Your browser is old and dusty. Try Google Chrome!

Details for slr0730

ORF slr0730
Accession NP_439996.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -358 -344 18.1908 0.0786
NP_441061.1_2 Reverse -350 -364 3.93283 0.158
NP_441061.1_2 Forward -318 -304 -2.36035 0.29
NP_441418.1_6 Forward -370 -351 -30.4831 0.28
NP_441453.1_4 Reverse -349 -357 14.8674 0.00947
NP_441453.1_4 Forward -358 -350 6.80426 0.121
NP_441818.1_9 Reverse -142 -161 1.37609 0.191
NP_441818.1_9 Reverse -126 -145 -10.9153 0.299
NP_442169.1_1 Forward -399 -380 9.93088 0.239
NP_440813.1_1 Reverse -343 -357 19.2718 0.0907
NP_440996.1_5 Reverse -244 -253 15.4627 0.195
NP_440637.1_7 Forward -340 -321 12.2908 0.259
NP_443002.1_5 Forward -318 -300 9.6548 0.285
NP_442173.1_1 Forward -357 -349 13.8841 0.0225
NP_442173.1_1 Reverse -350 -358 12.0158 0.0316
NP_442752.1_4 Forward -358 -351 13.8055 0.0199
NP_441745.1_3 Reverse -114 -133 13.0766 0.298
NP_440784.1_7 Forward -357 -350 6.23397 0.241
NP_440784.1_7 Reverse -350 -357 6.13563 0.241
NP_441250.1_3 Forward -209 -190 1.76941 0.284
NP_440061.1_9 Reverse -347 -361 14.9452 0.0555
NP_442062.1_8 Forward -358 -348 9.7148 0.0559
NP_442062.1_8 Reverse -349 -359 5.09324 0.184
NP_441859.1_3 Reverse -348 -367 9.24175 0.13
NP_440304.1_4 Reverse -187 -197 5.28991 0.218
NP_442602.1_3 Reverse -101 -120 9.24257 0.0877
NP_439918.1_3 Reverse -2 -21 9.73422 0.249
NP_442110.1_7 Reverse -349 -363 0.982901 0.241
NP_442896.1_7 Reverse -82 -101 16.5191 0.0141
NP_440769.1_8 Forward -183 -164 10.2259 0.188
NP_441083.1_3 Reverse -127 -137 13.7459 0.195
NP_441083.1_5 Reverse -349 -359 9.81313 0.0224
NP_441083.1_5 Forward -358 -348 -1.00328 0.289
NP_441738.1_2 Reverse -351 -358 15.28 0.0102
NP_441942.1_2 Forward -397 -378 14.2574 0.217
NP_441645.1_6 Reverse -80 -94 13.1753 0.193
NP_440209.1_1 Forward -358 -350 8.57422 0.0425
NP_442889.1_10 Reverse -243 -262 11.4867 0.247
NP_441716.1_1 Reverse -109 -123 5.21113 0.239
NP_441327.1_5 Forward -42 -33 12.6844 0.298
NP_442111.1_4 Forward -359 -345 3.34284 0.248
NP_442111.1_4 Reverse -348 -362 2.5562 0.271
NP_440906.1_5 Forward -357 -350 6.23397 0.234
NP_440906.1_5 Reverse -350 -357 6.13563 0.241
NP_440438.2_8 Forward -265 -246 8.65258 0.116
NP_440747.1_10 Forward -361 -349 -2.32097 0.0331
NP_440747.1_10 Reverse -346 -358 -2.51763 0.0509
NP_441130.1_7 Reverse -337 -351 16.2235 0.287
NP_442145.1_4 Forward -266 -247 19.5277 0.0572
NP_441012.1_4 Forward -311 -298 6.60746 0.278
NP_443018.1_3 Reverse -350 -357 11.7405 0.0655
NP_443018.1_3 Forward -357 -350 5.44732 0.193
NP_441634.1_8 Forward -393 -379 -1.08205 0.278
NP_440376.1_1 Forward -358 -349 5.89959 0.116
NP_440376.1_1 Reverse -349 -358 -0.0986038 0.285
NP_443065.1_6 Forward -329 -310 1.86774 0.229
NP_442687.1_7 Reverse -108 -118 10.4031 0.0994
NP_442687.1_7 Forward -359 -349 5.68323 0.189
NP_441077.1_6 Forward -41 -25 7.04377 0.233
NP_441077.1_6 Reverse -208 -224 6.56173 0.239
NP_441077.1_6 Reverse -242 -258 3.86234 0.265
NP_441077.1_6 Reverse -241 -257 3.66953 0.267
NP_442946.1_7 Reverse -120 -135 14.6361 0.284
NP_440642.1_10 Reverse -334 -348 9.34041 0.193
NP_441013.1_2 Reverse -344 -362 3.46073 0.23
NP_441422.1_7 Reverse -347 -364 15.6735 0.0565
NP_441950.1_7 Forward -376 -357 -6.78538 0.273
