Your browser is old and dusty. Try Google Chrome!

Details for slr0739

ORF slr0739
Accession NP_440010.1
Symbol crtE
Category Carotenoid
Definition geranylgeranyl pyrophosphate synthase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -251 -237 1.96621 0.179
NP_441061.1_2 Forward -257 -243 1.76955 0.183
NP_441061.1_2 Reverse -250 -264 -1.27871 0.255
NP_441061.1_2 Reverse -308 -322 -2.65535 0.3
NP_440795.1_7 Forward -257 -250 14.6904 0.0123
NP_440795.1_7 Reverse -250 -257 14.6904 0.0123
NP_441418.1_6 Reverse -249 -268 -20.3551 0.111
NP_441418.1_6 Forward -258 -239 -29.2048 0.219
NP_442291.1_5 Forward -259 -243 12.5466 0.0314
NP_442291.1_5 Reverse -248 -264 3.10679 0.114
NP_442291.1_5 Reverse -157 -173 -3.57971 0.245
NP_440897.1_6 Forward -258 -239 -0.787962 0.185
NP_441453.1_4 Reverse -249 -257 16.539 0.00633
NP_441453.1_4 Forward -258 -250 16.539 0.00633
NP_441453.1_4 Forward -40 -32 4.14932 0.264
NP_442151.1_6 Forward -258 -244 10.3243 0.125
NP_440561.1_1 Reverse -302 -321 10.3234 0.284
NP_441818.1_1 Forward -257 -246 18.8393 0.00301
NP_441818.1_9 Forward -188 -169 -9.047 0.287
NP_440226.1_1 Reverse -249 -268 15.7324 0.0231
NP_440226.1_1 Forward -258 -239 6.98095 0.115
NP_441630.1_3 Reverse -212 -231 -0.4922 0.288
NP_442744.1_8 Reverse -31 -50 2.3594 0.196
NP_442744.1_9 Forward -264 -250 12.6414 0.288
NP_442287.1_1 Forward -34 -24 15.2208 0.22
NP_442655.1_10 Reverse -66 -85 -13.2752 0.266
NP_443002.1_5 Reverse -372 -390 9.94979 0.27
NP_442173.1_1 Forward -257 -249 15.4574 0.00633
NP_442173.1_1 Reverse -250 -258 15.4574 0.00633
NP_442752.1_4 Reverse -158 -165 15.0838 0.0199
NP_442752.1_4 Forward -258 -251 13.8055 0.0199
NP_442752.1_4 Reverse -249 -256 13.8055 0.0199
NP_442752.1_4 Reverse -75 -82 10.5605 0.1
NP_443027.1_4 Forward -260 -250 14.828 0.0437
NP_443027.1_4 Reverse -247 -257 14.0414 0.0452
NP_441812.1_3 Reverse -248 -262 15.6342 0.0985
NP_442975.1_10 Forward -262 -248 21.3367 0.00107
NP_440784.1_7 Forward -257 -250 15.9687 0.0123
NP_440784.1_7 Reverse -250 -257 15.9687 0.0123
NP_442909.1_7 Forward -172 -158 5.60385 0.275
NP_441145.1_1 Reverse -30 -49 5.89931 0.254
NP_440878.1_9 Forward -394 -375 2.65439 0.176
NP_442062.1_8 Reverse -249 -259 19.4496 0.000558
NP_442062.1_8 Forward -258 -248 17.3846 0.00193
NP_442062.1_8 Forward -40 -30 12.6647 0.0292
NP_442062.1_8 Reverse -158 -168 3.91327 0.243
NP_441900.1_2 Reverse -185 -203 -1.55487 0.27
NP_441900.1_2 Forward -91 -73 -2.34152 0.278
NP_441859.1_3 Forward -297 -278 1.86696 0.272
NP_441859.1_3 Reverse -248 -267 1.27698 0.29
NP_440735.1_2 Forward -178 -159 18.6974 0.275
NP_440304.1_4 Forward -260 -250 10.8948 0.051
NP_440304.1_4 Reverse -247 -257 10.8948 0.051
NP_440304.1_4 Reverse -29 -39 5.97822 0.185
NP_440304.1_4 Reverse -305 -315 3.51995 0.296
NP_442242.1_4 Forward -257 -250 14.3954 0.0124
NP_442242.1_4 Reverse -250 -257 14.3954 0.0124
NP_440044.1_8 Forward -257 -238 14.2574 0.0301
NP_440044.1_8 Reverse -250 -269 2.16274 0.155
NP_441935.1_2 Reverse -237 -256 -3.54046 0.253
NP_441594.1_6 Reverse -38 -57 8.06259 0.166
NP_441594.1_6 Forward -204 -185 4.916 0.211
NP_441594.1_6 Forward -261 -242 0.786102 0.281
NP_441594.1_6 Reverse -240 -259 0.294447 0.289
NP_442110.1_7 Forward -258 -244 9.14437 0.0755
NP_442110.1_7 Reverse -158 -172 6.48943 0.142
NP_441925.1_4 Forward -43 -24 -14.7509 0.263
NP_441925.1_4 Reverse -221 -240 -14.8492 0.263
NP_440856.1_4 Reverse -242 -261 -1.96717 0.205
NP_440856.1_7 Forward -252 -233 -0.197208 0.167
NP_441083.1_3 Forward -317 -307 12.2709 0.272
NP_441083.1_5 Forward -258 -248 20.3345 0.00053
NP_441083.1_5 Reverse -249 -259 11.3864 0.0159
NP_441083.1_5 Forward -167 -157 7.45319 0.0546
NP_441083.1_5 Forward -40 -30 -0.314959 0.265
NP_441738.1_2 Forward -256 -249 15.28 0.0102
NP_441738.1_2 Reverse -251 -258 15.28 0.0102
NP_441738.1_2 Forward -165 -158 11.7401 0.0647
NP_440209.1_1 Reverse -249 -257 18.1123 0.00295
NP_440209.1_1 Forward -258 -250 18.1123 0.00295
NP_442889.1_1 Reverse -295 -314 -12.7836 0.239
NP_442889.1_8 Forward -261 -247 19.7634 0.00619
NP_442889.1_8 Forward -354 -340 6.68548 0.178
NP_440410.1_10 Forward -330 -311 2.85105 0.256
NP_441713.1_3 Forward -252 -233 2.55606 0.277
NP_441770.1_5 Forward -266 -247 -1.86883 0.277
NP_440178.1_7 Forward -259 -240 -16.0285 0.164
NP_442570.1_3 Reverse -23 -42 7.57094 0.143
NP_442570.1_3 Reverse -22 -41 6.68596 0.151
NP_442570.1_3 Reverse -156 -175 -8.85033 0.294
NP_440538.1_10 Reverse -163 -182 10.4225 0.279
NP_441716.1_1 Forward -258 -244 6.48943 0.198
NP_442111.1_4 Reverse -248 -262 9.2427 0.0619
NP_442111.1_4 Reverse -286 -300 5.50613 0.162
NP_441624.1_7 Forward -386 -372 7.9644 0.241
NP_440343.1_3 Reverse -221 -239 5.32826 0.257
NP_440343.1_9 Forward -238 -219 7.07928 0.291
NP_440906.1_5 Forward -257 -250 15.8704 0.0124
NP_440906.1_5 Reverse -250 -257 15.8704 0.0124
NP_440747.1_10 Reverse -246 -258 7.51213 0.00286
NP_440747.1_10 Forward -261 -249 -2.1243 0.0225
NP_440747.1_10 Forward -43 -31 -2.61596 0.0556
NP_441130.1_10 Forward -260 -246 10.816 0.11
NP_441486.1_1 Reverse -246 -260 19.6658 0.00323
NP_441486.1_1 Forward -261 -247 11.2093 0.0168
NP_441486.1_1 Forward -170 -156 1.47456 0.109
NP_441486.1_1 Reverse -339 -353 -3.147 0.176
NP_442634.1_4 Forward -190 -176 -3.54032 0.161
NP_440403.1_4 Reverse -31 -50 -8.55534 0.257
NP_440403.1_10 Reverse -240 -259 8.84924 0.189
NP_441014.1_10 Reverse -341 -360 4.42355 0.197
NP_441014.1_10 Reverse -248 -267 4.12856 0.205
NP_441014.1_10 Forward -34 -15 -1.27961 0.259
NP_442848.1_1 Reverse -243 -257 5.21113 0.0859
NP_442848.1_1 Forward -264 -250 -1.37704 0.263
