Your browser is old and dusty. Try Google Chrome!

Details for slr0737

ORF slr0737
Accession NP_440008.1
Symbol psaD
Category Photosystem I
Definition photosystem I subunit II
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -288 -302 13.8643 0.164
NP_442711.1_1 Forward -224 -210 13.4709 0.172
NP_441061.1_2 Forward -126 -112 0.294584 0.213
NP_441418.1_6 Forward -318 -299 -28.9099 0.213
NP_441418.1_6 Reverse -297 -316 -29.3032 0.221
NP_441418.1_6 Reverse -300 -319 -29.7948 0.238
NP_441418.1_6 Reverse -379 -398 -30.2865 0.267
NP_440815.1_5 Reverse -364 -383 9.24257 0.228
NP_441802.1_1 Forward -349 -330 5.30933 0.286
NP_441781.1_7 Forward -127 -108 -1.37718 0.272
NP_441581.1_4 Reverse -295 -314 1.96607 0.291
NP_441208.1_1 Forward -305 -286 -5.80207 0.284
NP_441594.1_6 Forward -306 -287 15.7324 0.0958
NP_441594.1_6 Reverse -291 -310 5.30933 0.209
NP_440856.1_7 Forward -321 -302 -2.85214 0.192
NP_440856.1_7 Reverse -294 -313 -4.81876 0.224
NP_439957.1_9 Reverse -75 -94 2.33913 0.3
NP_441738.1_2 Forward -229 -222 11.8385 0.0469
NP_441025.1_6 Reverse -73 -92 8.52366 0.166
NP_441624.1_7 Reverse -303 -317 9.43936 0.22
NP_440747.1_10 Reverse -285 -297 -12.2524 0.254
NP_442330.1_4 Forward -110 -91 13.3846 0.286
NP_442634.1_4 Reverse -286 -300 1.08123 0.149
NP_441265.1_1 Reverse -33 -52 -7.86702 0.101
NP_440842.1_6 Reverse -205 -224 12.9783 0.236
NP_441014.1_10 Reverse -378 -397 -2.06626 0.27
NP_441634.1_8 Reverse -292 -306 1.27789 0.202
NP_441013.1_3 Reverse -222 -241 6.98095 0.276
NP_442782.1_2 Reverse -332 -346 4.22782 0.256
NP_440184.1_2 Reverse -284 -303 7.17762 0.245
NP_441256.1_1 Reverse -294 -313 -8.752 0.264
NP_442937.1_5 Reverse -304 -323 7.17762 0.26
NP_442486.1_4 Reverse -88 -107 8.84924 0.264
NP_440153.1_8 Reverse -294 -307 7.00078 0.168
NP_440153.1_8 Forward -303 -290 -2.73398 0.256
NP_440993.1_4 Reverse -210 -227 3.38209 0.289
NP_442995.1_9 Reverse -140 -154 21.8291 0.0927
NP_442002.1_9 Reverse -221 -228 9.67555 0.27
NP_442438.1_10 Forward -137 -123 2.94952 0.168
NP_442438.1_10 Forward -302 -288 1.08123 0.206
NP_441752.1_6 Reverse -91 -110 6.29264 0.211
NP_442771.1_1 Reverse -286 -304 -9.71562 0.231
NP_441916.1_7 Reverse -288 -298 2.63497 0.246
NP_440345.1_3 Forward -43 -29 17.3912 0.161
NP_441041.1_7 Forward -234 -222 4.89098 0.289
NP_442396.1_5 Reverse -29 -42 9.45906 0.129
NP_440174.1_4 Forward -269 -250 22.3206 0.0455
NP_442004.1_6 Forward -132 -118 4.71948 0.204
NP_441725.1_4 Reverse -283 -297 8.16044 0.205
NP_440260.1_8 Reverse -300 -318 -2.14413 0.243