NP_442296.1_9 Reverse -343 -362 0.392778 0.197
NP_441763.1_10 Reverse -184 -203 11.11 0.143
NP_440360.1_5 Reverse -361 -380 0.491109 0.297
NP_440236.1_2 Reverse -188 -206 -4.70074 0.277
NP_442658.1_1 Reverse -187 -197 9.02601 0.169
NP_442658.1_1 Reverse -347 -357 6.56775 0.224
NP_442198.1_3 Forward -370 -351 6.09597 0.251
NP_440141.1_8 Reverse -180 -199 8.45592 0.23
NP_441855.2_4 Reverse -341 -360 10.3907 0.255
NP_442782.1_2 Forward -358 -344 7.66941 0.202
NP_439968.1_8 Reverse -4 -20 13.7265 0.249
NP_442937.1_5 Forward -369 -350 13.9625 0.0859
NP_441958.1_5 Forward -359 -349 8.73149 0.0255
NP_440203.1_5 Reverse -352 -362 13.5492 0.114
NP_439905.1_1 Forward -318 -305 7.39411 0.262
NP_441377.1_6 Reverse -311 -330 10.8159 0.298
NP_439990.1_5 Forward -363 -350 13.294 0.1
NP_442690.1_1 Reverse -252 -271 -15.7335 0.28
NP_442690.1_1 Reverse -29 -48 -16.3235 0.287
NP_442690.1_1 Forward -264 -245 -17.2085 0.298
NP_442690.1_1 Reverse -215 -234 -17.2085 0.298
NP_442911.1_2 Forward -368 -349 -5.40875 0.158
NP_441580.1_6 Forward -161 -142 -4.91709 0.235
NP_440153.1_5 Forward -357 -343 1.96621 0.241
NP_440153.1_8 Reverse -376 -389 -2.53732 0.244
NP_442064.1_1 Forward -203 -184 -1.47551 0.146
NP_442536.1_4 Reverse -106 -124 11.9172 0.176
NP_442536.1_4 Forward -124 -106 5.91901 0.3
NP_442236.1_2 Reverse -303 -322 14.1591 0.247
NP_442236.1_7 Reverse -37 -56 7.66927 0.3
NP_440993.1_2 Reverse -344 -360 5.36841 0.234
NP_440993.1_3 Forward -335 -316 2.75194 0.199
NP_443044.1_1 Reverse -327 -346 16.1257 0.17
NP_441913.1_1 Reverse -183 -199 13.0453 0.293
NP_442002.1_1 Forward -98 -80 -9.71562 0.283
NP_442438.1_10 Reverse -344 -358 0.392915 0.229
NP_442771.1_1 Reverse -377 -395 -10.3056 0.254
NP_440147.1_4 Reverse -347 -360 7.49244 0.0678
NP_440147.1_4 Forward -360 -347 4.64084 0.153
NP_441550.1_8 Forward -360 -350 15.5158 0.0132
NP_441916.1_7 Forward -358 -348 6.66654 0.0875
NP_441916.1_7 Reverse -349 -359 1.35667 0.286
NP_441041.1_4 Reverse -304 -323 -13.4719 0.288
NP_441547.1_2 Forward -369 -351 7.68896 0.215
NP_442004.1_6 Forward -324 -310 5.30946 0.191
NP_441725.1_5 Forward -197 -187 7.05986 0.106
NP_441725.1_5 Reverse -350 -360 -0.806614 0.271
NP_439966.1_7 Reverse -347 -357 8.73102 0.13
NP_439966.1_7 Forward -360 -350 5.09279 0.243
NP_439966.1_7 Reverse -385 -395 4.40448 0.273
NP_439966.1_9 Forward -360 -351 0.884706 0.253
NP_442941.1_3 Reverse -350 -360 1.16001 0.15
NP_440289.1_2 Reverse -386 -399 -1.35735 0.233
NP_440260.1_8 Forward -374 -356 -4.99573 0.273
NP_442281.1_1 Reverse -344 -358 18.2885 0.00454
NP_442281.1_1 Reverse -184 -198 2.65393 0.26
NP_441079.1_7 Reverse -243 -262 9.53674 0.0999
NP_442575.1_8 Forward -357 -338 8.84924 0.124
NP_440437.1_1 Reverse -343 -362 -0.590531 0.183
NP_442500.1_8 Reverse -241 -255 9.0215 0.285
NP_442012.1_1 Forward -125 -106 2.0644 0.205
NP_441644.1_6 Reverse -349 -359 14.7292 0.0105
NP_442215.1_2 Forward -200 -184 8.80999 0.0612
NP_442215.1_2 Reverse -340 -356 4.0901 0.0879
NP_442029.1_6 Forward -363 -344 9.43923 0.188
NP_442029.1_6 Forward -369 -350 8.45592 0.207
NP_440929.1_8 Reverse -349 -358 7.17789 0.0713
NP_442933.1_10 Reverse -349 -358 8.06287 0.0885
NP_442933.1_10 Forward -358 -349 7.96454 0.0937
NP_441751.2_8 Reverse -350 -364 5.21113 0.0448
NP_442554.1_8 Reverse -350 -360 8.23984 0.0776