NP_442848.1_5 Forward -47 -29 1.49411 0.276
NP_442848.1_9 Reverse -32 -51 3.53937 0.223
NP_442848.1_9 Reverse -366 -385 -0.39387 0.278
NP_443018.1_3 Forward -257 -250 14.8871 0.0123
NP_443018.1_3 Reverse -250 -257 14.8871 0.0123
NP_443018.1_3 Forward -39 -32 10.7572 0.0907
NP_443018.1_3 Forward -350 -343 10.2655 0.107
NP_443018.1_3 Reverse -32 -39 4.56234 0.241
NP_441634.1_8 Reverse -370 -384 3.73617 0.143
NP_441634.1_8 Reverse -247 -261 3.63784 0.145
NP_440376.1_1 Forward -258 -249 19.4693 0.000692
NP_440376.1_1 Reverse -249 -258 19.4693 0.000692
NP_440376.1_1 Reverse -24 -33 8.06287 0.0463
NP_440376.1_1 Reverse -31 -40 6.48957 0.0963
NP_440376.1_1 Forward -40 -31 6.19458 0.109
NP_440376.1_1 Reverse -158 -167 3.44131 0.203
NP_441588.1_4 Forward -256 -246 8.63316 0.14
NP_441588.1_4 Forward -165 -155 6.37155 0.2
NP_442687.1_7 Forward -259 -249 15.8113 0.0125
NP_442687.1_7 Reverse -30 -40 9.12481 0.0994
NP_442687.1_7 Reverse -248 -258 8.92815 0.0994
NP_442687.1_7 Reverse -306 -316 5.19158 0.217
NP_442687.1_7 Forward -41 -31 4.60159 0.243
NP_442485.1_3 Forward -327 -308 2.94938 0.207
NP_442485.1_3 Forward -51 -32 -2.65548 0.264
NP_442485.1_3 Reverse -109 -128 -4.22878 0.278
NP_441846.1_10 Reverse -30 -49 -20.5517 0.256
NP_441846.1_10 Forward -327 -308 -23.01 0.275
NP_440642.1_10 Forward -389 -375 5.1122 0.242
NP_440642.1_10 Reverse -119 -133 1.27731 0.296
NP_440533.1_4 Reverse -28 -47 13.6675 0.297
NP_440533.1_9 Forward -333 -314 4.32602 0.229
NP_440360.1_10 Forward -82 -68 3.44117 0.232
NP_442658.1_1 Forward -260 -250 15.9091 0.00966
NP_442658.1_1 Reverse -29 -39 12.3692 0.0569
NP_442658.1_1 Reverse -247 -257 6.76441 0.214
NP_442658.1_1 Reverse -172 -182 6.56775 0.224
NP_441855.2_4 Forward -266 -247 10.2943 0.257
NP_442782.1_2 Forward -322 -308 3.04785 0.269
NP_442496.1_5 Forward -359 -341 9.95058 0.217
NP_442544.1_6 Forward -265 -246 -4.52377 0.244
NP_441414.1_9 Forward -258 -239 3.83436 0.0572
NP_441414.1_9 Reverse -249 -268 1.47442 0.0738
NP_441487.1_9 Forward -259 -240 -2.16383 0.293
NP_441958.1_5 Forward -259 -249 12.2714 0.00183
NP_441958.1_5 Reverse -248 -258 12.2714 0.00183
NP_441958.1_5 Reverse -30 -40 1.06167 0.116
NP_440984.1_7 Forward -45 -31 7.86607 0.161
NP_442911.1_2 Forward -268 -249 3.83436 0.0414
NP_442911.1_2 Reverse -239 -258 -0.688862 0.0775
NP_440153.1_5 Reverse -250 -264 6.88276 0.174
NP_440153.1_5 Reverse -159 -173 5.99778 0.191
NP_440153.1_5 Forward -257 -243 0.392915 0.299
NP_441941.1_4 Forward -389 -370 20.8456 0.0271
NP_441941.1_7 Forward -185 -166 31.1704 0.000201
NP_443055.1_6 Forward -251 -233 3.26332 0.199
NP_440993.1_2 Reverse -244 -260 1.04184 0.295
NP_440602.1_8 Forward -258 -244 18.1908 0.0898
NP_442853.1_5 Forward -190 -171 16.4199 0.0935
NP_442002.1_9 Forward -259 -252 10.7572 0.185
NP_440809.1_9 Forward -332 -314 -5.38906 0.225
NP_440809.1_9 Reverse -240 -258 -7.25734 0.225
NP_441294.1_7 Forward -171 -157 9.25063 0.256
NP_441646.1_1 Reverse -24 -43 6.09597 0.174
NP_441646.1_1 Forward -265 -246 1.47442 0.231
NP_442438.1_10 Reverse -244 -258 17.4042 0.0188
NP_442438.1_10 Forward -321 -307 5.40779 0.134
NP_442438.1_10 Forward -172 -158 4.03116 0.152
NP_441752.1_6 Reverse -311 -330 2.16274 0.243
NP_441000.1_6 Forward -259 -245 3.8345 0.104
NP_441000.1_6 Reverse -248 -262 -3.83532 0.225
NP_440147.1_4 Reverse -29 -42 7.29578 0.0712
NP_440147.1_4 Forward -260 -247 3.36254 0.188
NP_440147.1_4 Reverse -247 -260 0.805932 0.244
NP_441295.1_4 Reverse -244 -263 -3.44213 0.29
NP_441550.1_8 Reverse -247 -257 12.3692 0.0336
NP_441550.1_8 Forward -214 -204 12.0743 0.0379
NP_441550.1_8 Forward -260 -250 6.0761 0.214
NP_441916.1_7 Reverse -249 -259 18.4663 0.00144
NP_441916.1_7 Forward -258 -248 10.3048 0.0261
NP_441916.1_7 Reverse -31 -41 5.97822 0.111
NP_441916.1_10 Forward -353 -334 0.687771 0.278
NP_440206.1_4 Forward -222 -203 7.4718 0.209
NP_440206.1_4 Reverse -309 -328 -0.886293 0.29
NP_441041.1_4 Forward -258 -239 -5.31042 0.151
NP_442396.1_5 Reverse -245 -258 8.18076 0.16
NP_442396.1_5 Forward -262 -249 7.39411 0.204
NP_442396.1_5 Reverse -357 -370 6.31247 0.243
NP_443063.1_3 Reverse -367 -386 15.3391 0.171
NP_442004.1_6 Forward -258 -244 1.47456 0.288
NP_441725.1_5 Forward -257 -247 11.2881 0.0247
NP_441725.1_5 Reverse -250 -260 11.2881 0.0247
NP_441725.1_5 Forward -39 -29 7.64985 0.0904
NP_441725.1_5 Reverse -343 -353 -0.609952 0.265
NP_439966.1_7 Forward -260 -250 18.4657 0.00473
NP_439966.1_7 Reverse -247 -257 15.8108 0.0124
NP_439966.1_7 Forward -169 -159 9.71433 0.104
NP_439966.1_7 Forward -42 -32 4.50281 0.269
NP_439966.1_9 Reverse -38 -47 7.66954 0.253
NP_439966.1_9 Forward -185 -176 3.7363 0.253
NP_439966.1_9 Forward -260 -251 0.983037 0.253
NP_440736.1_3 Forward -113 -94 -1.47551 0.286
NP_442941.1_3 Forward -257 -247 19.9412 0.00262
NP_442941.1_3 Reverse -250 -260 11.4848 0.0116
NP_440289.1_2 Forward -261 -248 11.819 0.0171
NP_440289.1_2 Reverse -246 -259 6.60746 0.0591
NP_440289.1_2 Forward -319 -306 -4.01229 0.276
NP_440260.1_8 Reverse -22 -40 -6.76569 0.295
NP_441514.1_4 Forward -157 -138 12.3088 0.292
NP_441678.1_4 Forward -383 -364 12.7825 0.217
NP_442281.1_1 Forward -263 -249 12.0937 0.0409
NP_442281.1_1 Reverse -244 -258 8.84875 0.075
NP_442281.1_1 Forward -45 -31 6.48882 0.124
NP_440177.1_1 Forward -385 -367 2.77242 0.295
NP_442256.1_2 Reverse -38 -56 -8.92897 0.241
NP_440437.1_1 Reverse -243 -262 5.60432 0.0862
NP_441556.1_10 Forward -45 -31 11.7792 0.214
NP_441556.1_10 Reverse -308 -322 9.6378 0.294
NP_440498.1_1 Reverse -170 -188 4.24738 0.13