NP_441678.1_4 Forward -302 -283 15.9291 0.16
NP_441079.1_7 Forward -185 -166 -2.06626 0.216
NP_442901.1_4 Forward -119 -100 1.96607 0.278
NP_442847.1_3 Reverse -290 -309 7.66846 0.235
NP_442288.1_3 Forward -374 -357 5.74204 0.284
NP_441556.1_4 Forward -315 -296 10.2943 0.284
NP_440867.1_3 Reverse -290 -309 7.7676 0.285
NP_442215.1_2 Forward -299 -283 -6.92296 0.281
NP_442029.1_6 Forward -378 -359 4.42435 0.268
NP_442933.1_10 Reverse -288 -297 8.1612 0.0885
NP_442554.1_4 Forward -83 -64 7.96426 0.291
NP_442142.1_4 Forward -312 -299 2.18201 0.299
NP_440775.1_6 Reverse -358 -377 17.4269 0.255
NP_440895.1_3 Forward -244 -225 15.7961 0.258
NP_440125.1_6 Reverse -114 -133 10.9142 0.174
NP_441448.1_1 Reverse -292 -311 3.83436 0.287
NP_440379.1_5 Reverse -294 -313 -8.55534 0.253
NP_440920.1_1 Reverse -287 -306 10.6192 0.126
NP_442719.1_1 Reverse -29 -48 15.4374 0.256
NP_442719.1_2 Reverse -86 -104 -9.02799 0.259
NP_441612.1_2 Forward -76 -66 7.19391 0.26
NP_442559.1_3 Forward -79 -60 9.24257 0.28
NP_442559.1_3 Reverse -102 -121 7.27595 0.291
NP_440789.1_1 Forward -89 -70 14.4533 0.285
NP_442808.1_1 Forward -244 -234 1.06124 0.296
NP_442113.1_10 Forward -205 -186 -7.96535 0.277
NP_442342.1_9 Reverse -286 -302 3.79511 0.258
NP_442789.1_4 Reverse -295 -314 6.09597 0.135
NP_440923.1_1 Forward -90 -72 10.8348 0.291
NP_441878.1_6 Reverse -287 -297 1.55333 0.0937
NP_441878.1_6 Forward -304 -294 -7.98478 0.285
NP_441878.1_6 Reverse -293 -303 -7.98478 0.285
NP_442721.1_3 Forward -304 -285 17.6007 0.16
NP_442267.1_4 Forward -116 -97 5.60432 0.194
NP_442419.1_2 Reverse -298 -317 1.67108 0.238
NP_440084.1_8 Forward -90 -76 10.4202 0.271
NP_441739.1_2 Reverse -84 -100 3.10612 0.285
NP_441308.1_8 Reverse -362 -372 11.8781 0.22
NP_440101.1_10 Forward -303 -284 1.76941 0.28
NP_440190.1_5 Reverse -143 -161 13.3922 0.254
NP_441459.1_3 Forward -327 -308 14.3343 0.223
NP_441574.1_1 Reverse -288 -307 -4.6221 0.253
NP_442347.1_2 Reverse -101 -110 6.29291 0.175
NP_442347.1_2 Reverse -289 -298 3.44131 0.284
NP_440547.1_1 Forward -314 -295 17.3048 0.109
NP_442594.1_8 Reverse -147 -166 2.65439 0.294
NP_440299.1_1 Forward -301 -288 5.0336 0.191
NP_441799.1_1 Forward -235 -221 4.8172 0.236
NP_440256.1_1 Reverse -212 -231 -6.98204 0.225
NP_441229.1_10 Forward -282 -263 -0.295539 0.288
NP_441559.1_8 Reverse -359 -373 1.08123 0.156
NP_442158.1_4 Forward -117 -107 11.9764 0.26
NP_442866.1_1 Reverse -292 -311 -4.22878 0.225
NP_441838.1_10 Forward -311 -292 10.8159 0.259