NP_442554.1_8 Forward -357 -347 2.14332 0.281
NP_442863.1_10 Forward -387 -368 20.059 0.2
NP_441762.1_7 Reverse -348 -360 3.77555 0.0676
NP_442142.1_4 Forward -310 -297 5.32859 0.194
NP_442142.1_4 Forward -361 -348 4.83694 0.209
NP_442292.1_1 Reverse -350 -359 8.65285 0.0335
NP_442016.1_10 Forward -98 -79 6.98095 0.259
NP_440895.1_6 Forward -364 -351 11.1307 0.202
NP_443009.1_5 Forward -359 -348 7.53132 0.126
NP_440405.1_3 Forward -74 -55 26.3235 0.00381
NP_441865.1_3 Forward -270 -252 15.5554 0.227
NP_441715.1_4 Forward -357 -347 7.84651 0.107
NP_440279.1_2 Forward -369 -350 4.52268 0.298
NP_442076.1_5 Reverse -11 -30 6.98095 0.256
NP_441468.1_1 Forward -357 -350 6.13563 0.209
NP_441468.1_1 Reverse -350 -357 6.0373 0.223
NP_441015.1_10 Forward -363 -344 13.8641 0.0564
NP_441015.1_10 Forward -369 -350 -3.54046 0.19
NP_441673.1_1 Forward -358 -349 1.27803 0.155
NP_441673.1_1 Reverse -349 -358 1.27803 0.155
NP_441731.1_3 Forward -366 -347 3.24438 0.164
NP_441826.1_2 Forward -364 -350 5.89945 0.0946
NP_441826.1_2 Reverse -343 -357 -4.7203 0.299
NP_442490.1_9 Forward -370 -351 8.55425 0.125
NP_441764.1_8 Reverse -161 -171 11.4064 0.284
NP_442868.1_6 Forward -360 -350 7.74818 0.0697
NP_442719.1_2 Forward -117 -99 -2.83317 0.192
NP_441251.1_8 Reverse -242 -255 11.5208 0.27
NP_440051.1_5 Reverse -220 -234 17.8465 0.178
NP_441612.1_2 Reverse -194 -204 11.7441 0.21
NP_442227.1_2 Reverse -342 -361 -3.63879 0.294
NP_442808.1_1 Reverse -348 -358 10.501 0.0481
NP_442808.1_1 Forward -18 -8 1.94622 0.281
NP_441101.1_4 Forward -206 -187 6.4893 0.295
NP_442050.1_1 Forward -358 -339 9.0459 0.25
NP_440558.1_2 Forward -322 -303 5.60432 0.142
NP_440558.1_2 Reverse -74 -93 -1.18052 0.211
NP_442593.1_3 Forward -362 -343 18.5208 0.216
NP_442792.1_5 Forward -301 -284 8.39697 0.296
NP_441878.1_6 Reverse -188 -198 -7.39479 0.222
NP_441036.1_3 Reverse -98 -117 4.03102 0.168
NP_441036.1_8 Reverse -348 -358 8.1415 0.176
NP_441557.1_5 Forward -358 -349 8.94785 0.0289
NP_441557.1_5 Reverse -349 -358 0.688044 0.128
NP_442066.2_4 Forward -358 -339 -3.14714 0.215
NP_442777.1_1 Reverse -78 -97 6.78348 0.253
NP_442777.1_3 Reverse -380 -398 10.9331 0.158
NP_440084.1_8 Forward -258 -244 9.36983 0.29
NP_441458.1_10 Reverse -340 -359 5.50599 0.216
NP_441574.1_1 Forward -370 -351 -7.37537 0.289
NP_442347.1_2 Reverse -350 -359 10.3245 0.058
NP_442645.1_2 Forward -373 -354 -16.3235 0.23
NP_441633.1_3 Reverse -347 -360 -1.75067 0.163
NP_440136.1_2 Forward -357 -350 6.23397 0.171
NP_440136.1_2 Reverse -350 -357 6.13563 0.193
NP_441728.2_2 Reverse -188 -207 17.994 0.218
NP_442998.1_5 Forward -347 -337 7.05986 0.3
NP_442998.1_10 Reverse -351 -358 15.5754 0.0102
NP_440299.1_1 Forward -362 -349 12.4084 0.0383
NP_440299.1_1 Reverse -345 -358 5.0336 0.191
NP_440640.1_6 Reverse -2 -21 -0.39387 0.285
NP_440256.1_1 Forward -361 -342 -0.787193 0.0961
NP_442007.1_8 Reverse -377 -395 8.76983 0.297
NP_441559.1_8 Reverse -344 -358 -7.37523 0.291
NP_440915.1_6 Forward -362 -348 3.93283 0.1
NP_440915.1_6 Reverse -345 -359 0.786239 0.153
NP_442158.1_4 Forward -367 -357 11.7798 0.264
NP_441866.1_6 Forward -212 -193 8.06178 0.26
NP_440215.1_10 Forward -398 -379 13.2741 0.276
NP_441939.1_3 Forward -357 -338 13.6675 0.0883
NP_441199.1_6 Reverse -345 -364 -0.787193 0.282
