 -246 3.22496 0.279
NP_441859.1_3 Forward -118 -99 1.57197 0.281
NP_440304.1_4 Forward -119 -109 10.8948 0.051
NP_440304.1_4 Reverse -106 -116 1.84832 0.299
NP_442242.1_4 Forward -116 -109 14.3954 0.0124
NP_442242.1_4 Reverse -109 -116 14.3954 0.0124
NP_440011.1_1 Forward -383 -364 18.0924 0.153
NP_440011.1_2 Forward -339 -320 23.8939 0.0201
NP_441935.1_1 Reverse -336 -355 8.25926 0.234
NP_441594.1_6 Forward -384 -365 10.2259 0.133
NP_442110.1_7 Reverse -108 -122 2.65453 0.222
NP_441082.1_10 Forward -215 -202 7.59077 0.297
NP_442726.1_7 Forward -145 -127 3.06741 0.215
NP_441925.1_4 Forward -138 -119 -15.0459 0.263
NP_440014.1_3 Forward -192 -178 15.5859 0.282
NP_440856.1_4 Forward -124 -105 8.94757 0.0586
NP_440856.1_4 Reverse -249 -268 -4.81876 0.268
NP_441083.1_3 Forward -382 -372 16.1058 0.106
NP_441083.1_5 Forward -117 -107 11.3864 0.0159
NP_441083.1_5 Reverse -108 -118 11.2881 0.0159
NP_441434.1_7 Forward -115 -101 1.96621 0.288
NP_441738.1_2 Forward -115 -108 15.28 0.0102
NP_441738.1_2 Reverse -110 -117 15.28 0.0102
NP_441558.1_5 Forward -119 -100 15.5357 0.0407
NP_441942.1_6 Forward -124 -105 16.0312 0.235
NP_440209.1_1 Reverse -108 -116 18.1123 0.00295
NP_440209.1_1 Forward -117 -109 18.1123 0.00295
NP_442136.1_4 Reverse -110 -129 11.6017 0.236
NP_440870.1_2 Forward -233 -214 7.57094 0.0844
NP_440447.1_6 Reverse -100 -118 4.44404 0.17
NP_441713.1_7 Reverse -109 -128 13.8641 0.293
NP_442570.1_3 Reverse -106 -125 -7.37537 0.27
NP_441716.1_1 Forward -165 -151 4.22782 0.256
NP_442111.1_4 Forward -118 -104 6.48943 0.123
NP_442111.1_4 Reverse -107 -121 4.12949 0.219
NP_441163.1_1 Reverse -148 -165 9.96952 0.217
NP_441163.1_1 Forward -382 -365 8.39624 0.232
NP_440906.1_5 Forward -116 -109 15.8704 0.0124
NP_440906.1_5 Reverse -109 -116 15.8704 0.0124
NP_440747.1_10 Forward -120 -108 17.1486 0.000663
NP_440747.1_10 Reverse -105 -117 5.34885 0.0141
NP_440747.1_10 Forward -168 -156 -12.3507 0.27
NP_440747.1_10 Forward -297 -285 -12.5474 0.297
NP_441854.1_10 Reverse -175 -194 8.06259 0.186
NP_441854.1_10 Forward -389 -370 0.491109 0.282
NP_441486.1_1 Reverse -105 -119 -3.44199 0.178
NP_441486.1_1 Forward -120 -106 -3.83532 0.183
NP_442634.1_4 Reverse -106 -120 -1.27871 0.149
NP_442634.1_4 Forward -119 -105 -1.8687 0.149
NP_440403.1_10 Reverse -153 -172 9.3409 0.189
NP_440403.1_10 Reverse -363 -382 3.24438 0.278
NP_440842.1_6 Reverse -106 -125 14.5516 0.166
NP_440842.1_10 Forward -194 -180 4.12949 0.254
NP_442848.1_5 Forward -134 -116 -2.43913 0.286
NP_443018.1_3 Forward -116 -109 14.8871 0.0123
NP_443018.1_3 Reverse -109 -116 14.8871 0.0123
NP_441316.1_7 Reverse -106 -121 6.56807 0.107
NP_441634.1_8 Reverse -333 -347 3.14618 0.155
NP_441634.1_8 Forward -119 -105 -2.85201 0.295
NP_441634.1_8 Forward -167 -153 -3.73699 0.295
NP_441634.1_8 Forward -296 -282 -4.4253 0.295
NP_440376.1_1 Forward -117 -108 19.4693 0.000692
NP_440376.1_1 Reverse -108 -117 19.4693 0.000692
NP_440376.1_1 Reverse -122 -131 3.93297 0.188
NP_441857.1_5 Reverse -101 -119 3.16574 0.246
NP_441588.1_4 Forward -115 -105 14.238 0.0773
NP_443065.1_8 Forward -189 -170 16.5191 0.141
NP_442687.1_7 Reverse -107 -117 15.8113 0.0125
NP_442687.1_7 Forward -118 -108 9.02648 0.0994
NP_441846.1_10 Reverse -122 -141 -15.9302 0.256
NP_441846.1_10 Reverse -119 -138 -22.2233 0.257
NP_441846.1_10 Reverse -107 -126 -22.8133 0.266
NP_441846.1_10 Reverse -211 -230 -23.7966 0.298
NP_441013.1_2 Forward -197 -179 1.98577 0.242
NP_441422.1_7 Forward -229 -212 -7.04099 0.256
NP_440691.1_5 Reverse -110 -129 14.2574 0.184
NP_440533.1_9 Forward -162 -143 2.85105 0.261
NP_442658.1_1 Reverse -106 -116 15.9091 0.00966
NP_442658.1_1 Forward -119 -109 14.2375 0.0237
NP_442658.1_1 Reverse -154 -164 12.9592 0.0423
NP_442782.1_2 Reverse -108 -122 1.57289 0.281
NP_442782.1_2 Forward -392 -378 0.786239 0.284
NP_442782.1_2 Reverse -156 -170 0.687908 0.286
NP_442205.1_9 Reverse -70 -86 1.04184 0.255
NP_441414.1_9 Forward -117 -98 -5.80207 0.18
NP_440720.1_1 Forward -385 -366 3.34271 0.26
NP_440607.1_9 Forward -142 -123 16.2139 0.254
NP_441958.1_5 Forward -118 -108 21.2195 0.000805
NP_441958.1_5 Reverse -107 -117 12.2714 0.00183
NP_441958.1_5 Reverse -121 -131 -0.314959 0.198
NP_441127.1_1 Reverse -129 -143 20.5508 0.021
NP_440203.1_5 Forward -174 -164 9.22267 0.268
NP_439905.1_1 Reverse -109 -122 11.0324 0.204
NP_439905.1_1 Forward -293 -280 7.6891 0.25
NP_440984.1_7 Forward -122 -108 19.4691 0.00745
NP_440984.1_7 Reverse -117 -131 9.43936 0.127
NP_440984.1_7 Reverse -103 -117 7.76774 0.163
NP_439990.1_5 Forward -122 -109 7.29578 0.203
NP_442911.1_2 Reverse -98 -117 -0.885524 0.0793
NP_440153.1_8 Forward -291 -278 -2.63565 0.246
NP_440153.1_8 Forward -381 -368 -3.71729 0.299