NP_440695.1_5 Reverse -189 -208 -1.47551 0.284
NP_441199.1_6 Forward -313 -294 0.196116 0.252
NP_442993.1_1 Forward -303 -287 -12.2328 0.268
NP_442484.1_2 Forward -120 -101 3.14605 0.21
NP_440168.1_9 Reverse -286 -305 -1.47551 0.273
NP_440327.1_6 Reverse -297 -316 7.96426 0.224
NP_440194.1_4 Forward -34 -15 19.0748 0.25
NP_440586.1_1 Forward -111 -92 0.58944 0.237
NP_440586.1_1 Reverse -290 -309 -3.04881 0.263
NP_440586.1_8 Forward -296 -289 10.7568 0.128
NP_442251.1_6 Forward -163 -156 7.11894 0.274
NP_442959.1_5 Reverse -164 -183 7.47261 0.231
NP_440027.1_3 Forward -312 -294 5.22993 0.245
NP_439937.1_8 Forward -308 -289 -1.86883 0.251
NP_439937.1_8 Reverse -295 -314 -2.0655 0.254
NP_439937.1_8 Forward -311 -292 -5.21209 0.288
NP_439937.1_9 Forward -264 -247 0.628129 0.0978
NP_441789.1_7 Forward -328 -309 -3.44288 0.273
NP_441572.1_7 Forward -138 -119 -3.73712 0.219
NP_441877.1_7 Reverse -283 -302 13.6666 0.087
NP_442790.1_4 Reverse -288 -307 -12.4886 0.248
NP_442244.1_6 Forward -127 -108 7.17762 0.225
NP_440344.1_6 Forward -226 -212 15.5359 0.271
NP_441060.1_1 Reverse -189 -208 17.4407 0.151
NP_440487.1_1 Reverse -294 -313 -6.78538 0.274
NP_441335.1_5 Reverse -377 -396 17.994 0.217
NP_442280.1_10 Reverse -57 -75 8.37644 0.258
NP_442280.1_10 Forward -124 -106 6.52583 0.274
NP_441896.1_1 Forward -89 -70 8.55343 0.258
NP_440894.1_10 Reverse -283 -302 2.0644 0.298
NP_440999.1_9 Forward -202 -188 1.27789 0.168
NP_440999.1_9 Forward -301 -287 -1.08205 0.226
NP_440999.1_9 Reverse -293 -307 -2.55701 0.27
NP_441771.1_4 Forward -107 -88 -3.3438 0.292
NP_442033.1_10 Forward -299 -280 -8.55534 0.201
NP_443064.1_3 Forward -122 -103 6.58763 0.259
NP_441621.1_7 Reverse -298 -312 -5.11362 0.248
NP_441621.1_7 Reverse -295 -309 -6.49025 0.295
NP_443062.1_1 Reverse -288 -306 8.2534 0.157
NP_440939.1_5 Forward -105 -89 14.2182 0.204
NP_442204.1_1 Reverse -284 -295 8.7118 0.0852
NP_441443.1_7 Forward -315 -296 -3.24547 0.288
NP_440865.1_9 Forward -303 -284 -6.88371 0.234
NP_441052.1_2 Forward -297 -287 0.963343 0.255
NP_442414.1_9 Forward -315 -296 10.1275 0.292
NP_439982.1_1 Forward -303 -284 18.5839 0.127
NP_441004.1_1 Reverse -149 -168 -10.1286 0.218
NP_441004.1_1 Reverse -294 -313 -15.5368 0.275
NP_441004.1_1 Reverse -282 -301 -17.6018 0.292
NP_441501.1_9 Reverse -295 -314 17.5998 0.185
NP_442856.1_7 Forward -306 -287 -3.44213 0.243
NP_441982.1_6 Forward -348 -339 11.1485 0.288
NP_440463.1_8 Forward -313 -294 7.40308 0.264
NP_440389.1_5 Forward -348 -329 14.5362 0.221
NP_439960.1_10 Forward -313 -295 6.41066 0.138