NP_442982.1_5 Reverse -169 -188 -3.54046 0.299
NP_440375.1_8 Forward -211 -192 -0.4922 0.266
NP_440375.1_8 Forward -257 -238 -1.7705 0.293
NP_440375.1_8 Reverse -32 -51 -1.7705 0.293
NP_441644.1_6 Forward -258 -248 17.3841 0.00127
NP_441644.1_6 Reverse -249 -259 10.1076 0.0628
NP_441644.1_6 Forward -40 -30 10.0093 0.0649
NP_441644.1_6 Reverse -203 -213 4.7978 0.224
NP_441644.1_6 Forward -212 -202 3.61784 0.272
NP_443049.1_6 Reverse -157 -167 11.2506 0.269
NP_442215.1_2 Forward -260 -244 12.4482 0.0306
NP_442215.1_2 Forward -42 -26 -3.77637 0.222
NP_442029.1_6 Reverse -153 -172 4.42435 0.268
NP_442029.1_6 Reverse -26 -45 4.32602 0.271
NP_442247.1_8 Forward -51 -37 11.701 0.247
NP_440253.1_2 Reverse -249 -267 5.62401 0.0906
NP_440253.1_2 Forward -258 -240 -0.0791831 0.201
NP_440929.1_8 Forward -258 -249 19.2726 0.000701
NP_440929.1_8 Reverse -249 -258 19.2726 0.000701
NP_440929.1_8 Forward -167 -158 4.81794 0.176
NP_442933.1_10 Forward -258 -249 17.601 0.00325
NP_442933.1_10 Reverse -249 -258 17.601 0.00325
NP_442933.1_10 Reverse -31 -40 4.52295 0.24
NP_441751.2_8 Forward -257 -243 6.3911 0.0354
NP_441751.2_8 Forward -83 -69 -2.75368 0.133
NP_442554.1_8 Forward -257 -247 15.9097 0.00747
NP_442554.1_8 Reverse -250 -260 13.8447 0.0145
NP_442554.1_8 Reverse -204 -214 5.87989 0.135
NP_442554.1_8 Forward -39 -29 3.91327 0.203
NP_442554.1_8 Reverse -32 -42 3.91327 0.203
NP_442554.1_8 Reverse -343 -353 2.83163 0.253
NP_441762.1_7 Reverse -248 -260 2.89058 0.0676
NP_441762.1_7 Forward -259 -247 2.30059 0.0676
NP_442142.1_4 Reverse -246 -259 16.7349 0.0264
NP_442142.1_4 Forward -261 -248 7.88518 0.127
NP_442142.1_4 Forward -43 -30 4.73861 0.212
NP_442142.1_4 Reverse -231 -244 2.18201 0.299
NP_442292.1_1 Forward -257 -248 18.486 0.00229
NP_442292.1_1 Reverse -250 -259 9.63616 0.0183
NP_442476.1_6 Reverse -250 -264 0.294584 0.267
NP_443009.1_5 Reverse -248 -259 18.3477 0.00265
NP_443009.1_5 Reverse -30 -41 9.98959 0.0841
NP_441715.1_4 Reverse -250 -260 16.303 0.0117
NP_441715.1_4 Forward -257 -247 14.828 0.0268
NP_441715.1_4 Reverse -180 -190 4.50326 0.27
NP_440357.1_3 Forward -330 -311 4.12936 0.242
NP_440357.1_3 Reverse -38 -57 3.44104 0.242
NP_440015.1_9 Forward -40 -22 1.10079 0.242
NP_441448.1_2 Forward -172 -153 8.16011 0.134
NP_440183.1_9 Reverse -33 -52 -13.7669 0.26
NP_441198.1_8 Reverse -29 -39 10.6345 0.254
NP_440379.1_8 Forward -199 -180 12.0942 0.249
NP_441468.1_1 Forward -257 -250 15.8704 0.0124
NP_441468.1_1 Reverse -250 -257 15.8704 0.0124
NP_441468.1_1 Forward -187 -180 7.41394 0.121
NP_441468.1_1 Reverse -32 -39 4.07068 0.263
NP_441020.2_6 Reverse -247 -264 13.9035 0.0641
NP_441020.2_6 Forward -260 -243 7.90532 0.215
NP_441673.1_1 Forward -258 -249 20.8459 0.000698
NP_441673.1_1 Reverse -249 -258 20.8459 0.000698
NP_441673.1_1 Reverse -31 -40 1.37636 0.114
NP_441673.1_1 Forward -40 -31 1.1797 0.163
NP_441673.1_1 Forward -316 -307 -7.76842 0.168
NP_441673.1_1 Reverse -307 -316 -8.06341 0.254
NP_442253.1_5 Forward -43 -26 0.333834 0.203
NP_441826.1_2 Reverse -243 -257 14.0609 0.0213
NP_441826.1_2 Forward -46 -32 1.96621 0.137
NP_441826.1_2 Forward -264 -250 0.294584 0.19
NP_441330.1_1 Forward -45 -26 -6.39206 0.156
NP_442868.1_6 Reverse -247 -257 9.91146 0.038
NP_442868.1_6 Forward -260 -250 0.963343 0.205
NP_442719.1_2 Reverse -106 -124 -3.61981 0.2
NP_441612.1_2 Forward -258 -248 8.54929 0.21
NP_442361.1_3 Reverse -243 -256 9.85238 0.272
NP_442808.1_1 Forward -259 -249 18.4657 0.00201
NP_442808.1_1 Reverse -248 -258 8.63269 0.0481
NP_442808.1_1 Forward -41 -31 6.56775 0.107
NP_442808.1_1 Forward -34 -24 2.83119 0.254
NP_440145.1_3 Reverse -83 -102 -5.60541 0.273
NP_442542.1_2 Forward -260 -247 11.4257 0.114
NP_442050.1_1 Forward -323 -304 8.35759 0.251
NP_442050.1_1 Forward -329 -310 7.07928 0.277
NP_442050.1_5 Reverse -247 -257 16.4991 0.00812
NP_442050.1_5 Forward -169 -159 10.796 0.129
NP_442050.1_5 Forward -260 -250 9.12434 0.193
NP_440342.1_1 Forward -238 -219 10.6192 0.284
NP_440601.1_1 Reverse -148 -167 19.6656 0.155
NP_440346.1_6 Forward -161 -151 15.6049 0.203
NP_441114.1_3 Forward -38 -29 17.1093 0.113
NP_440558.1_2 Forward -43 -24 -0.000545616 0.197
NP_440558.1_2 Reverse -240 -259 -0.787193 0.204
NP_440558.1_2 Reverse -298 -317 -2.85214 0.231
NP_440558.1_2 Reverse -170 -189 -5.11376 0.253
NP_441518.1_3 Reverse -239 -258 -14.0619 0.267
NP_441878.1_6 Reverse -30 -40 12.0747 0.013
NP_441878.1_6 Forward -259 -249 10.4031 0.0176
NP_441878.1_6 Reverse -248 -258 10.4031 0.0176
NP_441878.1_6 Reverse -306 -316 9.02648 0.0269
NP_441878.1_6 Forward -41 -31 1.16001 0.11
NP_441878.1_6 Forward -352 -342 0.766681 0.134
NP_441878.1_6 Forward -317 -307 -6.90313 0.198
NP_441036.1_8 Forward -259 -249 17.7779 0.000554
NP_441036.1_8 Reverse -39 -49 11.6814 0.111
NP_441036.1_8 Reverse -248 -258 8.33817 0.174
NP_442650.1_2 Reverse -158 -172 10.4227 0.13
NP_442650.1_2 Reverse -237 -251 6.58777 0.13
NP_441557.1_5 Forward -258 -249 19.9609 0.000699
NP_441557.1_5 Reverse -249 -258 19.9609 0.000699
NP_441557.1_5 Reverse -31 -40 0.491382 0.144
NP_441557.1_5 Forward -40 -31 0.29472 0.174
NP_441557.1_8 Forward -308 -298 13.0576 0.225
NP_441557.1_8 Reverse -180 -190 11.8776 0.236
NP_441557.1_9 Reverse -74 -88 18.4858 0.264
NP_441445.1_1 Reverse -240 -259 14.7491 0.05
NP_441445.1_1 Forward -267 -248 4.916 0.183
NP_441445.1_1 Forward -58 -39 3.24438 0.218
NP_441445.1_1 Forward -182 -163 0.982764 0.264
NP_442066.2_4 Reverse -31 -50 1.57275 0.151
NP_442795.1_3 Forward -356 -337 4.81767 0.257
NP_441308.1_8 Forward -260 -250 10.1081 0.22
NP_440101.1_3 Reverse -26 -45 5.01433 0.205