NP_442386.1_9 Reverse -348 -357 12.8806 0.0501
NP_442386.1_10 Forward -88 -75 13.6873 0.107
NP_441340.1_5 Forward -357 -350 13.5105 0.0314
NP_441340.1_5 Reverse -350 -357 5.84064 0.208
NP_441340.1_9 Forward -228 -218 15.1001 0.194
NP_442240.1_2 Forward -357 -338 -20.2567 0.295
NP_440586.1_8 Reverse -350 -357 9.47853 0.146
NP_440586.1_8 Forward -357 -350 5.74197 0.283
NP_441262.1_3 Forward -358 -351 14.7888 0.0223
NP_440027.1_3 Reverse -382 -400 1.98502 0.295
NP_443051.1_1 Forward -359 -350 7.47288 0.0571
NP_439996.1_10 Forward -314 -295 21.2389 0.0369
NP_439937.1_8 Forward -393 -374 6.68596 0.192
NP_439937.1_9 Reverse -76 -93 0.529798 0.0978
NP_439937.1_9 Forward -111 -94 -1.43681 0.124
NP_439937.1_9 Reverse -348 -365 -9.10659 0.181
NP_439937.1_9 Forward -112 -95 -13.0398 0.279
NP_440408.1_7 Reverse -310 -329 8.45592 0.281
NP_440439.1_1 Forward -361 -348 7.00078 0.0703
NP_440439.1_1 Forward -84 -71 -0.570702 0.226
NP_440439.1_1 Reverse -346 -359 -1.75067 0.281
NP_440372.1_2 Forward -357 -350 13.8055 0.0214
NP_440372.1_2 Reverse -350 -357 6.52896 0.188
NP_440171.1_3 Forward -361 -342 3.14605 0.284
NP_441181.1_6 Forward -357 -339 3.06741 0.283
NP_439977.1_5 Forward -319 -300 0.884433 0.199
NP_441572.1_7 Reverse -343 -362 -5.11376 0.25
NP_442384.1_10 Reverse -349 -362 7.6891 0.0764
NP_441877.1_9 Forward -266 -249 5.84037 0.284
NP_441018.1_7 Forward -362 -343 10.4225 0.205
NP_442262.1_10 Reverse -350 -357 13.2155 0.0213
NP_440344.1_1 Forward -360 -341 10.9142 0.188
NP_441335.1_5 Reverse -127 -146 15.4374 0.234
NP_442556.1_10 Forward -213 -194 11.982 0.217
NP_440297.1_9 Forward -197 -187 6.96153 0.161
NP_440999.1_9 Reverse -345 -359 10.4227 0.0529
NP_440888.1_2 Reverse -349 -363 14.0603 0.0211
NP_442454.1_2 Reverse -20 -39 7.01823 0.291
NP_442454.1_2 Reverse -246 -265 6.15881 0.298
NP_440491.1_1 Forward -361 -342 8.37887 0.243
NP_442277.1_2 Reverse -335 -349 17.4042 0.158
NP_442033.1_10 Reverse -337 -356 -10.3253 0.233
NP_441543.1_2 Reverse -350 -359 7.07956 0.131
NP_441543.1_2 Forward -357 -348 6.09625 0.153
NP_442845.1_2 Forward -364 -350 13.9626 0.088
NP_442710.1_7 Forward -261 -242 -2.12892 0.233
NP_442315.1_1 Forward -372 -354 2.67408 0.297
NP_443064.1_3 Forward -102 -83 12.0942 0.159
NP_443064.1_3 Forward -103 -84 5.50599 0.298
NP_442578.1_5 Reverse -336 -355 8.45592 0.227
NP_442578.1_7 Forward -357 -350 6.0373 0.18
NP_441462.1_2 Forward -358 -348 8.82982 0.03
NP_441462.1_4 Reverse -380 -399 -4.22878 0.242
NP_442204.1_1 Forward -362 -351 2.41861 0.266
NP_442204.1_5 Forward -398 -379 2.0644 0.22
NP_441560.1_8 Forward -393 -374 13.5579 0.205
NP_442487.1_5 Reverse -71 -90 9.43841 0.198
NP_440454.1_8 Reverse -197 -213 19.2323 0.215
NP_440516.1_8 Forward -358 -349 9.4395 0.0183
NP_440516.1_8 Reverse -349 -358 5.11294 0.118
NP_442428.1_5 Forward -357 -350 6.13563 0.209
NP_442428.1_5 Reverse -350 -357 6.0373 0.212
NP_440673.1_3 Reverse -351 -358 12.4288 0.0426
NP_441052.1_2 Reverse -349 -359 1.65166 0.233
NP_441052.1_2 Reverse -355 -365 1.455 0.244
NP_440992.1_5 Forward -146 -127 12.375 0.297
NP_442219.1_8 Forward -347 -328 7.00751 0.28
NP_442219.1_9 Reverse -350 -359 7.96454 0.0696
NP_440436.1_4 Reverse -350 -359 7.57079 0.124
NP_440436.1_4 Forward -357 -348 7.37413 0.132