NP_441031.1_8 Reverse -295 -314 12.4875 0.137
NP_442006.1_2 Forward -312 -295 -15.3991 0.224
NP_441003.1_9 Forward -124 -105 8.45592 0.224
NP_442320.1_8 Reverse -216 -230 -6.49025 0.288
NP_441732.1_2 Forward -310 -294 -15.9694 0.164
NP_441737.1_1 Forward -346 -327 9.24257 0.169
NP_441737.1_1 Reverse -142 -161 7.66927 0.169
NP_442815.1_1 Reverse -364 -383 17.3057 0.109
NP_442274.1_8 Forward -200 -182 13.3789 0.286
NP_442489.1_7 Reverse -288 -297 5.21127 0.077
NP_442749.1_5 Forward -102 -85 17.2859 0.159
NP_440545.1_3 Forward -307 -290 -3.10775 0.199
NP_440545.1_3 Forward -301 -284 -4.77938 0.232
NP_440545.1_3 Reverse -284 -301 -4.97604 0.237
NP_440831.1_3 Forward -306 -287 4.63975 0.298
NP_441629.1_3 Forward -310 -291 -3.44288 0.277
NP_440486.1_6 Forward -319 -300 5.211 0.3
NP_440010.1_4 Forward -316 -297 4.42355 0.22
NP_440010.1_4 Forward -313 -294 -1.08295 0.267
NP_440010.1_4 Forward -307 -288 -2.75457 0.289
NP_442551.1_4 Forward -305 -290 4.79811 0.245
NP_442875.1_8 Forward -101 -82 9.83255 0.293
NP_441895.1_10 Forward -100 -81 -18.8801 0.282
NP_440671.1_4 Reverse -278 -292 7.76774 0.208
NP_441973.1_4 Forward -336 -317 18.9773 0.219
NP_441915.1_4 Reverse -293 -312 17.5998 0.187
NP_440875.1_9 Reverse -290 -300 14.0176 0.0518
NP_440590.1_1 Reverse -109 -128 11.7 0.22
NP_442497.1_1 Forward -253 -234 7.57013 0.291
NP_440227.1_2 Forward -356 -340 9.49831 0.29
NP_440665.1_1 Forward -318 -299 -11.3086 0.244
NP_440833.1_6 Reverse -83 -97 8.94708 0.267
NP_440212.1_1 Forward -138 -119 3.14605 0.163
NP_442138.1_10 Reverse -297 -316 -5.40875 0.269
NP_440546.1_6 Reverse -247 -266 7.07928 0.278
NP_440055.1_2 Reverse -306 -325 12.2908 0.184
NP_441269.1_3 Reverse -219 -238 18.6823 0.296
NP_440402.1_3 Reverse -279 -298 3.34271 0.297
NP_441848.1_7 Reverse -94 -113 5.01354 0.215
NP_441848.1_7 Reverse -92 -111 -3.83621 0.285
NP_440008.1_1 Forward -90 -71 31.072 0.0000279
NP_440008.1_2 Forward -53 -34 26.6471 0.00097
NP_441102.1_1 Reverse -298 -317 4.32602 0.272
NP_442532.1_7 Forward -306 -292 1.76955 0.267
NP_442532.1_7 Reverse -291 -305 1.76955 0.267
NP_440914.1_1 Reverse -364 -374 10.079 0.158
NP_442533.1_6 Forward -297 -288 5.21127 0.15
NP_442533.1_6 Forward -303 -294 4.52295 0.179
NP_442533.1_6 Reverse -294 -303 4.52295 0.179
NP_442541.1_10 Reverse -294 -308 1.67063 0.282
NP_441482.1_7 Reverse -282 -296 -3.147 0.11
NP_441028.1_6 Reverse -101 -111 9.02601 0.216
NP_443045.1_5 Forward -224 -211 14.2391 0.275
NP_441106.1_3 Forward -91 -72 14.4541 0.158