NP_441458.1_10 Forward -267 -248 5.211 0.222
NP_442830.1_5 Forward -41 -27 4.42388 0.239
NP_442183.1_1 Reverse -249 -263 19.9608 0.0053
NP_442347.1_2 Forward -166 -157 13.5694 0.056
NP_442347.1_2 Forward -257 -248 12.4878 0.056
NP_442347.1_2 Reverse -250 -259 11.1111 0.056
NP_442645.1_2 Reverse -241 -260 -4.13045 0.054
NP_441037.1_4 Forward -260 -250 7.02532 0.237
NP_441037.1_4 Reverse -29 -39 6.44058 0.263
NP_441633.1_3 Forward -86 -73 3.16588 0.0738
NP_441633.1_3 Reverse -247 -260 1.29759 0.109
NP_441633.1_3 Forward -260 -247 -3.81562 0.177
NP_441633.1_3 Forward -42 -29 -3.81562 0.177
NP_441633.1_5 Reverse -236 -255 18.681 0.099
NP_440136.1_2 Forward -257 -250 15.9687 0.0123
NP_440136.1_2 Reverse -250 -257 15.9687 0.0123
NP_440136.1_2 Reverse -159 -166 3.97235 0.288
NP_442590.1_9 Reverse -298 -317 3.24438 0.296
NP_442590.1_10 Reverse -18 -37 5.89931 0.257
NP_442998.1_10 Forward -256 -249 15.5754 0.0102
NP_442998.1_10 Reverse -251 -258 15.5754 0.0102
NP_442998.1_10 Forward -165 -158 5.74231 0.255
NP_440299.1_1 Forward -262 -249 10.9334 0.0529
NP_440299.1_1 Reverse -245 -258 10.3434 0.0573
NP_441799.1_1 Reverse -245 -259 13.8636 0.0293
NP_441799.1_1 Forward -262 -248 8.75042 0.106
NP_441799.1_1 Reverse -27 -41 7.3738 0.144
NP_441007.1_10 Reverse -70 -83 1.9859 0.202
NP_441007.1_10 Reverse -244 -257 0.805932 0.216
NP_442201.1_10 Forward -269 -250 -14.8485 0.291
NP_441449.1_8 Forward -365 -346 15.9216 0.21
NP_440256.1_1 Reverse -246 -265 20.7473 0.00409
NP_440256.1_1 Forward -261 -242 -2.45882 0.118
NP_441559.1_8 Forward -44 -30 5.1128 0.1
NP_441559.1_8 Forward -45 -31 -6.49025 0.279
NP_440915.1_6 Reverse -245 -259 1.76955 0.131
NP_440915.1_6 Reverse -310 -324 -2.16369 0.26
NP_440915.1_6 Reverse -199 -213 -2.36035 0.268
NP_441179.1_9 Reverse -232 -242 8.92768 0.284
NP_442866.1_1 Reverse -207 -226 -9.63698 0.296
NP_441464.1_2 Reverse -227 -237 17.5813 0.221
NP_441464.1_8 Forward -40 -26 5.89945 0.248
NP_440695.1_5 Forward -258 -239 0.196116 0.284
NP_442993.1_1 Reverse -249 -265 -7.80794 0.146
NP_442386.1_9 Forward -259 -250 15.7322 0.0144
NP_442386.1_9 Reverse -248 -257 13.8639 0.0289
NP_442386.1_9 Forward -168 -159 5.9975 0.23
NP_442386.1_9 Reverse -101 -110 5.50585 0.25
NP_442386.1_9 Forward -41 -32 4.7192 0.289
NP_442386.1_9 Reverse -242 -251 4.62087 0.294
NP_441340.1_5 Forward -257 -250 15.6737 0.0124
NP_441340.1_5 Reverse -250 -257 15.6737 0.0124
NP_441340.1_5 Forward -39 -32 3.97235 0.274
NP_442327.1_3 Reverse -123 -142 14.2756 0.165
NP_442791.1_5 Reverse -23 -42 0.294447 0.21
NP_440168.1_9 Reverse -29 -48 -0.983855 0.273
NP_440161.1_3 Reverse -247 -266 14.6508 0.118
NP_442714.1_7 Reverse -165 -184 -2.16383 0.294
NP_440586.1_8 Forward -257 -250 13.2151 0.026
NP_440586.1_8 Reverse -250 -257 13.2151 0.026
NP_440586.1_8 Forward -350 -343 9.08521 0.178
NP_442251.1_6 Forward -257 -250 15.2804 0.0124
NP_442251.1_6 Reverse -250 -257 15.2804 0.0124
NP_440192.1_4 Forward -185 -166 11.435 0.212
NP_440684.1_9 Forward -264 -250 8.75105 0.225
NP_441262.1_3 Reverse -249 -256 14.7888 0.0223
NP_441262.1_3 Forward -258 -251 14.7888 0.0223
NP_440027.1_3 Reverse -31 -49 1.98502 0.295
NP_443051.1_1 Reverse -248 -257 10.4228 0.00754
NP_443051.1_1 Forward -259 -250 10.4228 0.00754
NP_443051.1_5 Forward -133 -114 3.44104 0.298
NP_439937.1_8 Forward -330 -311 -3.14714 0.265
NP_439937.1_9 Reverse -100 -117 -10.1882 0.224
NP_439937.1_9 Forward -259 -242 -16.4814 0.287
NP_440408.1_7 Forward -264 -245 7.86593 0.284
NP_440439.1_1 Forward -261 -248 1.10092 0.162
NP_440439.1_1 Reverse -246 -259 0.117615 0.202
NP_440439.1_1 Reverse -37 -50 0.117615 0.202
NP_440439.1_1 Forward -43 -30 -0.275709 0.211
NP_440372.1_2 Forward -257 -250 16.3621 0.0124
NP_440372.1_2 Reverse -250 -257 16.3621 0.0124
NP_440372.1_2 Reverse -159 -166 4.07068 0.262
NP_441789.1_7 Forward -48 -29 -5.1145 0.293
NP_440819.1_5 Reverse -383 -391 7.8859 0.266
NP_440316.1_10 Reverse -30 -40 6.8632 0.251
NP_440139.1_1 Forward -264 -245 10.3234 0.0921
NP_440139.1_1 Reverse -243 -262 4.12856 0.19
NP_440139.1_1 Reverse -301 -320 2.26028 0.235
NP_441572.1_7 Forward -46 -27 -2.75381 0.2
NP_440267.1_2 Reverse -244 -258 7.47213 0.196
NP_442384.1_10 Forward -258 -245 9.06573 0.0574
NP_442384.1_10 Reverse -249 -262 7.09911 0.0875
NP_442384.1_10 Reverse -31 -44 6.80412 0.0939
NP_442384.1_10 Forward -167 -154 1.78924 0.247
NP_442384.1_10 Forward -198 -185 1.49425 0.257
NP_440693.1_8 Forward -223 -204 13.4708 0.251
NP_441018.1_7 Reverse -154 -173 16.8141 0.077
NP_442790.1_4 Forward -267 -248 -6.58872 0.144
NP_442262.1_10 Forward -257 -250 14.1988 0.0123
NP_442262.1_10 Reverse -250 -257 14.1988 0.0123
NP_442262.1_10 Forward -39 -32 9.87221 0.164
NP_442262.1_10 Forward -350 -343 9.18389 0.211
NP_442262.1_10 Forward -220 -213 7.21728 0.281
NP_441689.1_5 Reverse -247 -257 15.3192 0.0403
NP_441689.1_5 Forward -260 -250 8.53436 0.132
NP_440163.1_2 Reverse -189 -208 17.5015 0.298
NP_440163.1_10 Forward -261 -251 14.238 0.102
NP_440163.1_10 Reverse -246 -256 11.3864 0.169
NP_440163.1_10 Forward -319 -309 8.33817 0.278
NP_440344.1_10 Forward -265 -248 1.8088 0.0294
NP_440344.1_10 Reverse -242 -259 0.137172 0.0369
NP_440531.1_6 Forward -48 -29 17.8957 0.0353
NP_440189.1_10 Reverse -296 -315 5.01433 0.279
NP_441965.1_10 Forward -261 -245 2.32015 0.288
NP_440297.1_9 Forward -257 -247 9.32148 0.0917
NP_440297.1_9 Reverse -250 -260 9.32148 0.0917
NP_440297.1_9 Reverse -343 -353 9.22315 0.0917
NP_440297.1_9 Forward -39 -29 7.35486 0.126
NP_440297.1_9 Forward -315 -305 -0.0199663 0.282