NP_440436.1_4 Forward -197 -188 6.48915 0.157
NP_441884.1_8 Forward -359 -340 -6.49039 0.225
NP_442414.1_9 Reverse -71 -90 12.6841 0.282
NP_441719.1_4 Forward -357 -350 6.82395 0.0855
NP_441719.1_4 Reverse -350 -357 6.52896 0.188
NP_441733.1_10 Forward -361 -348 16.9322 0.0382
NP_441004.1_1 Forward -363 -344 -12.0953 0.244
NP_441004.1_1 Forward -137 -118 -17.1101 0.289
NP_441004.1_1 Forward -394 -375 -17.3068 0.29
NP_442813.1_2 Forward -178 -159 -3.3438 0.273
NP_442813.1_4 Forward -105 -86 0.491109 0.197
NP_442813.1_4 Forward -366 -347 0.392778 0.2
NP_442813.1_4 Forward -104 -85 -8.45701 0.299
NP_442366.1_3 Reverse -348 -366 7.19731 0.0762
NP_442366.1_3 Forward -359 -341 5.32902 0.0878
NP_440129.1_4 Reverse -352 -370 16.6363 0.171
NP_442694.1_4 Reverse -8 -17 12.9794 0.225
NP_440328.1_4 Reverse -343 -362 1.76941 0.217
NP_440328.1_4 Forward -306 -287 -0.0988766 0.267
NP_443054.1_2 Forward -390 -376 -0.295402 0.293
NP_441851.1_10 Forward -359 -349 7.35486 0.142
NP_442208.1_5 Forward -360 -341 -3.54046 0.258
NP_442011.1_1 Forward -359 -340 -2.26216 0.272
NP_442515.1_1 Reverse -194 -208 -0.787057 0.235
NP_441396.1_5 Forward -353 -344 17.1093 0.15
NP_440338.1_4 Reverse -244 -263 7.27514 0.28
NP_441124.1_5 Forward -255 -245 10.5254 0.286
NP_440588.1_2 Reverse -340 -359 -2.16383 0.161
NP_440588.1_2 Forward -367 -348 -3.44213 0.186
NP_441031.1_1 Reverse -243 -262 4.02695 0.293
NP_441031.1_1 Reverse -200 -219 3.73773 0.296
NP_442006.1_2 Forward -400 -383 -13.7275 0.197
NP_442006.1_3 Forward -364 -346 -6.1757 0.298
NP_440483.1_1 Reverse -86 -105 -8.94866 0.297
NP_442243.1_1 Reverse -349 -367 -1.35821 0.277
NP_441570.1_1 Forward -364 -346 -7.65067 0.0925
NP_441078.1_4 Reverse -349 -358 0.0980582 0.205
NP_441078.1_4 Forward -358 -349 0.0980582 0.205
NP_441663.1_8 Reverse -343 -362 14.8474 0.0482
NP_442348.1_2 Reverse -215 -224 14.7494 0.146
NP_442480.1_3 Reverse -243 -262 19.2412 0.103
NP_440707.1_7 Forward -365 -346 9.14423 0.207
NP_442443.1_1 Forward -136 -117 -4.72043 0.276
NP_442443.1_4 Reverse -192 -202 16.7941 0.14
NP_440526.1_3 Reverse -350 -361 8.12131 0.126
NP_441432.1_8 Forward -359 -350 14.0611 0.0258
NP_441432.1_9 Reverse -221 -234 8.50141 0.289
NP_441732.1_2 Reverse -345 -361 -16.3627 0.165
NP_440760.1_7 Forward -174 -155 0.981987 0.299
NP_441945.1_10 Forward -138 -119 10.3242 0.252
NP_441057.1_3 Forward -115 -96 -11.9969 0.25
NP_440713.1_4 Forward -368 -349 9.83255 0.136
NP_442489.1_7 Reverse -349 -358 0.786375 0.152
NP_442489.1_7 Forward -358 -349 0.589713 0.17
NP_440565.1_1 Reverse -93 -112 19.0757 0.152
NP_440559.1_1 Reverse -350 -359 7.76787 0.0918
NP_440559.1_1 Forward -357 -348 6.09625 0.134
NP_441659.2_8 Reverse -349 -359 12.7631 0.0147
NP_442008.1_2 Forward -361 -342 5.40766 0.226
NP_442776.1_1 Forward -22 -3 4.03102 0.278
NP_440315.1_1 Reverse -129 -148 15.8307 0.0957
NP_442346.1_5 Forward -359 -349 7.05986 0.183
NP_440352.1_7 Forward -317 -304 20.6681 0.0654
NP_440545.1_3 Forward -362 -345 3.67709 0.0804
NP_441629.1_3 Forward -145 -126 -3.34455 0.277
NP_441126.1_6 Reverse -236 -250 17.5509 0.228
NP_440459.1_2 Reverse -347 -364 7.70866 0.283
NP_440010.1_10 Forward -393 -374 10.0292 0.209
NP_441943.1_5 Reverse -14 -33 18.2844 0.177
NP_442603.1_7 Reverse -349 -363 12.192 0.102
NP_442603.1_7 Forward -358 -344 7.96378 0.191