NP_442064.1_1 Reverse -103 -122 -8.94866 0.259
NP_443055.1_6 Reverse -138 -156 0.608397 0.241
NP_443055.1_6 Forward -131 -113 -1.6532 0.281
NP_440993.1_3 Forward -301 -282 8.55343 0.129
NP_440993.1_3 Forward -127 -108 5.60352 0.151
NP_440496.1_1 Forward -282 -263 3.44104 0.266
NP_440602.1_8 Reverse -222 -236 14.2576 0.155
NP_441348.1_3 Reverse -117 -136 13.0775 0.138
NP_441099.1_5 Forward -304 -285 -11.3086 0.276
NP_441099.1_5 Reverse -325 -344 -12.2919 0.299
NP_442002.1_9 Reverse -107 -114 10.7572 0.185
NP_442431.1_10 Reverse -279 -297 13.1955 0.0764
NP_442431.1_10 Reverse -282 -300 4.83737 0.206
NP_441000.1_6 Forward -118 -104 -3.63866 0.225
NP_441000.1_6 Reverse -107 -121 -4.03198 0.225
NP_440484.1_3 Forward -119 -105 12.8809 0.242
NP_440147.1_4 Reverse -106 -119 19.6855 0.00258
NP_440147.1_4 Forward -119 -106 9.06573 0.0437
NP_441550.1_8 Forward -119 -109 15.8108 0.0132
NP_441550.1_8 Reverse -106 -116 8.3377 0.124
NP_441916.1_7 Reverse -108 -118 18.9579 0.00144
NP_441916.1_7 Forward -117 -107 18.4663 0.00144
NP_440206.1_4 Forward -136 -117 10.2251 0.185
NP_441041.1_4 Reverse -276 -295 -10.3253 0.231
NP_441041.1_4 Forward -117 -98 -13.7669 0.295
NP_441041.1_7 Forward -120 -108 13.3454 0.0485
NP_441041.1_7 Reverse -105 -117 9.55551 0.109
NP_442396.1_5 Reverse -104 -117 9.95071 0.128
NP_442004.1_6 Forward -152 -138 3.8345 0.231
NP_440703.1_9 Forward -191 -178 7.68852 0.254
NP_441725.1_4 Forward -122 -108 3.93223 0.278
NP_441725.1_5 Forward -116 -106 2.04498 0.115
NP_441725.1_5 Reverse -109 -119 1.94665 0.115
NP_439966.1_7 Forward -119 -109 14.3359 0.0203
NP_439966.1_7 Forward -133 -123 10.9926 0.0766
NP_439966.1_7 Reverse -106 -116 9.91099 0.0968
NP_439966.1_9 Reverse -106 -115 0.884706 0.253
NP_440202.1_8 Forward -125 -106 9.70905 0.297
NP_442941.1_3 Reverse -109 -119 19.2529 0.00262
NP_442941.1_3 Reverse -77 -87 2.83163 0.14
NP_442941.1_3 Forward -116 -106 2.63497 0.14
NP_440289.1_2 Forward -120 -107 -3.52063 0.267
NP_440289.1_2 Reverse -105 -118 -3.71729 0.267
NP_440289.1_4 Reverse -368 -387 9.53756 0.26
NP_440983.1_9 Forward -126 -107 2.26107 0.292
NP_440260.1_8 Forward -391 -373 -6.4707 0.291
NP_441678.1_2 Reverse -225 -244 6.78429 0.281
NP_442281.1_1 Forward -122 -108 15.9285 0.00992
NP_442281.1_1 Reverse -103 -117 4.03056 0.21
NP_441334.1_7 Reverse -106 -125 -10.817 0.12
NP_441079.1_1 Reverse -137 -156 15.3391 0.251
NP_440437.1_1 Forward -123 -104 -5.70374 0.292
NP_440647.1_9 Reverse -106 -124 15.0638 0.113
NP_442012.1_1 Forward -123 -104 6.29264 0.133
NP_441087.1_6 Forward -140 -122 -3.12816 0.296
NP_441644.1_6 Reverse -108 -118 19.0557 0.000803
NP_441644.1_6 Forward -117 -107 10.1076 0.0628
NP_441644.1_6 Reverse -282 -292 3.42118 0.282
NP_442215.1_2 Reverse -106 -122 6.15506 0.0738
NP_442247.1_8 Forward -119 -105 11.8976 0.247
NP_440253.1_2 Forward -117 -99 10.3439 0.0401
NP_440253.1_2 Reverse -346 -364 0.609134 0.181
NP_440929.1_8 Forward -117 -108 19.2726 0.000701
NP_440929.1_8 Reverse -108 -117 19.2726 0.000701
NP_442933.1_10 Forward -117 -108 17.601 0.00325
NP_442933.1_10 Reverse -108 -117 17.601 0.00325
NP_441751.2_8 Reverse -109 -123 5.01447 0.0448
NP_442554.1_8 Reverse -109 -119 17.2863 0.00543
NP_442554.1_8 Forward -116 -106 13.2547 0.0187
NP_442554.1_8 Forward -293 -283 2.53664 0.268
NP_442167.1_6 Reverse -371 -387 11.0709 0.256
NP_441762.1_7 Forward -118 -106 10.2654 0.0142
NP_441762.1_7 Reverse -107 -119 2.30059 0.0676
NP_442142.1_4 Forward -120 -107 15.4566 0.0264
NP_442142.1_4 Reverse -105 -118 5.23026 0.197
NP_442142.1_4 Forward -297 -284 4.73861 0.212
NP_442292.1_1 Reverse -109 -118 17.5026 0.00435
NP_442292.1_1 Forward -116 -107 9.63616 0.0183
NP_442292.1_5 Forward -310 -291 -1.7705 0.272
NP_441525.1_1 Reverse -152 -165 17.4239 0.139
NP_441899.1_4 Forward -398 -379 18.0924 0.233
NP_442476.1_6 Reverse -109 -123 3.73617 0.154
NP_443009.1_5 Forward -118 -107 19.626 0.00102
NP_443009.1_5 Reverse -107 -118 7.82632 0.118
NP_443009.1_5 Forward -166 -155 3.79477 0.278
NP_440807.1_9 Forward -268 -249 18.879 0.279
NP_442408.2_1 Reverse -108 -127 -7.08038 0.291
NP_442741.1_5 Forward -155 -136 9.73422 0.287
NP_441715.1_4 Reverse -109 -119 16.7946 0.0106
NP_441715.1_4 Forward -116 -106 9.41981 0.097
NP_441448.1_2 Forward -136 -117 12.1917 0.0815
NP_440379.1_5 Reverse -152 -171 -4.13045 0.208
NP_441468.1_1 Forward -116 -109 15.8704 0.0124
NP_441468.1_1 Reverse -109 -116 15.8704 0.0124
NP_441618.1_3 Reverse -108 -127 7.57094 0.15
NP_441020.2_6 Reverse -106 -123 14.1985 0.0592
NP_441020.2_6 Reverse -120 -137 9.57695 0.168
NP_441015.1_10 Reverse -117 -136 -4.32711 0.202
NP_441015.1_10 Reverse -207 -226 -6.49039 0.249
NP_441015.1_10 Reverse -280 -299 -8.65367 0.276