NP_440297.1_9 Forward -128 -118 -0.0199663 0.282
NP_440297.1_9 Forward -350 -340 -0.118297 0.282
NP_441592.1_4 Forward -316 -297 -0.688862 0.246
NP_440999.1_9 Forward -44 -30 2.5562 0.148
NP_440999.1_9 Forward -385 -371 1.86788 0.157
NP_440888.1_2 Forward -258 -244 19.9601 0.000906
NP_440888.1_2 Reverse -249 -263 14.9452 0.0137
NP_440888.1_2 Reverse -307 -321 5.01387 0.298
NP_440600.1_4 Forward -266 -248 -6.27403 0.285
NP_442147.1_7 Reverse -240 -259 9.43923 0.257
NP_439969.1_1 Reverse -194 -213 -6.68705 0.288
NP_441123.1_1 Forward -224 -205 22.3206 0.0577
NP_442077.1_9 Reverse -346 -365 4.916 0.103
NP_441543.1_2 Reverse -250 -259 18.486 0.00236
NP_441543.1_2 Forward -257 -248 16.9127 0.00359
NP_441543.1_2 Reverse -288 -297 8.75118 0.0968
NP_442845.1_2 Reverse -158 -172 9.43936 0.174
NP_442845.1_2 Reverse -243 -257 7.27608 0.195
NP_442845.1_2 Reverse -152 -166 5.89945 0.22
NP_442845.1_2 Forward -258 -244 5.40779 0.233
NP_442845.1_2 Forward -218 -204 3.53951 0.287
NP_441469.1_8 Forward -259 -250 16.126 0.00797
NP_441469.1_8 Reverse -30 -39 9.63616 0.227
NP_441469.1_8 Reverse -248 -257 6.48957 0.227
NP_441469.1_8 Forward -41 -32 5.50626 0.265
NP_442315.1_2 Reverse -154 -166 13.5103 0.291
NP_442315.1_2 Reverse -153 -165 12.232 0.291
NP_443064.1_6 Forward -258 -248 12.5669 0.0796
NP_442578.1_7 Forward -257 -250 14.5921 0.026
NP_442578.1_7 Reverse -250 -257 14.5921 0.026
NP_440710.1_1 Forward -48 -30 -7.06068 0.232
NP_440710.1_1 Reverse -299 -317 -9.0273 0.292
NP_440071.1_1 Reverse -370 -387 11.5428 0.241
NP_441462.1_2 Forward -258 -248 11.5831 0.00406
NP_441462.1_2 Reverse -249 -259 11.5831 0.00406
NP_441462.1_2 Forward -40 -30 0.471689 0.148
NP_443062.1_1 Forward -258 -240 15.9565 0.0336
NP_443062.1_1 Reverse -249 -267 13.4213 0.0627
NP_443062.1_1 Reverse -203 -221 4.35311 0.264
NP_443062.1_6 Reverse -241 -260 4.22769 0.221
NP_443062.1_6 Forward -324 -305 2.3594 0.256
NP_441601.1_2 Forward -55 -36 2.55606 0.219
NP_441601.1_4 Reverse -230 -249 -3.44213 0.293
NP_440516.1_6 Reverse -342 -356 12.192 0.196
NP_440516.1_8 Forward -258 -249 16.9127 0.00442
NP_440516.1_8 Reverse -249 -258 16.9127 0.00442
NP_440516.1_8 Forward -212 -203 7.07956 0.0867
NP_440516.1_8 Reverse -158 -167 -0.196935 0.185
NP_441033.1_2 Forward -268 -249 -6.88371 0.293
NP_442428.1_4 Forward -259 -240 3.24438 0.244
NP_442428.1_5 Forward -257 -250 15.8704 0.0124
NP_442428.1_5 Reverse -250 -257 15.8704 0.0124
NP_442428.1_5 Reverse -32 -39 4.46401 0.267
NP_442428.1_8 Reverse -309 -328 -0.787193 0.274
NP_440673.1_2 Forward -306 -287 8.63366 0.264
NP_440673.1_3 Forward -256 -249 12.4288 0.0426
NP_440673.1_3 Reverse -251 -258 12.4288 0.0426
NP_440673.1_3 Forward -38 -31 8.98723 0.203
NP_441052.1_2 Forward -258 -248 19.9412 0.00106
NP_441052.1_2 Reverse -249 -259 10.5014 0.0285
NP_441052.1_2 Forward -351 -341 0.668351 0.256
NP_441052.1_2 Forward -167 -157 -0.314959 0.273
NP_442219.1_8 Reverse -239 -258 8.94017 0.238
NP_442219.1_8 Reverse -20 -39 7.00751 0.28
NP_442219.1_9 Forward -257 -248 17.7976 0.00718
NP_442219.1_9 Reverse -250 -259 8.35786 0.0681
NP_442219.1_9 Forward -166 -157 5.01461 0.193
NP_440436.1_4 Reverse -250 -259 18.1905 0.00233
NP_440436.1_4 Forward -257 -248 17.2072 0.00233
NP_440436.1_4 Forward -39 -30 9.73406 0.0871
NP_440436.1_4 Forward -166 -157 4.62087 0.248
NP_441884.1_9 Forward -261 -242 -22.715 0.284
NP_442864.1_2 Forward -380 -361 12.4875 0.246
NP_442864.1_7 Reverse -40 -58 5.82068 0.274
NP_441719.1_4 Forward -257 -250 16.3621 0.0124
NP_441719.1_4 Reverse -250 -257 16.3621 0.0124
NP_441733.1_10 Reverse -246 -259 9.95071 0.106
NP_441004.1_1 Reverse -25 -44 9.3409 0.0592
NP_441004.1_1 Reverse -69 -88 -10.7186 0.225
NP_441004.1_4 Reverse -28 -38 15.8113 0.154
NP_441004.1_5 Reverse -27 -41 16.6175 0.2
NP_442366.1_3 Forward -259 -241 3.85406 0.104
NP_442366.1_3 Reverse -248 -266 -1.75081 0.217
NP_442366.1_5 Reverse -155 -165 12.7626 0.108
NP_441034.1_3 Forward -299 -280 17.404 0.295
NP_441115.1_4 Forward -259 -241 7.88485 0.269
NP_443054.1_2 Forward -260 -246 3.34284 0.24
NP_443054.1_2 Reverse -247 -261 3.04785 0.24
NP_442430.1_2 Reverse -277 -296 2.0644 0.268
NP_442308.1_3 Reverse -22 -41 10.5209 0.293
NP_441851.1_10 Forward -259 -249 16.008 0.00552
NP_441851.1_10 Reverse -248 -258 15.8113 0.00552
NP_441851.1_10 Reverse -30 -40 6.27322 0.178
NP_441851.1_10 Reverse -157 -167 4.69992 0.254
NP_441851.1_10 Forward -41 -31 4.50326 0.266
NP_442011.1_1 Reverse -30 -49 -0.787193 0.268
NP_442856.1_7 Forward -176 -157 -1.47551 0.226
NP_442856.1_7 Forward -49 -30 -5.01543 0.27
NP_441668.1_4 Forward -268 -249 5.11266 0.173
NP_442515.1_1 Reverse -248 -262 12.0943 0.0355
NP_440593.1_3 Forward -391 -372 -4.03212 0.244
NP_441982.1_6 Forward -162 -153 11.1485 0.288
NP_441982.1_10 Forward -32 -13 6.29183 0.264
NP_440463.1_8 Reverse -312 -331 9.33934 0.247
NP_440165.1_5 Forward -259 -240 -1.08219 0.185
NP_441349.1_10 Reverse -239 -258 2.26107 0.0753
NP_441349.1_10 Forward -268 -249 -0.590531 0.0947
NP_440432.1_9 Reverse -250 -265 -1.79006 0.167
NP_442843.1_1 Reverse -32 -51 -3.83545 0.23
NP_439960.1_4 Reverse -248 -267 12.4867 0.28
NP_439960.1_6 Forward -381 -362 12.0942 0.186
NP_440474.1_8 Reverse -250 -264 6.68548 0.22
NP_440474.1_8 Forward -257 -243 6.29216 0.228
NP_440431.1_3 Forward -358 -339 -7.57203 0.208
NP_442450.1_5 Reverse -247 -257 9.32148 0.115
NP_442450.1_5 Forward -260 -250 9.32148 0.115
NP_440588.1_2 Reverse -298 -317 -2.95047 0.174
NP_440588.1_2 Reverse -155 -174 -3.44213 0.186
NP_440588.1_2 Forward -207 -188 -6.98204 0.297
NP_442006.1_2 Reverse -93 -110 -17.6607 0.279