NP_442828.1_7 Reverse -96 -115 -3.73712 0.276
NP_441888.1_7 Reverse -344 -358 3.14618 0.225
NP_440449.1_6 Forward -396 -378 9.1312 0.187
NP_441833.1_4 Reverse -350 -357 6.52896 0.0924
NP_441833.1_4 Forward -357 -350 6.23397 0.163
NP_443040.1_1 Reverse -163 -177 11.3435 0.276
NP_442060.1_10 Forward -366 -347 9.3409 0.252
NP_442699.1_8 Forward -354 -335 -13.2752 0.297
NP_442162.1_8 Reverse -343 -362 -2.85214 0.291
NP_442162.1_9 Forward -357 -350 12.9205 0.0282
NP_442162.1_9 Reverse -350 -357 12.9205 0.0282
NP_440671.1_1 Forward -177 -158 4.69551 0.267
NP_440671.1_4 Forward -364 -350 10.4227 0.158
NP_440671.1_4 Reverse -343 -357 8.35772 0.201
NP_442943.1_1 Reverse -243 -258 5.78533 0.21
NP_442045.1_5 Forward -367 -348 -2.85214 0.294
NP_442140.1_3 Reverse -350 -360 11.4848 0.0757
NP_442140.1_3 Forward -357 -347 4.69992 0.238
NP_442723.1_1 Forward -171 -152 2.16195 0.291
NP_441609.1_1 Reverse -217 -236 0.0977854 0.224
NP_440875.1_9 Reverse -351 -361 9.3454 0.233
NP_441813.1_5 Reverse -347 -357 15.5163 0.0106
NP_440590.1_4 Reverse -350 -363 5.13249 0.0585
NP_440590.1_4 Forward -357 -344 3.26421 0.0749
NP_442497.1_10 Reverse -350 -359 0.589713 0.153
NP_442497.1_10 Forward -357 -348 -1.18024 0.256
NP_440821.1_4 Forward -360 -350 8.23984 0.053
NP_441239.1_9 Reverse -75 -87 17.4436 0.0146
NP_441239.1_9 Reverse -347 -359 11.347 0.0627
NP_440624.1_5 Forward -260 -242 16.2476 0.153
NP_441892.1_1 Reverse -346 -363 -4.28772 0.258
NP_442669.1_1 Forward -187 -168 28.4171 0.0000322
NP_442669.1_1 Reverse -57 -76 3.93269 0.144
NP_440604.1_5 Forward -181 -162 17.0177 0.235
NP_442193.1_1 Reverse -2 -20 8.18062 0.274
NP_441508.1_4 Reverse -194 -208 13.094 0.297
NP_441541.1_1 Forward -266 -248 4.01265 0.171
NP_440833.1_6 Forward -226 -212 9.34041 0.264
NP_440354.1_5 Forward -361 -342 5.70265 0.192
NP_440546.1_4 Forward -358 -348 14.5061 0.0459
NP_440546.1_4 Reverse -349 -359 8.20381 0.199
NP_440462.1_6 Reverse -347 -357 13.648 0.0266
NP_440868.1_4 Forward -362 -350 4.8572 0.109
NP_441249.1_8 Forward -400 -381 4.32602 0.259
NP_441868.1_4 Reverse -308 -322 18.3875 0.166
NP_441474.1_1 Forward -161 -142 -0.492971 0.255
NP_442402.1_4 Forward -114 -95 8.35677 0.113
NP_442402.1_4 Forward -115 -96 -8.26108 0.278
NP_442402.1_10 Forward -106 -96 12.6642 0.204
NP_441848.1_4 Reverse -245 -261 8.3146 0.288
NP_441848.1_4 Forward -232 -216 7.45517 0.288
NP_441848.1_4 Reverse -234 -250 6.97771 0.3
NP_441848.1_7 Forward -252 -233 -1.67294 0.254
NP_441084.1_6 Reverse -199 -213 10.4106 0.241
NP_442923.1_4 Forward -137 -118 26.3522 0.00247
NP_442039.1_4 Forward -357 -350 11.6422 0.0747
NP_442039.1_7 Reverse -191 -201 13.943 0.211
NP_441811.1_1 Reverse -336 -355 5.89931 0.28
NP_442696.1_6 Reverse -74 -93 -13.0786 0.261
NP_442837.1_3 Forward -357 -350 6.0373 0.25
NP_442837.1_3 Reverse -350 -357 6.0373 0.25
NP_442053.1_1 Reverse -349 -358 7.17789 0.104
NP_440505.1_3 Forward -360 -350 15.0247 0.0149
NP_440351.1_1 Reverse -81 -100 23.5989 0.000823
NP_440351.1_1 Forward -106 -87 -1.08219 0.222
NP_441701.1_3 Reverse -300 -317 10.4619 0.24
NP_441102.1_2 Forward -181 -162 5.89931 0.298
NP_440009.1_4 Reverse -192 -211 7.07928 0.299
NP_440914.1_1 Reverse -349 -359 14.373 0.0158
NP_440914.1_1 Reverse -189 -199 10.6645 0.129