NP_441015.1_10 Reverse -127 -146 -10.6203 0.286
NP_441015.1_10 Forward -380 -361 -11.6036 0.298
NP_441673.1_1 Forward -117 -108 20.8459 0.000698
NP_441673.1_1 Reverse -108 -117 20.8459 0.000698
NP_440265.1_8 Reverse -321 -339 12.9005 0.282
NP_441330.1_1 Forward -122 -103 6.29264 0.0253
NP_442868.1_6 Forward -119 -109 10.4031 0.038
NP_442868.1_6 Reverse -106 -116 0.865012 0.205
NP_442719.1_2 Reverse -237 -255 -10.7979 0.283
NP_441612.1_2 Forward -368 -358 15.7134 0.209
NP_441612.1_2 Forward -365 -355 9.13016 0.21
NP_442227.1_2 Forward -133 -114 1.47442 0.245
NP_442427.1_5 Reverse -365 -384 5.50599 0.227
NP_442427.1_8 Reverse -99 -118 5.50599 0.264
NP_442808.1_1 Reverse -107 -117 18.4657 0.00201
NP_442808.1_1 Forward -118 -108 8.73102 0.0481
NP_442808.1_1 Forward -132 -122 7.55106 0.0756
NP_442808.1_1 Forward -153 -143 1.35624 0.287
NP_441101.1_7 Reverse -277 -296 12.2908 0.29
NP_441101.1_10 Forward -169 -150 -7.57203 0.29
NP_440145.1_3 Forward -127 -108 -5.9004 0.282
NP_442542.1_9 Forward -124 -110 12.2903 0.11
NP_442050.1_5 Forward -119 -109 15.9091 0.0091
NP_441114.1_3 Forward -343 -334 7.86621 0.231
NP_440558.1_2 Reverse -158 -177 -4.6221 0.247
NP_442789.1_4 Reverse -106 -125 -0.4922 0.204
NP_440093.1_7 Reverse -49 -68 11.2092 0.273
NP_442792.1_5 Forward -265 -248 10.6586 0.285
NP_441878.1_6 Forward -118 -108 10.5014 0.0176
NP_441878.1_6 Reverse -107 -117 10.4031 0.0176
NP_441878.1_6 Forward -193 -183 10.1081 0.0184
NP_441878.1_6 Reverse -182 -192 1.84832 0.0588
NP_441878.1_6 Reverse -371 -381 0.176696 0.147
NP_441878.1_6 Reverse -155 -165 -7.49312 0.231
NP_441878.1_6 Forward -382 -372 -7.88644 0.278
NP_441036.1_8 Reverse -107 -117 17.7779 0.000554
NP_441036.1_8 Forward -118 -108 15.713 0.00724
NP_441557.1_5 Forward -117 -108 19.9609 0.000699
NP_441557.1_5 Reverse -108 -117 19.9609 0.000699
NP_441557.1_8 Forward -138 -128 11.8776 0.236
NP_441445.1_1 Reverse -99 -118 0.884433 0.266
NP_441445.1_8 Reverse -184 -203 -10.227 0.277
NP_442066.2_4 Reverse -108 -127 -8.65367 0.294
NP_442066.2_9 Forward -121 -108 12.6056 0.154
NP_440744.1_2 Reverse -107 -126 14.7221 0.284
NP_440101.1_3 Reverse -280 -299 7.17762 0.179
NP_440101.1_3 Forward -392 -373 2.26107 0.259
NP_441458.1_10 Forward -126 -107 2.26107 0.272
NP_442830.1_5 Forward -133 -119 8.06211 0.215
NP_442469.1_2 Reverse -116 -134 13.8838 0.298
NP_440979.1_8 Forward -245 -226 19.2723 0.106
NP_441574.1_1 Forward -312 -293 -1.37718 0.216
NP_442347.1_2 Forward -116 -107 11.1111 0.056
NP_442347.1_2 Reverse -360 -369 8.25953 0.102
NP_442347.1_2 Reverse -109 -118 3.34298 0.284
NP_442645.1_2 Forward -125 -106 -22.5183 0.291
NP_442888.1_6 Forward -365 -346 5.11266 0.228
NP_441037.1_4 Reverse -106 -116 14.7245 0.028
NP_441037.1_4 Forward -119 -109 7.22024 0.237
NP_442594.1_8 Reverse -210 -229 9.0459 0.2
NP_442047.1_2 Forward -221 -207 11.7993 0.297
NP_441633.1_3 Forward -119 -106 3.65753 0.0699
NP_441633.1_3 Reverse -106 -119 3.36254 0.0699
NP_440136.1_2 Forward -116 -109 15.9687 0.0123
NP_440136.1_2 Reverse -109 -116 15.9687 0.0123
NP_442590.1_10 Forward -351 -332 4.42435 0.276
NP_442590.1_10 Reverse -359 -378 3.44104 0.293
NP_442998.1_2 Forward -134 -115 4.71854 0.262
NP_442998.1_5 Forward -268 -258 11.1898 0.191
NP_442998.1_10 Forward -115 -108 15.5754 0.0102
NP_442998.1_10 Reverse -110 -117 15.5754 0.0102
NP_440899.1_2 Forward -128 -109 19.6648 0.0314
NP_440899.1_2 Forward -203 -184 9.93006 0.172
NP_440299.1_1 Reverse -104 -117 10.9334 0.0529
NP_441799.1_1 Forward -121 -107 19.1735 0.00693
NP_441799.1_1 Reverse -104 -118 13.2736 0.0337
NP_441799.1_1 Forward -298 -284 8.55376 0.112
NP_441007.1_10 Forward -122 -109 10.8357 0.0646
NP_442201.1_10 Forward -128 -109 -5.50708 0.165
NP_442333.2_5 Forward -128 -109 -5.31042 0.214
NP_440256.1_1 Forward -120 -101 9.93088 0.0193
NP_440256.1_1 Forward -168 -149 4.81767 0.0411
NP_440256.1_1 Reverse -105 -124 -7.76869 0.245
NP_440256.1_1 Reverse -119 -138 -9.24366 0.275
NP_442526.1_3 Reverse -80 -99 18.17 0.183
NP_442007.1_8 Forward -295 -277 10.7364 0.258
NP_441559.1_8 Forward -349 -335 2.06454 0.148
NP_441559.1_8 Forward -122 -108 1.37622 0.156
NP_441559.1_8 Reverse -103 -117 -6.39192 0.277
NP_441270.1_5 Reverse -272 -291 15.8244 0.191
NP_440915.1_6 Reverse -104 -118 4.81781 0.0953
NP_440915.1_6 Forward -121 -107 0.982901 0.148
NP_440915.1_6 Forward -135 -121 -0.787057 0.209
NP_440915.1_6 Reverse -126 -140 -2.75368 0.28
NP_440997.1_6 Reverse -291 -310 8.06259 0.29
NP_442785.1_7 Forward -119 -105 10.0294 0.231
NP_441866.1_6 Reverse -249 -268 7.86512 0.265
NP_442866.1_1 Reverse -150 -169 -4.42544 0.227
NP_441464.1_8 Forward -117 -103 4.91614 0.26
NP_441494.1_6 Forward -380 -367 10.8357 0.225
NP_441494.1_6 Forward -122 -109 5.72248 0.294
NP_442993.1_1 Forward -117 -101 -8.10294 0.153
NP_442993.1_1 Reverse -251 -267 -13.1178 0.286
NP_442386.1_9 Reverse -107 -116 15.7322 0.0144
NP_442386.1_9 Forward -118 -109 6.39082 0.219
NP_440570.1_5 Reverse -325 -344 2.3594 0.234
NP_441750.1_1 Forward -321 -302 -10.3253 0.3
NP_441750.1_1 Forward -126 -107 -10.9153 0.3
NP_441340.1_5 Forward -116 -109 15.6737 0.0124
NP_441340.1_5 Reverse -109 -116 15.6737 0.0124
NP_442240.1_2 Reverse -109 -128 -0.688862 0.0609
NP_440161.1_3 Forward -119 -100 11.6025 0.208
NP_440586.1_8 Forward -116 -109 13.2151 0.026
NP_440586.1_8 Reverse -109 -116 13.2151 0.026
NP_440586.1_9 Forward -157 -138 12.7825 0.258
NP_442251.1_6 Forward -116 -109 15.2804 0.0124
NP_442251.1_6 Reverse -109 -116 15.2804 0.0124
NP_441262.1_3 Reverse -108 -115 14.7888 0.0223
NP_441262.1_3 Forward -117 -110 14.7888 0.0223
NP_440027.1_3 Forward -127 -109 7.58986 0.208
NP_440027.1_3 Reverse -365 -383 3.26332 0.275
NP_443051.1_1 Forward -118 -109 19.5676 0.00335
NP_443051.1_1 Reverse -107 -116 10.4228 0.00754
NP_439937.1_9 Forward -118 -101 -16.383 0.287
NP_441657.1_4 Forward -237 -218 22.5164 0.0908
NP_441595.1_4 Forward -201 -182 20.1573 0.135
NP_440926.1_9 Forward -392 -373 10.4225 0.275
NP_440408.1_7 Reverse -108 -127 7.66927 0.284
NP_440626.1_1 Forward -164 -145 10.7167 0.24
NP_440439.1_1 Forward -120 -107 18.1122 0.0105
NP_440439.1_1 Reverse -119 -132 8.9674 0.0488
NP_440439.1_1 Reverse -105 -118 1.00259 0.164
NP_442239.1_8 Reverse -275 -294 5.211 0.281
NP_439943.1_1 Reverse -258 -277 -4.72043 0.216
NP_439943.1_7 Reverse -103 -122 1.86774 0.299
NP_440372.1_2 Forward -116 -109 16.3621 0.0124
NP_440372.1_2 Reverse -109 -116 16.3621 0.0124
NP_440574.1_7 Reverse -219 -238 10.2259 0.283
NP_442511.1_2 Reverse -153 -172 14.0175 0.23
NP_440316.1_10 Forward -375 -365 7.84651 0.245
NP_441803.1_10 Reverse -130 -144 12.7826 0.295
NP_441572.1_7 Forward -123 -104 -4.42544 0.235
NP_440267.1_2 Forward -122 -108 11.5037 0.125
NP_440267.1_2 Forward -182 -168 6.39049 0.229
NP_442384.1_10 Reverse -108 -121 17.0305 0.0065
NP_442384.1_10 Forward -117 -104 7.09911 0.0875
NP_440364.1_10 Reverse -277 -296 15.0441 0.256
NP_442262.1_10 Forward -116 -109 14.1988 0.0123
NP_442262.1_10 Reverse -109 -116 14.1988 0.0123
NP_441689.1_5 Forward -119 -109 8.3377 0.132
NP_440344.1_10 Reverse -101 -118 -8.0243 0.121
NP_440282.1_10 Forward -127 -108 -6.68705 0.25
NP_440531.1_1 Forward -266 -247 31.4654 0.000206
NP_440531.1_2 Forward -320 -301 24.5822 0.00384
NP_440531.1_3 Forward -227 -208 27.9255 0.00157
NP_440531.1_5 Forward -299 -280 29.9904 0.000103
NP_440531.1_6 Forward -125 -106 27.3355 0.00153
NP_440531.1_6 Reverse -364 -383 -4.81876 0.287
NP_440531.1_6 Reverse -114 -133 -4.81876 0.287
NP_440531.1_7 Forward -341 -322 29.7937 0.0000369
NP_440531.1_8 Forward -392 -373 28.5154 0.000653
NP_440531.1_10 Forward -203 -184 20.5506 0.153
NP_441060.1_4 Forward -284 -266 2.18243 0.256
NP_441965.1_10 Reverse -105 -121 13.4315 0.103
NP_442529.1_4 Reverse -99 -118 11.7008 0.175
NP_440297.1_9 Forward -116 -106 -0.118297 0.282
NP_440297.1_9 Reverse -109 -119 -0.216628 0.282
NP_441592.1_4 Forward -198 -179 -0.39387 0.243
NP_441896.1_3 Forward -274 -255 0.687771 0.224
NP_441896.1_3 Reverse -99 -118 -1.18052 0.253
NP_440894.1_10 Forward -158 -139 3.73603 0.266
NP_440999.1_9 Forward -295 -281 -0.492064 0.209
NP_440999.1_9 Forward -121 -107 -1.8687 0.252
NP_440999.1_9 Reverse -281 -295 -2.55701 0.27
NP_440888.1_2 Reverse -108 -122 12.2903 0.0476
NP_440888.1_2 Forward -131 -117 8.65209 0.152
NP_440888.1_2 Forward -117 -103 8.16044 0.171
NP_440888.1_2 Reverse -359 -373 5.30886 0.284
NP_440600.1_4 Forward -125 -107 -1.35749 0.163
NP_440600.1_4 Reverse -100 -118 -5.88071 0.282
NP_440052.1_5 Forward -142 -123 -4.32711 0.254
NP_439969.1_3 Reverse -103 -122 0.58944 0.265
NP_442033.1_10 Forward -164 -145 -2.0655 0.148
NP_441543.1_2 Forward -116 -107 18.486 0.00236
NP_441543.1_2 Reverse -109 -118 15.9293 0.00518
NP_441304.1_10 Forward -393 -384 13.3727 0.249
NP_441469.1_4 Reverse -356 -375 9.24257 0.282
NP_441469.1_8 Reverse -107 -116 16.126 0.00797
NP_441469.1_8 Forward -118 -109 6.5879 0.227
NP_442315.1_1 Reverse -226 -244 4.9357 0.256
NP_442315.1_2 Reverse -231 -243 9.38042 0.291
NP_443064.1_6 Reverse -108 -118 10.8217 0.13
NP_442337.1_8 Reverse -112 -131 1.0811 0.241
NP_441306.1_6 Reverse -376 -395 16.4207 0.221
NP_441306.1_10 Forward -389 -375 13.2736 0.25
NP_442578.1_7 Forward -116 -109 14.5921 0.026
NP_442578.1_7 Reverse -109 -116 14.5921 0.026
NP_440710.1_1 Forward -125 -107 2.77242 0.12
NP_441462.1_2 Reverse -108 -118 20.2362 0.000805
NP_441462.1_2 Forward -117 -107 11.5831 0.00406
NP_441621.1_7 Reverse -106 -120 4.22782 0.0934
NP_443062.1_1 Reverse -108 -126 9.22847 0.138
NP_443062.1_1 Forward -117 -99 3.67056 0.289
NP_440519.1_6 Reverse -360 -374 10.4227 0.29
NP_442204.1_1 Forward -121 -110 11.2684 0.0565
NP_442204.1_2 Forward -127 -108 6.58763 0.287
NP_442204.1_5 Reverse -275 -294 1.17943 0.241
NP_442487.1_5 Forward -355 -336 1.96529 0.3
NP_442537.1_3 Forward -156 -137 14.0608 0.239
NP_440516.1_2 Reverse -102 -120 -1.75081 0.292
NP_440516.1_8 Forward -117 -108 16.9127 0.00442
NP_440516.1_8 Reverse -108 -117 16.9127 0.00442
NP_442428.1_5 Forward -116 -109 15.8704 0.0124
NP_442428.1_5 Reverse -109 -116 15.8704 0.0124
NP_442428.1_8 Forward -382 -363 0.982764 0.236
NP_441443.1_7 Forward -393 -374 8.35759 0.117
NP_441443.1_7 Forward -168 -149 -0.983855 0.25
NP_441867.1_2 Forward -384 -365 -19.3717 0.291
NP_440673.1_2 Reverse -137 -156 10.4871 0.207
NP_440673.1_2 Reverse -362 -381 7.75569 0.292
NP_440673.1_3 Forward -115 -108 12.4288 0.0426
NP_440673.1_3 Reverse -110 -117 12.4288 0.0426
NP_441052.1_2 Forward -344 -334 12.2714 0.0285
NP_441052.1_2 Forward -117 -107 10.5014 0.0285
NP_441052.1_2 Reverse -108 -118 10.4031 0.0285
NP_442219.1_9 Forward -116 -107 8.35786 0.0681
NP_442219.1_9 Reverse -109 -118 8.25953 0.0681
NP_440436.1_4 Forward -116 -107 18.1905 0.00233
NP_440436.1_4 Reverse -109 -118 9.24241 0.0871
NP_440436.1_4 Forward -164 -155 8.75075 0.0995
NP_441884.1_8 Reverse -107 -126 -10.3253 0.268
NP_441884.1_9 Forward -393 -374 -12.7836 0.138
NP_441884.1_9 Reverse -105 -124 -14.4552 0.138
NP_441884.1_9 Reverse -282 -301 -23.9933 0.284
NP_441893.1_5 Forward -195 -181 15.4369 0.288
NP_440314.1_9 Forward -245 -226 -9.93197 0.281
NP_441719.1_4 Forward -116 -109 16.3621 0.0124
NP_441719.1_4 Reverse -109 -116 16.3621 0.0124
NP_441733.1_10 Forward -120 -107 5.82081 0.203
NP_442813.1_5 Forward -208 -189 2.85105 0.275
NP_442366.1_5 Reverse -105 -115 13.3526 0.0775
NP_441034.1_4 Forward -122 -103 14.7467 0.252
NP_440296.1_10 Reverse -105 -124 -4.6221 0.209
NP_440296.1_10 Reverse -127 -146 -14.8485 0.276
NP_440296.1_10 Reverse -119 -138 -15.2418 0.29
NP_441115.1_4 Forward -118 -100 9.6548 0.206
NP_441115.1_4 Reverse -107 -125 8.27817 0.254
NP_442694.1_4 Reverse -227 -236 13.8644 0.217
NP_442206.1_10 Reverse -108 -123 6.86307 0.178
NP_440328.1_4 Reverse -102 -121 4.81767 0.159
NP_440328.1_4 Forward -374 -355 1.57275 0.223
NP_440328.1_4 Forward -123 -104 1.27776 0.23
NP_440328.1_4 Forward -137 -118 -1.27885 0.299
NP_443054.1_2 Forward -119 -105 9.04604 0.102
NP_441851.1_10 Reverse -107 -117 16.008 0.00552
NP_441851.1_10 Forward -118 -108 8.53483 0.114
NP_442208.1_5 Reverse -123 -142 -10.3253 0.298
NP_442011.1_1 Reverse -107 -126 6.09597 0.186
NP_442011.1_1 Forward -141 -122 -3.3438 0.294
NP_442856.1_7 Forward -377 -358 6.78429 0.123
NP_442856.1_7 Reverse -276 -295 6.39097 0.123
NP_442856.1_7 Forward -126 -107 -5.80207 0.287
NP_441668.1_4 Forward -391 -372 4.81767 0.173
NP_442515.1_1 Forward -368 -354 -2.06536 0.268
NP_442515.1_1 Forward -118 -104 -3.24533 0.289
NP_442515.1_1 Reverse -107 -121 -4.4253 0.298
NP_440593.1_3 Reverse -367 -386 -0.885524 0.211
NP_440463.1_8 Forward -133 -114 7.88715 0.264
NP_440165.1_5 Reverse -107 -126 3.04771 0.103
NP_441046.1_2 Forward -392 -373 2.65439 0.24
NP_441046.1_2 Forward -278 -259 1.27776 0.257
NP_441349.1_10 Forward -127 -108 -8.65367 0.278
NP_442314.1_1 Reverse -112 -130 -4.40575 0.259
NP_440432.1_9 Reverse -109 -124 6.17475 0.0477
NP_442843.1_1 Reverse -373 -392 -4.6221 0.239
NP_442843.1_1 Forward -272 -253 -5.70374 0.244
NP_439960.1_10 Forward -124 -106 -3.81576 0.282
NP_440431.1_3 Forward -118 -99 -1.47551 0.156
NP_440431.1_3 Forward -262 -243 -8.45701 0.234
NP_442450.1_5 Reverse -106 -116 7.55152 0.13
NP_442006.1_2 Forward -282 -265 -15.3991 0.224
NP_442006.1_2 Reverse -129 -146 -16.9724 0.267
NP_442006.1_2 Reverse -147 -164 -17.4641 0.276
NP_442006.1_2 Reverse -372 -389 -18.1524 0.288
NP_441003.1_9 Reverse -173 -192 5.70265 0.261
NP_441003.1_9 Reverse -363 -382 3.44104 0.292
NP_443047.1_7 Reverse -109 -128 4.42435 0.271
NP_442243.1_1 Forward -198 -180 -1.55487 0.279
NP_441570.1_1 Reverse -108 -126 9.16393 0.0121
NP_441570.1_1 Reverse -137 -155 -17.1888 0.267
NP_441570.1_1 Reverse -212 -230 -17.5821 0.283
NP_441078.1_4 Forward -117 -108 19.6659 0.0007
NP_441078.1_4 Reverse -108 -117 19.6659 0.0007
NP_441078.1_4 Forward -344 -335 3.44131 0.14
NP_441078.1_4 Reverse -156 -165 -1.57357 0.266
NP_440707.1_6 Forward -125 -106 20.2548 0.0398
NP_440707.1_8 Reverse -364 -383 13.9625 0.294
NP_440707.1_9 Reverse -288 -307 7.17762 0.232
NP_440707.1_9 Forward -311 -292 2.65439 0.268
NP_442443.1_1 Forward -125 -106 -5.60541 0.282
NP_441432.1_8 Forward -118 -109 16.8143 0.00595
NP_441432.1_8 Reverse -107 -116 8.25953 0.0755
NP_442320.1_8 Reverse -102 -116 -1.96703 0.0847
NP_442344.1_7 Forward -116 -97 -6.78538 0.172
NP_441732.1_2 Forward -121 -105 -16.2644 0.165
NP_441732.1_7 Reverse -257 -276 11.8975 0.298
NP_440629.1_6 Forward -300 -281 12.115 0.297
NP_440760.1_1 Reverse -108 -127 -21.535 0.238
NP_440461.1_3 Forward -316 -297 14.2574 0.288
NP_441945.1_10 Forward -322 -303 9.63589 0.258
NP_442353.1_4 Reverse -102 -121 3.14526 0.22
NP_442353.1_5 Forward -157 -138 17.8957 0.104
NP_440713.1_4 Forward -127 -108 2.55606 0.26
NP_440713.1_4 Forward -156 -137 1.37609 0.287
NP_442489.1_7 Forward -117 -108 20.1576 0.000695
NP_442489.1_7 Reverse -108 -117 20.1576 0.000695
NP_442489.1_7 Reverse -156 -165 -1.37691 0.195
NP_442489.1_7 Forward -165 -156 -2.06522 0.288
NP_442079.1_7 Reverse -109 -128 5.211 0.178
NP_440559.1_1 Forward -116 -107 8.75118 0.0586
NP_440559.1_1 Reverse -109 -118 8.65285 0.0586
NP_441659.2_8 Reverse -108 -118 20.9245 0.000805
NP_441659.2_8 Forward -117 -107 11.9764 0.0147
NP_441040.1_5 Reverse -178 -197 3.14605 0.275
NP_441807.1_5 Forward -128 -109 13.2741 0.122
NP_442346.1_5 Forward -118 -108 16.303 0.00248
NP_442346.1_5 Reverse -107 -117 9.02648 0.118
NP_442346.1_5 Forward -166 -156 4.60159 0.281
NP_440545.1_3 Reverse -104 -121 2.89044 0.0923
NP_441856.1_3 Reverse -105 -124 6.88262 0.11
NP_441856.1_3 Forward -308 -289 -1.67217 0.239
NP_440831.1_3 Forward -126 -107 10.1732 0.181
NP_441629.1_3 Reverse -365 -384 -2.75457 0.272
NP_441923.1_6 Reverse -124 -138 8.75105 0.278
NP_440486.1_6 Reverse -124 -143 6.4893 0.283
NP_440010.1_4 Forward -298 -279 1.17865 0.24
NP_440010.1_10 Forward -168 -149 1.47442 0.299
NP_442603.1_7 Reverse -108 -122 7.66879 0.198
NP_441948.1_4 Reverse -101 -119 14.0805 0.0336
NP_441948.1_4 Forward -124 -106 -2.3408 0.163
NP_441833.1_4 Forward -116 -109 15.9687 0.0124
NP_441833.1_4 Reverse -109 -116 15.9687 0.0124
NP_441112.1_6 Forward -127 -108 -3.3438 0.296
NP_442699.1_8 Reverse -370 -389 -11.5053 0.238
NP_442162.1_9 Forward -116 -109 16.2637 0.0124
NP_442162.1_9 Reverse -109 -116 16.2637 0.0124
NP_440671.1_4 Forward -361 -347 9.34103 0.184
NP_443026.1_5 Reverse -219 -238 -3.24547 0.283
NP_440224.1_1 Forward -128 -109 12.2908 0.0566
NP_441915.1_4 Forward -382 -363 9.24175 0.28
NP_442199.1_5 Forward -173 -154 10.6192 0.0574
NP_442199.1_5 Forward -125 -106 -7.57203 0.299
NP_442140.1_3 Forward -116 -106 16.2046 0.0255
NP_442140.1_3 Reverse -109 -119 4.69992 0.238
NP_440875.1_9 Reverse -110 -120 16.5483 0.0145
NP_440875.1_9 Reverse -158 -168 12.3628 0.12
NP_440875.1_9 Forward -129 -119 9.44274 0.233
NP_441813.1_5 Forward -119 -109 18.1713 0.00743
NP_441813.1_5 Reverse -106 -116 9.91146 0.021
NP_440590.1_4 Forward -116 -103 10.4424 0.027
NP_440590.1_4 Reverse -123 -136 8.9674 0.0402
NP_440590.1_4 Reverse -109 -122 -5.29059 0.277
NP_440590.1_9 Reverse -114 -132 8.86894 0.262
NP_440567.1_1 Reverse -109 -123 6.58777 0.0816
NP_442497.1_10 Reverse -109 -118 17.601 0.00813
NP_442497.1_10 Forward -116 -107 10.4228 0.0087
NP_440821.1_4 Reverse -106 -116 10.2065 0.0163
NP_440821.1_4 Forward -119 -109 2.24165 0.131
NP_441239.1_9 Forward -119 -107 15.5753 0.0186
NP_441239.1_9 Reverse -106 -118 12.3303 0.0477
NP_441239.1_9 Forward -194 -182 5.84051 0.206
NP_441239.1_9 Reverse -154 -166 4.46387 0.253
NP_441239.1_9 Reverse -364 -376 2.98891 0.3
NP_441951.1_6 Forward -291 -272 19.764 0.0635
NP_441892.1_1 Forward -126 -109 3.28376 0.128
NP_440665.1_1 Forward -291 -272 -17.0118 0.297
NP_442193.1_8 Forward -254 -235 9.7334 0.292
NP_440354.1_7 Forward -123 -105 9.95058 0.224
NP_442138.1_10 Reverse -108 -127 10.5209 0.0361
NP_441782.1_5 Forward -125 -106 16.6174 0.101
NP_440546.1_4 Reverse -108 -118 13.5365 0.0459
NP_440546.1_4 Forward -117 -107 11.8882 0.0679
NP_440546.1_6 Forward -397 -378 17.2074 0.121
NP_442349.1_3 Forward -243 -224 16.8141 0.0527
NP_442041.1_5 Reverse -150 -169 -0.688862 0.278
NP_441656.1_6 Reverse -111 -130 5.99764 0.269
NP_440462.1_6 Forward -119 -109 18.7612 0.00454
NP_440462.1_6 Reverse -106 -116 9.02648 0.0498
NP_440462.1_6 Reverse -74 -84 3.32329 0.25
NP_442340.1_3 Forward -163 -144 12.1925 0.0625
NP_442611.1_1 Reverse -108 -127 -1.86883 0.283
NP_440868.1_4 Forward -121 -109 17.0502 0.0124
NP_440868.1_4 Reverse -104 -116 8.39711 0.0602
NP_440868.1_8 Reverse -281 -300 10.5209 0.103
NP_441249.1_1 Reverse -235 -254 2.75272 0.206
NP_442479.1_9 Forward -275 -256 -12.2919 0.281
NP_441474.1_1 Forward -127 -108 -0.197979 0.255
NP_442402.1_4 Reverse -250 -269 2.75194 0.154
NP_442402.1_4 Reverse -291 -310 -5.50783 0.244
NP_442402.1_4 Reverse -249 -268 -7.3761 0.274
NP_442402.1_4 Reverse -351 -370 -7.96609 0.278
NP_441084.1_6 Forward -119 -105 16.2281 0.0689
NP_441084.1_6 Forward -167 -153 10.0228 0.255
NP_442039.1_4 Forward -116 -109 15.1821 0.0124
NP_442039.1_4 Reverse -109 -116 15.1821 0.0124
NP_442039.1_7 Forward -372 -362 10.8948 0.257
NP_440825.1_7 Forward -116 -106 12.4217 0.155
NP_442837.1_3 Forward -116 -109 15.7721 0.0124
NP_442837.1_3 Reverse -109 -116 15.7721 0.0124
NP_442837.1_3 Forward -84 -77 6.52896 0.2
NP_440160.1_2 Forward -267 -248 -3.73712 0.26
NP_440160.1_5 Forward -98 -88 16.7941 0.181
NP_442053.1_1 Forward -117 -108 18.3876 0.0007
NP_442053.1_1 Reverse -108 -117 18.3876 0.0007
NP_442053.1_1 Forward -131 -122 5.80125 0.164
NP_440505.1_3 Forward -119 -109 17.188 0.00332
NP_440505.1_3 Reverse -333 -343 6.76487 0.169
NP_440505.1_3 Reverse -106 -116 6.76487 0.169
NP_441203.1_1 Reverse -109 -128 -14.6519 0.197
NP_441203.1_1 Forward -151 -132 -17.6018 0.297
NP_442532.1_7 Reverse -294 -308 1.37622 0.289
NP_440914.1_1 Reverse -108 -118 16.3248 0.00196
NP_440914.1_1 Reverse -156 -166 11.6404 0.0843
NP_440914.1_1 Forward -117 -107 8.6151 0.186
NP_441011.1_8 Forward -116 -107 16.9127 0.00602
NP_441011.1_8 Reverse -109 -118 16.6177 0.00602
NP_442101.1_10 Forward -125 -106 -13.5702 0.297
NP_442533.1_1 Reverse -119 -138 -8.45701 0.205
NP_442533.1_6 Forward -117 -108 17.2076 0.00137
NP_442533.1_6 Reverse -108 -117 17.2076 0.00137
NP_442533.1_6 Forward -381 -372 11.2095 0.046
NP_442533.1_6 Forward -131 -122 10.9145 0.0503
NP_442533.1_6 Forward -191 -182 10.2261 0.0558
NP_442533.1_6 Reverse -183 -192 4.52295 0.179
NP_442232.1_3 Forward -383 -364 -7.86702 0.212
NP_442322.1_4 Forward -134 -117 -9.10659 0.287
NP_442322.1_4 Forward -125 -108 -9.59824 0.295
NP_441482.1_7 Forward -123 -109 -2.95034 0.103
NP_441482.1_7 Reverse -102 -116 -10.6202 0.211
NP_439944.1_9 Reverse -109 -119 9.12481 0.1
NP_442269.1_10 Reverse -324 -343 1.57275 0.29
NP_441028.1_6 Reverse -360 -370 12.6642 0.183
NP_440115.1_6 Forward -120 -110 14.0414 0.0615
NP_441972.1_5 Reverse -109 -128 -2.55715 0.186
NP_441106.1_1 Forward -118 -109 18.486 0.0028
NP_441106.1_1 Reverse -107 -116 18.191 0.0028
NP_441869.1_2 Forward -319 -300 15.9291 0.183
NP_442588.1_6 Forward -284 -265 -2.65548 0.294
NP_442928.1_3 Reverse -122 -141 12.8065 0.256
NP_442306.1_10 Forward -122 -103 -0.983855 0.0484
NP_441286.1_1 Forward -118 -106 -3.40261 0.145
NP_441286.1_1 Reverse -107 -119 -3.59927 0.145
NP_442674.1_3 Forward -125 -106 3.83357 0.294
NP_440670.1_8 Forward -117 -108 18.3876 0.000699
NP_440670.1_8 Reverse -108 -117 18.3876 0.000699
NP_440886.1_7 Reverse -107 -117 17.7774 0.0011
NP_440886.1_7 Forward -118 -108 8.04271 0.0805
NP_440886.1_7 Forward -132 -122 4.89613 0.213
NP_440886.1_7 Forward -345 -335 4.7978 0.218
NP_440828.1_4 Forward -142 -123 -1.47628 0.206
NP_440828.1_4 Forward -295 -276 -4.42619 0.246
NP_442614.1_2 Reverse -108 -122 10.1277 0.234
NP_442614.1_2 Reverse -129 -143 6.09611 0.293
NP_442072.1_9 Forward -118 -100 -23.2853 0.288
NP_440513.1_4 Reverse -108 -127 23.0089 0.0603
NP_442213.1_5 Forward -388 -369 5.60432 0.231
NP_441808.1_8 Reverse -279 -298 7.37428 0.278
NP_442022.1_4 Forward -393 -374 7.7676 0.268
NP_440907.2_8 Forward -116 -106 14.2375 0.0312
NP_440907.2_8 Reverse -109 -119 9.616 0.103
NP_440907.2_8 Forward -130 -120 6.96107 0.138
NP_440841.1_4 Reverse -21 -40 -6.88371 0.215
NP_441463.1_3 Forward -175 -156 0.491109 0.131
NP_441463.1_3 Reverse -98 -117 -5.70374 0.232
NP_441626.1_2 Forward -116 -109 15.7721 0.0124
NP_441626.1_2 Reverse -109 -116 15.7721 0.0124
NP_439958.1_2 Forward -95 -81 11.111 0.288
NP_442365.1_7 Reverse -331 -350 -5.50708 0.271
NP_442615.1_1 Reverse -99 -117 13.7855 0.0109
NP_442615.1_1 Forward -126 -108 0.510803 0.101
NP_441962.1_4 Reverse -367 -386 -0.885524 0.117
NP_441962.1_9 Forward -167 -148 5.70265 0.261
NP_440387.1_1 Forward -117 -101 -2.5964 0.148
NP_440387.1_1 Reverse -108 -124 -3.18639 0.156
NP_441963.1_2 Forward -371 -352 0.196116 0.274
NP_441431.1_2 Forward -120 -106 16.7152 0.033
NP_441431.1_2 Forward -195 -181 10.9137 0.15
NP_441431.1_2 Forward -378 -364 10.422 0.159
NP_441836.1_2 Reverse -279 -298 2.75272 0.165
NP_441836.1_2 Forward -350 -331 -2.95047 0.232
NP_441993.1_1 Forward -381 -362 4.87041 0.211
NP_441174.1_2 Forward -120 -106 16.0275 0.0864
NP_440814.1_8 Reverse -132 -151 0.687771 0.269
NP_440114.1_10 Forward -117 -103 9.83269 0.16
NP_440114.1_10 Reverse -108 -122 9.73436 0.164
NP_440114.1_10 Reverse -156 -170 6.09611 0.285
NP_442698.1_10 Forward -249 -230 0.392778 0.297
NP_442323.1_7 Forward -338 -319 13.5683 0.0877
NP_440287.1_6 Reverse -99 -118 7.7676 0.151
NP_441272.1_4 Forward -384 -365 0.196116 0.267
NP_440293.1_3 Reverse -181 -200 2.85105 0.192
NP_440293.1_3 Reverse -175 -194 -1.96717 0.239
NP_440293.1_3 Forward -389 -370 -5.70374 0.281