NP_441570.1_1 Forward -258 -240 7.4923 0.0166
NP_441570.1_1 Reverse -249 -267 -7.65067 0.0925
NP_440078.1_10 Reverse -158 -177 5.30933 0.226
NP_440078.1_10 Reverse -31 -50 3.53937 0.262
NP_441078.1_4 Forward -258 -249 19.6659 0.0007
NP_441078.1_4 Reverse -249 -258 19.6659 0.0007
NP_441078.1_4 Reverse -31 -40 8.1612 0.039
NP_441078.1_4 Forward -40 -31 0.983037 0.151
NP_441078.1_4 Forward -316 -307 -1.47524 0.266
NP_442729.1_5 Forward -244 -234 8.53483 0.248
NP_442729.1_8 Forward -262 -249 9.85238 0.125
NP_441528.1_2 Forward -396 -377 9.7334 0.255
NP_442348.1_2 Forward -124 -115 7.47288 0.28
NP_440707.1_6 Forward -48 -29 11.11 0.274
NP_442443.1_1 Forward -236 -217 8.65258 0.119
NP_442443.1_1 Forward -48 -29 -3.24547 0.265
NP_441094.1_6 Forward -323 -306 7.41293 0.278
NP_440526.1_3 Forward -257 -246 10.1862 0.0646
NP_440526.1_3 Forward -83 -72 2.12315 0.267
NP_441432.1_8 Reverse -248 -257 16.8143 0.00595
NP_441432.1_8 Forward -259 -250 8.25953 0.0755
NP_441432.1_8 Reverse -30 -39 6.5879 0.112
NP_441432.1_8 Reverse -157 -166 4.32629 0.223
NP_441432.1_8 Forward -297 -288 2.94966 0.28
NP_442320.1_8 Forward -264 -250 12.9793 0.0155
NP_442320.1_8 Reverse -243 -257 3.44117 0.0617
NP_442344.1_7 Reverse -250 -269 -5.9004 0.168
NP_442344.1_7 Forward -257 -238 -7.17871 0.18
NP_441732.1_2 Forward -262 -246 -16.7561 0.195
NP_440760.1_1 Forward -40 -21 -20.65 0.224
NP_440760.1_1 Reverse -249 -268 -20.945 0.226
NP_442797.1_6 Forward -391 -372 8.90373 0.254
NP_442797.1_7 Forward -41 -23 1.10079 0.265
NP_442797.1_7 Forward -323 -305 -1.16082 0.293
NP_440199.1_10 Reverse -246 -256 16.7946 0.0381
NP_440913.1_1 Forward -214 -196 7.78729 0.196
NP_442751.1_2 Forward -259 -240 8.65176 0.206
NP_442489.1_7 Forward -258 -249 20.1576 0.000695
NP_442489.1_7 Reverse -249 -258 20.1576 0.000695
NP_442489.1_7 Reverse -31 -40 8.1612 0.0294
NP_442489.1_7 Forward -40 -31 7.76787 0.0518
NP_442489.1_7 Forward -316 -307 -0.983583 0.178
NP_440565.1_3 Forward -389 -370 15.7735 0.218
NP_442079.1_7 Reverse -250 -269 7.57094 0.135
NP_440559.1_1 Forward -257 -248 17.4043 0.00658
NP_440559.1_1 Reverse -250 -259 8.75118 0.0586
NP_441659.2_8 Forward -258 -248 18.1713 0.00133
NP_441659.2_8 Reverse -249 -259 11.9764 0.0147
NP_441659.2_8 Forward -40 -30 7.45319 0.0601
NP_442913.1_10 Reverse -240 -259 6.39097 0.0612
NP_441040.1_2 Reverse -292 -311 -15.5368 0.286
NP_442008.1_2 Forward -326 -307 5.60432 0.226
NP_440779.1_5 Forward -129 -112 -6.451 0.185
NP_442346.1_5 Reverse -248 -258 16.6963 0.00248
NP_442346.1_5 Reverse -30 -40 14.4347 0.0134
NP_442346.1_5 Forward -259 -249 9.02648 0.118
NP_442346.1_5 Forward -352 -342 5.5849 0.238
NP_440545.1_3 Reverse -27 -44 0.727158 0.133
NP_440831.1_3 Reverse -240 -259 5.31929 0.283
NP_441786.1_10 Reverse -22 -41 7.17762 0.268
NP_441923.1_6 Forward -242 -228 14.6509 0.175
NP_440486.1_6 Reverse -24 -43 14.9458 0.207
NP_441126.1_5 Forward -237 -218 3.53937 0.269
NP_440250.1_4 Reverse -124 -143 4.71854 0.253
NP_440459.1_2 Forward -325 -308 12.4285 0.149
NP_440459.1_2 Reverse -22 -39 9.08529 0.239
NP_440459.1_2 Reverse -156 -173 7.80699 0.278
NP_440010.1_10 Reverse -295 -314 7.27595 0.226
NP_440847.1_3 Forward -250 -236 13.6669 0.209
NP_441585.1_6 Forward -48 -29 14.9449 0.232
NP_441888.1_7 Forward -263 -249 2.94952 0.225
NP_441888.1_7 Forward -45 -31 2.2612 0.225
NP_441948.1_4 Reverse -242 -260 6.31233 0.0646
NP_441948.1_4 Reverse -297 -315 2.67408 0.121
NP_441948.1_4 Forward -56 -38 -0.865831 0.139
NP_441948.1_4 Forward -265 -247 -4.50408 0.231
NP_441833.1_4 Forward -257 -250 15.9687 0.0124
NP_441833.1_4 Reverse -250 -257 15.9687 0.0124
NP_442162.1_9 Forward -257 -250 16.2637 0.0124
NP_442162.1_9 Reverse -250 -257 16.2637 0.0124
NP_440671.1_4 Forward -264 -250 8.55439 0.195
NP_440671.1_4 Reverse -243 -257 6.78443 0.235
NP_440671.1_4 Forward -227 -213 5.70279 0.275
NP_442140.1_3 Reverse -250 -260 8.33817 0.119
NP_442140.1_3 Forward -257 -247 4.40493 0.243
NP_442140.1_3 Reverse -32 -42 3.61828 0.288
NP_440875.1_9 Reverse -33 -43 13.1415 0.0803
NP_440875.1_9 Reverse -176 -186 8.08002 0.243
NP_441813.1_5 Forward -260 -250 17.188 0.00979
NP_441813.1_5 Reverse -247 -257 15.9097 0.01
NP_441813.1_5 Forward -169 -159 2.14332 0.199
NP_441813.1_5 Forward -42 -32 -0.216628 0.237
NP_440590.1_4 Forward -257 -244 2.57589 0.0845
NP_440590.1_4 Reverse -159 -172 1.29759 0.127
NP_440590.1_4 Reverse -41 -54 0.510939 0.153
NP_440590.1_4 Reverse -25 -38 -1.75067 0.228
NP_440590.1_4 Reverse -250 -263 -5.38892 0.277
NP_440590.1_4 Reverse -187 -200 -5.97891 0.296
NP_440590.1_7 Reverse -149 -163 14.9459 0.256
NP_440567.1_1 Forward -257 -243 15.8309 0.0166
NP_442497.1_10 Forward -257 -248 10.4228 0.0087
NP_442497.1_10 Reverse -250 -259 10.4228 0.0087
NP_442497.1_10 Forward -39 -30 0.196389 0.208
NP_440821.1_4 Forward -260 -250 19.0562 0.00399
NP_440821.1_4 Reverse -247 -257 18.2696 0.00448
NP_441239.1_9 Forward -260 -248 13.3137 0.037
NP_441239.1_9 Reverse -29 -41 10.9537 0.0695
NP_441239.1_9 Forward -42 -30 9.28209 0.11
NP_441239.1_9 Reverse -247 -259 6.92215 0.173
NP_441239.1_9 Reverse -118 -130 5.93884 0.202
NP_441239.1_9 Forward -190 -178 4.46387 0.253
NP_441239.1_9 Reverse -305 -317 4.36554 0.253
NP_441951.1_4 Forward -384 -365 5.60432 0.273
NP_441892.1_1 Reverse -66 -83 -3.10775 0.233
NP_441017.1_6 Forward -262 -248 11.5037 0.262
NP_440354.1_7 Reverse -243 -261 8.67227 0.232
NP_441617.1_6 Reverse -137 -156 -7.27704 0.292
NP_442138.1_10 Reverse -249 -268 -6.49039 0.285
NP_442052.1_8 Reverse -29 -39 15.3197 0.253
NP_440546.1_4 Reverse -249 -259 11.8882 0.0679