NP_441011.1_8 Forward -357 -348 14.651 0.023
NP_442533.1_1 Forward -96 -77 -10.522 0.234
NP_442533.1_1 Reverse -93 -112 -11.0136 0.235
NP_442533.1_6 Forward -358 -349 5.40793 0.14
NP_442533.1_6 Reverse -349 -358 4.52295 0.179
NP_442541.1_10 Forward -319 -305 13.5686 0.182
NP_442541.1_10 Reverse -77 -91 8.45543 0.218
NP_440263.1_5 Forward -105 -91 6.98109 0.294
NP_442232.1_3 Forward -366 -347 -13.2752 0.282
NP_442322.1_4 Reverse -383 -400 9.96952 0.141
NP_441482.1_7 Reverse -343 -357 -11.8985 0.286
NP_439944.1_9 Reverse -350 -360 9.32148 0.1
NP_441697.1_5 Reverse -243 -262 8.6416 0.142
NP_441697.1_5 Forward -261 -242 -8.92892 0.268
NP_441697.1_5 Reverse -209 -228 -9.97933 0.278
NP_441697.1_5 Reverse -244 -263 -10.8388 0.286
NP_441697.1_5 Reverse -242 -261 -11.6027 0.297
NP_441028.1_6 Forward -105 -95 8.3377 0.216
NP_441028.1_6 Forward -116 -106 5.48612 0.255
NP_441527.1_4 Forward -276 -257 -7.30556 0.232
NP_440115.1_6 Forward -361 -351 18.9579 0.0139
NP_440007.1_9 Reverse -185 -199 1.17956 0.29
NP_441347.1_9 Forward -175 -162 12.3596 0.17
NP_440608.1_6 Forward -25 -6 5.60352 0.242
NP_441602.1_3 Forward -363 -344 -0.983855 0.226
NP_441602.1_3 Reverse -377 -396 -4.91709 0.277
NP_441106.1_1 Reverse -348 -357 7.66954 0.0776
NP_442588.1_8 Reverse -86 -105 6.68596 0.238
NP_441286.1_1 Forward -199 -187 0.432302 0.113
NP_441286.1_1 Reverse -348 -360 -6.84419 0.283
NP_442674.1_1 Reverse -186 -205 10.6585 0.261
NP_440670.1_8 Forward -358 -349 8.65285 0.0627
NP_440670.1_8 Reverse -349 -358 6.29291 0.124
NP_440886.1_7 Reverse -348 -358 7.74772 0.0843
NP_440886.1_7 Reverse -378 -388 6.0761 0.147
NP_440828.1_4 Forward -27 -8 -2.36125 0.214
NP_442614.1_2 Reverse -195 -209 5.80112 0.297
NP_440404.1_9 Forward -279 -260 7.49569 0.286
NP_441808.1_8 Forward -388 -369 7.96426 0.273
NP_440907.2_8 Reverse -350 -360 9.12434 0.113
NP_441463.1_2 Forward -180 -162 6.32946 0.143
NP_441626.1_2 Forward -357 -350 12.2322 0.0511
NP_441626.1_2 Reverse -350 -357 5.93897 0.231
NP_442362.1_2 Forward -45 -28 18.1317 0.239
NP_442209.1_8 Forward -160 -141 13.7658 0.193
NP_442794.1_1 Forward -362 -350 3.2839 0.286
NP_442615.1_1 Forward -367 -349 0.609134 0.0999
NP_442615.1_1 Reverse -340 -358 -6.4707 0.248
NP_442467.1_8 Reverse -380 -399 17.8957 0.258
NP_441962.1_4 Forward -91 -72 -11.2103 0.238
NP_441431.1_1 Forward -43 -25 5.44503 0.245
NP_441431.1_2 Reverse -346 -360 14.5519 0.0636
NP_440634.1_2 Reverse -292 -311 19.764 0.157
NP_441993.1_1 Forward -364 -345 12.4721 0.0994
NP_441174.1_4 Reverse -153 -163 14.0414 0.267
NP_440814.1_8 Reverse -304 -323 7.66927 0.269
NP_441858.1_2 Forward -346 -327 18.6086 0.137
NP_442323.1_7 Reverse -344 -363 4.42355 0.217
NP_441272.1_4 Forward -367 -348 0.392778 0.258
NP_440766.1_4 Forward -362 -348 21.2391 0.0248
NP_441246.1_6 Reverse -148 -166 22.5369 0.00323
NP_442930.1_1 Forward -225 -215 14.9258 0.219
NP_442867.1_8 Forward -103 -84 4.916 0.277
NP_440457.1_1 Forward -362 -350 8.88877 0.101
NP_440457.1_1 Forward -90 -78 0.0389777 0.25
NP_440457.1_1 Forward -395 -383 -0.74767 0.273
NP_441801.1_4 Reverse -74 -84 3.42162 0.231
NP_442680.1_5 Reverse -236 -255 3.68677 0.227
NP_442680.1_5 Reverse -237 -256 2.31911 0.237
NP_440801.1_10 Forward -362 -343 7.17762 0.272
NP_440942.1_3 Reverse -92 -111 2.45773 0.298
NP_440942.1_6 Reverse -75 -94 9.04509 0.257
NP_441436.1_8 Forward -359 -340 9.83255 0.262
NP_441489.1_3 Reverse -192 -206 9.36983 0.232
NP_440734.1_9 Forward -346 -327 9.0459 0.297
NP_441159.1_7 Reverse -314 -333 -9.24366 0.264
NP_440554.1_4 Forward -357 -347 8.82982 0.0646
NP_440554.1_4 Reverse -350 -360 3.42162 0.23
NP_441885.1_5 Forward -358 -348 7.94484 0.0385
NP_441885.1_5 Reverse -349 -359 1.35667 0.11
NP_441428.1_8 Reverse -302 -321 2.55606 0.268
NP_442341.1_7 Reverse -348 -362 8.65272 0.0858
NP_441756.1_5 Reverse -345 -364 -1.96717 0.267
NP_441173.1_9 Forward -115 -107 11.0321 0.228
NP_441173.1_9 Forward -104 -96 10.1471 0.261
NP_442395.2_4 Forward -155 -136 1.76863 0.234
NP_443000.1_3 Forward -399 -380 10.0681 0.289
NP_443000.1_7 Reverse -347 -357 1.06167 0.274
NP_443000.1_7 Forward -360 -350 0.668351 0.293
NP_440507.2_3 Forward -367 -348 7.37347 0.281
NP_442513.1_5 Forward -100 -81 8.55343 0.266
NP_442513.1_6 Reverse -227 -246 7.07848 0.296
NP_440275.1_3 Forward -360 -350 15.123 0.0182
NP_440560.1_5 Forward -107 -88 17.6202 0.0646
NP_441902.1_3 Reverse -95 -105 12.9817 0.23
NP_442451.1_2 Reverse -341 -360 -10.817 0.28
NP_441122.1_1 Forward -202 -187 4.20813 0.28
NP_441207.1_7 Reverse -242 -256 17.9685 0.179
NP_439962.1_4 Reverse -341 -360 4.62101 0.179
NP_441875.1_7 Forward -123 -113 15.418 0.227
NP_441105.1_3 Forward -369 -350 -3.54046 0.181
NP_441105.1_3 Reverse -338 -357 -7.96535 0.263
NP_440216.1_1 Forward -358 -344 -2.16369 0.0482
NP_440216.1_9 Reverse -191 -200 7.17789 0.286
NP_440172.1_1 Reverse -349 -359 2.33998 0.279
NP_440167.1_3 Forward -398 -379 8.06259 0.283
NP_442015.1_10 Reverse -345 -358 11.9173 0.0372
NP_441226.1_7 Forward -357 -350 12.7234 0.0312
NP_441226.1_7 Reverse -350 -357 11.5435 0.0757
NP_442834.1_9 Reverse -6 -25 7.07928 0.239
NP_441111.1_7 Reverse -350 -358 8.86921 0.0589
NP_441766.1_2 Forward -358 -349 8.1612 0.0645
NP_441766.1_2 Reverse -349 -358 5.89959 0.103
NP_442417.1_5 Forward -358 -344 6.48943 0.219
NP_442179.1_3 Reverse -288 -307 16.8141 0.0963
NP_440416.1_9 Forward -365 -346 -0.885524 0.0621
NP_440416.1_9 Reverse -342 -361 -15.1435 0.186
NP_440072.1_5 Forward -396 -378 0.609134 0.236
NP_442154.1_1 Forward -399 -381 -16.7954 0.245
NP_440261.1_5 Reverse -350 -363 -3.32397 0.127
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGGCGGGCTGGGGTGGAAGCCGCTCTGAAGGATTTGTCCGTGGCGATCGGTGGGGGCAAAGTGAACATTTCCCTACTGGATGCCCTTTCCAGCACCATGGTTAACCGTTTGCTGACCCTGTTGGAAGAATATCAAAGTAAGAATTTTTAAACTTTTTCCGCCCTTAAAAGCTAGTAAAAATTCCCATTTGTTCAGTGTTTTTGCCATTGTCCTTAGAACGTGTTTGGAAAGTTTTATTCCGCCCCCTAAATCGACCCACTAAAGCTCCGGCAATAATGGGGGACTTTCACCCAGTTTCCCCCCAAATTTGGGGGGCCAGGGGAGCTTTTAAAACATGCTCTTAAACCTAGGCAACCTAAGCAAAGATTAAATTTTCATTCACCACCAAGCCCATTAACC

CDS

ATGGCCAGCACCCCCATCCAGAGCGAAGCTCGTACCGACCTAGAACCTAGCTTTGTCATTCCCCTCGTACTGCTGTTTGGAGCCATACCGATTTTCTTTCTACAGATGTGGGTCGGCCTGGCGATCGCCGTGTTTGGTGTTTTTTTAATGGTGCAGACCGCCATTATCAAACTCAGCTTTACGGCCACCGCGTTGGAAGTGTACCGTGGGAGCAAGTTAATTCGTTCTTTTCCTTACACAGAGTGGCAAAACTGGCGAATCTTTTGGGAACCCGCTCCCATTTTGTTTTATTTTAAAGAGGTCAAGAGCATCCATTTTTTGCCGATTATCTTTGACCCCGGCACCCTCAAAGCTTGTCTTGAGCGCCATTGTCCCCTCCAGTCCCTACGTGCGGAATGA

Protein

MASTPIQSEARTDLEPSFVIPLVLLFGAIPIFFLQMWVGLAIAVFGVFLMVQTAIIKLSFTATALEVYRGSKLIRSFPYTEWQNWRIFWEPAPILFYFKEVKSIHFLPIIFDPGTLKACLERHCPLQSLRAE