NP_439988.1_3 Reverse -178 -192 6.29277 0.278
NP_441237.1_6 Reverse -183 -200 10.4619 0.127
NP_441979.1_9 Forward -396 -377 2.75272 0.297
NP_442743.1_1 Reverse -242 -261 7.66846 0.264
NP_442743.1_4 Forward -164 -145 -3.04881 0.223
NP_442743.1_4 Reverse -109 -128 -8.35868 0.291
NP_441311.1_2 Forward -123 -109 13.8636 0.229
NP_441531.1_6 Forward -288 -275 8.37742 0.271
NP_442930.1_1 Reverse -81 -91 11.8776 0.249
NP_439910.1_2 Reverse -100 -117 -3.99273 0.0691
NP_440457.1_1 Forward -121 -109 0.628964 0.25
NP_440987.1_4 Reverse -314 -333 3.34271 0.283
NP_440798.1_6 Forward -116 -103 4.64084 0.144
NP_440798.1_6 Reverse -109 -122 2.08423 0.186
NP_441984.1_3 Reverse -118 -136 5.52568 0.282
NP_442509.1_9 Forward -117 -107 16.2041 0.00739
NP_442509.1_9 Reverse -108 -118 8.04271 0.192
NP_442936.1_10 Reverse -94 -108 8.01971 0.27
NP_442514.1_5 Forward -199 -180 -2.36125 0.219
NP_442514.1_5 Forward -147 -128 -2.95123 0.222
NP_442514.1_5 Reverse -365 -384 -7.27777 0.276
NP_441610.1_2 Forward -129 -110 8.16093 0.186
NP_440554.1_4 Reverse -109 -119 17.9746 0.0131
NP_440554.1_4 Forward -116 -106 7.35486 0.103
NP_441885.1_5 Forward -117 -107 11.4848 0.00668
NP_441885.1_5 Reverse -108 -118 11.3864 0.00668
NP_440478.1_4 Reverse -41 -60 11.1109 0.261
NP_440478.1_10 Reverse -106 -120 15.0442 0.107
NP_442341.1_7 Forward -268 -254 3.8345 0.21
NP_442341.1_9 Reverse -106 -120 7.07881 0.204
NP_442341.1_9 Reverse -185 -199 5.30886 0.274
NP_442341.1_9 Forward -119 -105 4.62054 0.296
NP_441756.1_5 Forward -135 -116 -0.39387 0.244
NP_441173.1_9 Reverse -261 -269 13.1954 0.184
NP_441173.1_9 Reverse -260 -268 12.9004 0.206
NP_442395.2_4 Reverse -365 -384 2.85027 0.214
NP_443000.1_7 Forward -119 -109 20.3345 0.00223
NP_443000.1_7 Reverse -106 -116 1.94665 0.226
NP_440275.1_3 Forward -119 -109 16.1063 0.0155
NP_440275.1_3 Reverse -106 -116 8.33817 0.0602
NP_442932.1_9 Forward -279 -260 11.9958 0.175
NP_440091.1_1 Reverse -104 -116 1.41561 0.197
NP_440679.1_2 Forward -301 -283 13.3922 0.281
NP_440679.1_10 Reverse -278 -297 0.294447 0.092
NP_441207.1_7 Forward -91 -77 12.2566 0.241
NP_439962.1_4 Reverse -373 -392 -3.54046 0.253
NP_442495.1_4 Reverse -112 -122 12.3697 0.229
NP_440149.1_8 Forward -117 -98 -5.99873 0.238
NP_441105.1_3 Forward -386 -367 -2.36049 0.159
NP_441105.1_3 Forward -176 -157 -6.98204 0.243
NP_442373.1_2 Reverse -276 -295 -5.21209 0.214
NP_442373.1_2 Forward -383 -364 -10.3253 0.278
NP_440216.1_1 Reverse -108 -122 17.1092 0.00188
NP_440216.1_1 Forward -117 -103 5.50613 0.0196
NP_440216.1_1 Reverse -122 -136 -11.8985 0.228
NP_440172.1_1 Reverse -108 -118 17.5813 0.00421
NP_440172.1_1 Forward -117 -107 8.73149 0.0586
NP_440172.1_1 Reverse -156 -166 2.04498 0.286
NP_442788.1_7 Reverse -219 -238 8.55425 0.278
NP_442015.1_3 Forward -141 -122 11.5033 0.288
NP_442015.1_10 Forward -121 -108 3.65753 0.178
NP_442015.1_10 Reverse -104 -117 1.78924 0.204
NP_441226.1_7 Forward -116 -109 14.4934 0.0123
NP_441226.1_7 Reverse -109 -116 14.4934 0.0123
NP_442446.1_3 Reverse -287 -306 10.8159 0.275
NP_441757.1_3 Reverse -107 -126 2.55606 0.155
NP_441111.1_7 Forward -116 -108 18.7023 0.00294
NP_441111.1_7 Reverse -109 -117 18.7023 0.00294
NP_441766.1_2 Forward -117 -108 17.5026 0.00297
NP_441766.1_2 Reverse -108 -117 17.5026 0.00297
NP_442417.1_5 Forward -285 -271 4.71948 0.291
NP_442417.1_5 Reverse -108 -122 4.62115 0.292
NP_440416.1_9 Reverse -101 -120 -15.1435 0.186
NP_440416.1_9 Forward -124 -105 -16.0285 0.206
NP_441940.1_4 Forward -167 -148 6.19431 0.294
NP_442154.1_1 Reverse -274 -292 -16.0088 0.229
NP_440261.1_5 Reverse -109 -122 16.1456 0.0132
NP_440261.1_5 Forward -116 -103 -12.2721 0.277
NP_440988.1_5 Forward -256 -237 15.0051 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCTCACAGGCGCAATTTTGGCCGGGGCCACTGGGGAACAACAACAGAGACTGGCCCGCTATGCCCAGAATATTGGCTTAGCTTTTCAAGTGGTGGATGACATCCTCGACATCACCGCCACCCAGGAAGAGTTGGGTAAAACCGCTGGTAAAGATGTCAAAGCCCAAAAAGCCACCTATCCCAGTCTCCTCGGTTTGGAAGCTTCCCGGGCCCAGGCCCAAAGTTTGATTGACCAGGCCATTGTCGCCCTGGAACCCTTTGGCCCCTCCGCCGAGCCCCTCCAGGCGATCGCCGAATATATTGTTGCCAGAAAATATTGATCCCTTGCCTCAAACTAATTTCCCGTTAAGCTAGGGACAGTTTTATCTGTTCATTGCATTAATTGAACTCACTACTCACC

CDS

ATGCTGGGAAATTTTCAACATAGCCAACTCCGCATTGAAGTGGAAGCAACGGCACCGGTAATTCGGGACAGCTTAACCAAAATTCCCCAACTGCGGCAATGGTTAGCCCCCCTCCCCCTGGGAGAAGGTTTGCCGGAGCGATTGATCCCCGGTGTTACGCTCCACACTGGTGTGGGTTTAGCCACATTAACCCAAACGGTGGACCGGGTAGGGGATGACCATTTGCGTCTCATACTCAGTGGGACCATTGACGGTTTCCATGAATGGTACTGGGGCGATGGTTGGGTCCAATCCCGTTTGGAAGGTATTTCCCTGTTGCCCCTAAATTTAGGCCAGACCCTTAGTTTACTCAAGCTAAAGCAATTTGTTACCACCGTTAAAAGCCCAGTCGTTTAA

Protein

MLGNFQHSQLRIEVEATAPVIRDSLTKIPQLRQWLAPLPLGEGLPERLIPGVTLHTGVGLATLTQTVDRVGDDHLRLILSGTIDGFHEWYWGDGWVQSRLEGISLLPLNLGQTLSLLKLKQFVTTVKSPVV