NP_440546.1_4 Forward -212 -202 11.4034 0.0841
NP_440546.1_4 Forward -258 -248 10.046 0.109
NP_440546.1_4 Reverse -203 -213 8.59164 0.181
NP_440546.1_6 Reverse -40 -59 10.2259 0.247
NP_440462.1_6 Forward -260 -250 15.418 0.0142
NP_440462.1_6 Reverse -247 -257 7.74818 0.0699
NP_442611.1_1 Forward -188 -169 3.73603 0.206
NP_442611.1_1 Forward -258 -239 -2.95047 0.295
NP_440868.1_4 Forward -262 -250 8.39711 0.0602
NP_440868.1_4 Reverse -245 -257 6.23383 0.0878
NP_440868.1_4 Reverse -36 -48 1.12062 0.192
NP_440868.1_4 Forward -44 -32 -0.0593532 0.242
NP_442479.1_8 Reverse -369 -388 3.6377 0.259
NP_442923.1_4 Reverse -25 -44 -6.09707 0.295
NP_442039.1_4 Forward -257 -250 15.1821 0.0124
NP_442039.1_4 Reverse -250 -257 15.1821 0.0124
NP_441811.1_4 Forward -42 -23 5.99764 0.196
NP_441811.1_8 Forward -179 -165 6.88276 0.259
NP_442837.1_3 Forward -257 -250 15.7721 0.0124
NP_442837.1_3 Reverse -250 -257 15.7721 0.0124
NP_442053.1_1 Forward -258 -249 18.3876 0.0007
NP_442053.1_1 Reverse -249 -258 18.3876 0.0007
NP_440505.1_3 Reverse -247 -257 16.303 0.00696
NP_440505.1_3 Forward -260 -250 13.8447 0.0247
NP_440505.1_3 Reverse -156 -166 6.8632 0.169
NP_442659.1_3 Forward -250 -231 22.8122 0.0334
NP_441252.1_6 Reverse -28 -35 14.3954 0.168
NP_442532.1_7 Reverse -249 -263 3.53951 0.195
NP_442532.1_7 Reverse -75 -89 2.65453 0.231
NP_440914.1_1 Forward -258 -248 17.5935 0.000537
NP_440914.1_1 Reverse -249 -259 8.6151 0.186
NP_440914.1_1 Reverse -158 -168 6.95605 0.257
NP_440914.1_1 Reverse -203 -213 6.46809 0.279
NP_441011.1_8 Reverse -250 -259 16.9127 0.00602
NP_441011.1_8 Forward -257 -248 8.25953 0.144
NP_442533.1_6 Forward -258 -249 17.2076 0.00137
NP_442533.1_6 Reverse -249 -258 17.2076 0.00137
NP_442533.1_6 Forward -316 -307 10.9145 0.0503
NP_442533.1_6 Forward -40 -31 8.25953 0.0776
NP_442533.1_6 Reverse -31 -40 7.66954 0.0897
NP_442533.1_6 Forward -33 -24 4.62128 0.179
NP_442533.1_6 Forward -167 -158 3.7363 0.204
NP_442541.1_10 Reverse -318 -332 3.14559 0.254
NP_442541.1_10 Forward -40 -26 2.26061 0.263
NP_442541.1_10 Reverse -173 -187 2.06395 0.269
NP_442232.1_3 Reverse -23 -42 -4.91709 0.165
NP_441482.1_7 Forward -264 -250 6.09611 0.0343
NP_439944.1_9 Forward -257 -247 19.0562 0.00329
NP_439944.1_9 Reverse -250 -260 10.3048 0.0887
NP_442202.1_10 Reverse -30 -44 5.01447 0.255
NP_440116.1_8 Forward -257 -238 7.66927 0.0428
NP_441527.1_4 Forward -157 -138 -4.34531 0.184
NP_440007.1_9 Reverse -310 -324 4.12949 0.267
NP_439965.1_1 Reverse -240 -259 2.75272 0.111
NP_439965.1_1 Forward -267 -248 -6.98204 0.218
NP_439965.1_7 Reverse -145 -164 18.8853 0.11
NP_441680.1_4 Reverse -370 -389 13.7658 0.149
NP_441106.1_1 Forward -259 -250 18.191 0.0028
NP_441106.1_1 Reverse -248 -257 9.63616 0.0311
NP_441106.1_1 Forward -317 -308 2.85133 0.255
NP_439903.1_6 Forward -43 -24 1.27698 0.249
NP_442306.1_10 Reverse -244 -263 -21.0434 0.242
NP_441286.1_1 Reverse -248 -260 14.4936 0.00418
NP_441286.1_1 Forward -259 -247 11.8387 0.0114
NP_441286.1_1 Reverse -341 -353 -6.74586 0.278
NP_441286.1_1 Reverse -157 -169 -6.94252 0.288
NP_442674.1_3 Reverse -67 -86 11.8967 0.174
NP_440670.1_8 Forward -258 -249 18.3876 0.000699
NP_440670.1_8 Reverse -249 -258 18.3876 0.000699
NP_440670.1_8 Reverse -158 -167 6.29291 0.124
NP_440670.1_8 Forward -40 -31 5.3096 0.167
NP_442908.1_1 Reverse -343 -362 1.37609 0.277
NP_441705.1_3 Forward -129 -110 -6.1954 0.291
NP_441930.1_1 Reverse -27 -46 16.0274 0.179
NP_441930.1_2 Reverse -30 -40 15.9097 0.19
NP_440886.1_7 Forward -259 -249 17.7774 0.0011
NP_440886.1_7 Reverse -248 -258 7.94438 0.0805
NP_440886.1_7 Forward -41 -31 7.64939 0.0865
NP_442614.1_2 Forward -258 -244 13.1759 0.133
NP_442614.1_2 Reverse -158 -172 7.47274 0.273
NP_442072.1_9 Forward -259 -241 -20.6304 0.204
NP_440513.1_4 Reverse -31 -50 8.55425 0.295
NP_442963.1_3 Forward -217 -199 14.6705 0.273
NP_441808.1_8 Forward -58 -39 15.0441 0.152
NP_440907.2_8 Reverse -250 -260 7.84605 0.117
NP_440907.2_8 Forward -166 -156 4.89613 0.235
NP_442264.1_2 Forward -262 -245 5.15205 0.284
NP_441021.1_8 Reverse -244 -262 2.47742 0.246
NP_440841.1_4 Reverse -247 -266 -5.80207 0.208
NP_441463.1_3 Reverse -239 -258 6.58763 0.0604
NP_441463.1_3 Forward -268 -249 3.04771 0.107
NP_441463.1_6 Reverse -247 -261 12.0207 0.224
NP_441626.1_2 Forward -257 -250 15.7721 0.0124
NP_441626.1_2 Reverse -250 -257 15.7721 0.0124
NP_442211.1_3 Forward -386 -367 9.90358 0.257
NP_441901.1_1 Reverse -22 -41 6.09597 0.164
NP_442365.1_7 Reverse -245 -264 -4.52377 0.245
NP_442615.1_1 Reverse -240 -258 8.7706 0.0275
NP_442615.1_1 Forward -267 -249 7.19731 0.0324
NP_441962.1_4 Reverse -26 -45 -8.06369 0.195
NP_441962.1_4 Reverse -244 -263 -8.85033 0.208
NP_441962.1_4 Reverse -160 -179 -14.8485 0.294
NP_440387.1_1 Reverse -249 -265 6.35172 0.0282
NP_440387.1_1 Forward -40 -24 -2.00642 0.145
NP_440387.1_1 Forward -258 -242 -2.69473 0.148
NP_440387.1_1 Forward -316 -300 -2.79306 0.15
NP_441431.1_2 Forward -43 -29 17.7968 0.0246
NP_441431.1_3 Forward -243 -224 2.55606 0.283
NP_440634.1_1 Forward -42 -23 11.4058 0.287
NP_440467.1_6 Reverse -179 -198 16.6174 0.288
NP_440114.1_10 Reverse -249 -263 11.996 0.0955
NP_440114.1_10 Reverse -203 -217 9.83269 0.16
NP_440114.1_10 Forward -258 -244 9.14437 0.183
NP_440114.1_10 Forward -212 -198 8.25939 0.21
NP_440114.1_10 Forward -40 -26 8.06273 0.217
NP_440114.1_10 Reverse -164 -178 7.27608 0.239
NP_441817.1_10 Forward -321 -302 14.4541 0.199
NP_441552.1_3 Reverse -242 -261 20.1564 0.123
NP_441720.1_2 Reverse -245 -264 6.29183 0.217
NP_440293.1_3 Reverse -23 -42 -4.72043 0.264
NP_440766.1_4 Reverse -245 -259 8.06273 0.0871
NP_439988.1_3 Reverse -160 -174 7.86607 0.273
NP_441237.1_9 Forward -39 -29 14.0414 0.0535
NP_442930.1_1 Forward -343 -333 10.206 0.278
NP_442930.1_1 Reverse -335 -345 10.1076 0.278
NP_441133.1_1 Forward -188 -169 11.8975 0.285
NP_439910.1_2 Forward -266 -249 -13.4325 0.162
NP_442867.1_8 Reverse -181 -200 7.17762 0.244
NP_440457.1_1 Reverse -245 -257 9.57708 0.092
NP_440457.1_1 Forward -262 -250 0.0389777 0.25
NP_440142.1_7 Reverse -32 -51 6.58763 0.259
NP_441984.1_3 Forward -50 -32 8.27895 0.232
NP_441889.1_4 Reverse -240 -259 0.687771 0.296
NP_441436.1_8 Reverse -29 -48 8.55425 0.283
NP_440473.1_9 Reverse -201 -220 -9.93197 0.267
NP_442509.1_9 Reverse -249 -259 16.2041 0.00739
NP_442509.1_9 Forward -258 -248 8.14104 0.192
NP_442509.1_9 Reverse -164 -174 6.27276 0.279
NP_440554.1_4 Reverse -250 -260 14.6313 0.02
NP_440554.1_4 Forward -257 -247 7.05986 0.106
NP_440554.1_4 Reverse -121 -131 2.7333 0.254
NP_441885.1_5 Forward -258 -248 20.9245 0.000538
NP_441885.1_5 Reverse -249 -259 11.4848 0.00668
NP_441885.1_5 Reverse -158 -168 -0.216628 0.189
NP_441885.1_5 Forward -167 -157 -1.00328 0.248
NP_441885.1_5 Forward -296 -286 -1.19994 0.255
NP_442341.1_7 Reverse -248 -262 9.34103 0.0751
NP_442341.1_7 Forward -259 -245 8.35772 0.0881
NP_442341.1_7 Forward -85 -71 5.99778 0.139
NP_442341.1_7 Reverse -157 -171 2.94952 0.239
NP_442341.1_9 Forward -260 -246 14.2569 0.0695
NP_441756.1_5 Forward -43 -24 -3.83545 0.29
NP_442534.1_7 Reverse -23 -42 10.9142 0.192
NP_440409.1_2 Forward -331 -312 15.5357 0.0994
NP_440750.1_5 Forward -154 -140 5.1128 0.294
NP_443000.1_7 Reverse -247 -257 17.0896 0.00865
NP_443000.1_7 Forward -260 -250 8.73149 0.0437
NP_441842.1_10 Reverse -242 -256 15.7325 0.0381
NP_440275.1_3 Forward -260 -250 8.4365 0.0602
NP_440275.1_3 Reverse -247 -257 8.1415 0.0602
NP_440091.1_1 Reverse -245 -257 18.3285 0.0114
NP_440091.1_1 Forward -262 -250 8.9871 0.0567
NP_442275.1_1 Forward -49 -30 7.17762 0.253
NP_443010.1_10 Forward -261 -244 7.98902 0.164
NP_439962.1_6 Forward -325 -307 8.7706 0.239
NP_441105.1_3 Forward -269 -250 -6.78538 0.241
NP_440216.1_1 Forward -258 -244 9.2427 0.00589
NP_440216.1_1 Reverse -249 -263 5.30946 0.0215
NP_440216.1_1 Reverse -31 -45 -2.06536 0.0458
NP_440216.1_1 Forward -212 -198 -4.62196 0.113
NP_440216.1_9 Forward -350 -341 6.78456 0.289
NP_440216.1_9 Forward -349 -340 6.78456 0.289
NP_440172.1_1 Forward -258 -248 15.0247 0.00945
NP_440172.1_1 Reverse -249 -259 8.73149 0.0586
NP_440172.1_1 Forward -40 -30 3.61828 0.222
NP_440172.1_1 Reverse -31 -41 2.7333 0.268
NP_442015.1_10 Forward -171 -158 9.36073 0.0503
NP_442015.1_10 Forward -262 -249 0.805932 0.218
NP_442015.1_10 Reverse -245 -258 0.60927 0.221
NP_441226.1_7 Forward -257 -250 14.4934 0.0123
NP_441226.1_7 Reverse -250 -257 14.4934 0.0123
NP_441226.1_7 Forward -211 -204 9.47853 0.147
NP_441226.1_7 Forward -166 -159 8.59356 0.197
NP_441226.1_7 Forward -32 -25 5.34865 0.289
NP_441111.1_7 Forward -257 -249 18.7023 0.00294
NP_441111.1_7 Reverse -250 -258 18.7023 0.00294
NP_442379.1_10 Reverse -242 -259 6.13536 0.118
NP_441766.1_2 Forward -258 -249 17.5026 0.00297
NP_441766.1_2 Reverse -249 -258 17.5026 0.00297
NP_441766.1_2 Forward -167 -158 2.94966 0.245
NP_441766.1_9 Forward -48 -29 -1.08219 0.261
NP_442417.1_5 Reverse -249 -263 12.586 0.0953
NP_440416.1_9 Reverse -242 -261 -0.295539 0.0591
NP_443052.1_8 Reverse -239 -258 1.0811 0.0618
NP_443052.1_8 Forward -268 -249 -8.94866 0.182
NP_443052.1_9 Reverse -367 -386 6.09597 0.138
NP_443052.1_9 Forward -82 -63 5.70265 0.14
NP_443052.1_9 Forward -385 -366 -2.0655 0.233
NP_443052.1_9 Reverse -188 -207 -6.09707 0.276
NP_441430.1_6 Forward -333 -314 13.4708 0.186
NP_440261.1_5 Reverse -32 -45 4.93583 0.0478
NP_440261.1_5 Forward -257 -244 -10.6005 0.201
NP_440988.1_10 Forward -254 -240 12.3534 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGAAAGCTTGTTTTCCCGCTGGCACCGTCAGTGGTGCACCGAAAATTAGGGCCATGGAAATTATTAACGAGCTGGAACCGGAACGGCGGGGGCCCTACTCCGGAGTCTATGGCTACTATGATTTTGAAGGCCAGTTAAATACGGCGATCGCCATTCGGACCATGGTGGTGCAGGAACAGCCAGATGGAGCCCATCGGGTGTCGGTGCAGACCGGAGCTGGCATTGTGGCCGATTCCGATCCCCAAAAAGAGTATGAGGAAACTTTAAATAAAGCGAGGGGACTTTTGGAAGCCATTCGTGCCTTGTCCTAGGTTTCTTCCATCACCCCTACCTGTAAAATGGGCTCTAGTTGCCGCTCCCGGCCATTGCCCAACCCCGTTATTTAGTATCCAGTGACAGT

CDS

ATGGTTGCCCAACAAACACGAACCGACTTTGATTTAGCCCAATACTTACAAGTTAAAAAAGGTGTGGTCGAGGCAGCCCTGGATAGTTCCCTGGCGATCGCCCGGCCGGAAAAGATTTACGAAGCCATGCGTTATTCTCTGTTGGCGGGGGGCAAACGATTGCGACCGATTTTATGCATTACGGCCTGCGAACTGTGTGGCGGTGATGAAGCCCTGGCCTTGCCCACGGCCTGTGCCCTGGAAATGATCCACACCATGTCCCTCATCCATGATGATTTGCCCTCCATGGATAATGACGATTTCCGCCGGGGTAAACCCACTAACCACAAAGTGTACGGGGAAGACATTGCCATTTTGGCCGGGGATGGACTGCTAGCCTATGCGTTTGAGTATGTAGTTACCCACACCCCCCAGGCTGATCCCCAAGCTTTACTCCAAGTTATTGCCCGTTTGGGTCGCACGGTGGGGGCCGCCGGTTTAGTGGGGGGACAAGTTCTAGACCTGGAATCGGAGGGGCGCACTGACATCACCCCGGAAACCCTAACTTTTATCCATACCCATAAAACCGGGGCATTGCTGGAAGCTTCCGTGCTCACAGGCGCAATTTTGGCCGGGGCCACTGGGGAACAACAACAGAGACTGGCCCGCTATGCCCAGAATATTGGCTTAGCTTTTCAAGTGGTGGATGACATCCTCGACATCACCGCCACCCAGGAAGAGTTGGGTAAAACCGCTGGTAAAGATGTCAAAGCCCAAAAAGCCACCTATCCCAGTCTCCTCGGTTTGGAAGCTTCCCGGGCCCAGGCCCAAAGTTTGATTGACCAGGCCATTGTCGCCCTGGAACCCTTTGGCCCCTCCGCCGAGCCCCTCCAGGCGATCGCCGAATATATTGTTGCCAGAAAATATTGA

Protein

MVAQQTRTDFDLAQYLQVKKGVVEAALDSSLAIARPEKIYEAMRYSLLAGGKRLRPILCITACELCGGDEALALPTACALEMIHTMSLIHDDLPSMDNDDFRRGKPTNHKVYGEDIAILAGDGLLAYAFEYVVTHTPQADPQALLQVIARLGRTVGAAGLVGGQVLDLESEGRTDITPETLTFIHTHKTGALLEASVLTGAILAGATGEQQQRLARYAQNIGLAFQVVDDILDITATQEELGKTAGKDVKAQKATYPSLLGLEASRAQAQSLIDQAIVALEPFGPSAEPLQAIAEYIVARKY