NP_441106.1_7 Forward -326 -307 11.405 0.253
NP_440429.1_9 Reverse -294 -313 2.45773 0.278
NP_440886.1_7 Reverse -299 -309 9.41933 0.0805
NP_440886.1_7 Forward -298 -288 7.25606 0.0993
NP_440886.1_7 Reverse -296 -306 6.76441 0.114
NP_442614.1_2 Forward -303 -289 7.9644 0.257
NP_440907.2_8 Forward -387 -377 5.78111 0.188
NP_442264.1_2 Forward -307 -290 5.84037 0.27
NP_440841.1_4 Reverse -110 -129 -5.50708 0.208
NP_441962.1_9 Reverse -94 -113 6.09597 0.258
NP_441742.1_7 Reverse -284 -303 16.2241 0.245
NP_440114.1_10 Forward -380 -366 6.78443 0.258
NP_441801.1_4 Reverse -102 -112 2.92996 0.231
NP_441436.1_8 Forward -304 -285 11.8975 0.258
NP_442509.1_9 Reverse -278 -288 6.46942 0.268
NP_442509.1_9 Forward -231 -221 6.46942 0.268
NP_441489.1_3 Forward -99 -85 8.89237 0.232
NP_441275.1_1 Forward -90 -72 2.18243 0.203
NP_441173.1_9 Reverse -89 -97 12.2121 0.21
NP_441173.1_9 Reverse -90 -98 9.75379 0.284
NP_440552.1_8 Forward -87 -70 17.3362 0.0718
NP_441902.1_3 Reverse -342 -352 14.8281 0.205
NP_441105.1_3 Forward -308 -289 -4.42544 0.2
NP_440172.1_1 Reverse -222 -232 2.53664 0.277
NP_442015.1_10 Reverse -284 -297 7.29578 0.0904
NP_442446.1_3 Forward -309 -290 15.3391 0.199
NP_442417.1_5 Reverse -297 -311 7.76774 0.176
NP_442179.1_7 Reverse -298 -317 7.27595 0.167
NP_440416.1_9 Forward -304 -285 -4.81876 0.0783
NP_442116.1_6 Forward -195 -178 10.2698 0.223
NP_442403.1_5 Reverse -232 -251 13.8641 0.298
NP_442226.1_8 Reverse -339 -349 15.6147 0.167
NP_440988.1_10 Reverse -292 -306 19.6144 0.0801
NP_440988.1_10 Forward -305 -291 10.6108 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCGGCCAAAACGGGTATCCACCAATTGGGCATCCTCTTGGATCGTATTTACTGCCCAAAAAGTTAGCCCACTCATTAACAGGGACACCACCAAGGTGGCCGCGGCCATCAACCGGGTTTGTAGGTTGAACTCAGACCACCATTTACGCAGAAAACCCTGCATAGTCTGCAAAATCGCCGTTGGATTGGACACAGAAGTCCCCATAATCTCCTTGCCAAAACTCCTATGATTCTATCTCGATTACACCAACCTACTGGGCGTTCTAACAGAGATGCTCTACCCATTGTCCTGGGGAGCAGAATTTGGTGAAATGTTACAGTTCTTGACAAAGCCAGATGGTAACCGTAGGTCAGTGGTAGGATTCCCTAAAATACCTTATGAAATTCCATTTTCATCCCT

CDS

ATGACAGAACTCTCTGGACAACCGCCTAAATTCGGTGGCAGCACTGGTGGACTTCTCTCCAAAGCCAACCGGGAAGAAAAGTATGCCATCACCTGGACCAGCGCCTCTGAACAAGTTTTTGAAATGCCCACTGGCGGCGCGGCCATCATGAACGAAGGGGAAAATCTCCTTTATCTAGCCCGCAAAGAACAGTGTTTAGCCCTGGGGACCCAGCTACGGACAAAATTTAAACCCAAAATTCAAGACTACAAAATTTACCGTGTTTATCCCAGTGGTGAAGTTCAATACCTCCACCCCGCCGATGGCGTTTTCCCTGAAAAAGTTAACGAAGGTCGGGAAGCCCAAGGTACTAAAACCCGCCGCATTGGCCAAAACCCAGAACCTGTAACCATCAAGTTCTCCGGTAAAGCCCCCTACGAGGTCTAG

Protein

MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV