Your browser is old and dusty. Try Google Chrome!

Details for slr0729

ORF slr0729
Accession NP_439995.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -209 -195 16.9125 0.0972
NP_441061.1_2 Forward -208 -194 7.86607 0.0956
NP_441061.1_2 Forward -385 -371 7.27608 0.104
NP_441061.1_2 Reverse -201 -215 5.80112 0.13
NP_441061.1_2 Forward -16 -2 1.57289 0.186
NP_441061.1_2 Forward -301 -287 0.687908 0.202
NP_441061.1_2 Forward -307 -293 -0.000409212 0.219
NP_440795.1_7 Forward -208 -201 14.6904 0.0123
NP_440795.1_7 Reverse -201 -208 14.6904 0.0123
NP_441418.1_6 Forward -209 -190 -0.39387 0.0102
NP_441418.1_6 Reverse -200 -219 -29.6965 0.234
NP_440897.1_6 Reverse -200 -219 1.96529 0.17
NP_441453.1_4 Reverse -200 -208 16.539 0.00633
NP_441453.1_4 Forward -209 -201 16.539 0.00633
NP_441453.1_4 Forward -53 -45 4.14932 0.264
NP_442151.1_6 Reverse -200 -214 9.63603 0.142
NP_442151.1_6 Reverse -343 -357 5.99778 0.253
NP_440561.1_4 Forward -304 -285 11.5571 0.285
NP_441818.1_1 Forward -22 -11 10.7762 0.224
NP_441818.1_9 Reverse -14 -33 -9.14533 0.287
NP_441465.1_8 Forward -57 -39 14.2771 0.139
NP_441630.1_3 Forward -217 -198 3.24438 0.203
NP_440150.1_6 Forward -212 -193 6.88262 0.223
NP_442655.1_2 Reverse -4 -23 2.0644 0.278
NP_442173.1_1 Forward -208 -200 15.4574 0.00633
NP_442173.1_1 Reverse -201 -209 15.4574 0.00633
NP_442752.1_4 Forward -209 -202 13.8055 0.0199
NP_442752.1_4 Reverse -200 -207 13.8055 0.0199
NP_442752.1_4 Reverse -14 -21 10.8555 0.0846
NP_442752.1_4 Forward -163 -156 10.5605 0.1
NP_442752.1_4 Forward -197 -190 7.90559 0.144
NP_443027.1_4 Forward -211 -201 13.943 0.0452
NP_443027.1_4 Reverse -198 -208 11.8781 0.0872
NP_441812.1_3 Reverse -199 -213 11.406 0.21
NP_442975.1_10 Forward -213 -199 4.32555 0.245
NP_440784.1_7 Forward -208 -201 15.9687 0.0123
NP_440784.1_7 Reverse -201 -208 15.9687 0.0123
NP_440061.1_9 Reverse -42 -56 7.66879 0.198
NP_440110.1_9 Reverse -379 -397 20.9636 0.212
NP_442062.1_8 Forward -209 -199 19.4496 0.000558
NP_442062.1_8 Reverse -200 -210 19.4496 0.000558
NP_442062.1_8 Forward -53 -43 14.4347 0.0134
NP_442062.1_8 Forward -46 -36 3.71661 0.256
NP_440761.1_4 Forward -214 -195 -13.6686 0.257
NP_441859.1_3 Forward -210 -191 7.57013 0.157
NP_441859.1_3 Reverse -199 -218 4.22689 0.228
NP_440304.1_4 Forward -211 -201 9.91146 0.051
NP_440304.1_4 Reverse -12 -22 7.55152 0.109
NP_440304.1_4 Reverse -291 -301 6.46988 0.155
NP_440304.1_4 Reverse -198 -208 1.84832 0.299
NP_442242.1_4 Forward -208 -201 14.3954 0.0124
NP_442242.1_4 Reverse -201 -208 14.3954 0.0124
NP_440044.1_8 Reverse -201 -220 -2.95047 0.274
NP_442181.1_1 Reverse -153 -172 9.93088 0.288
NP_439918.1_2 Forward -227 -208 -4.32711 0.274
NP_440307.1_10 Forward -164 -145 12.8808 0.266
NP_441594.1_6 Reverse -328 -347 3.73603 0.225
NP_441594.1_6 Reverse -191 -210 3.04771 0.238
NP_441594.1_6 Reverse -284 -303 1.0811 0.274
NP_441594.1_6 Reverse -340 -359 -0.197208 0.298
NP_442110.1_7 Reverse -200 -214 0.491246 0.259
NP_440856.1_4 Reverse -193 -212 6.98095 0.0725
NP_441083.1_5 Forward -209 -199 11.3864 0.0159
NP_441083.1_5 Reverse -200 -210 11.3864 0.0159
NP_441083.1_5 Forward -23 -13 6.96153 0.0717
NP_441083.1_5 Reverse -154 -164 4.69992 0.134
NP_441434.1_7 Reverse -202 -216 3.14618 0.259
NP_441738.1_2 Forward -207 -200 15.28 0.0102
NP_441738.1_2 Reverse -202 -209 15.28 0.0102
NP_441955.1_8 Reverse -194 -211 16.4601 0.157
NP_441955.1_8 Forward -215 -198 10.1669 0.255
NP_440209.1_1 Reverse -200 -208 18.1123 0.00295
NP_440209.1_1 Forward -209 -201 18.1123 0.00295
NP_442889.1_8 Forward -212 -198 3.8339 0.273
NP_442889.1_8 Reverse -204 -218 3.44058 0.278
NP_442889.1_8 Reverse -238 -252 3.34225 0.281
NP_440659.1_5 Reverse -364 -383 12.1925 0.216
NP_442570.1_3 Forward -304 -285 -3.54046 0.222
NP_441025.1_10 Reverse -244 -260 17.0698 0.101
NP_441716.1_1 Forward -209 -195 7.9644 0.153
NP_441716.1_1 Forward -374 -360 4.32615 0.256
NP_442111.1_4 Forward -210 -196 12.7826 0.042
NP_442111.1_4 Reverse -153 -167 4.81781 0.189
NP_442111.1_4 Forward -24 -10 3.63784 0.236
NP_441624.1_7 Reverse -371 -385 11.996 0.201
NP_441163.1_1 Reverse -329 -346 4.0697 0.294
NP_440906.1_5 Forward -208 -201 15.8704 0.0124
NP_440906.1_5 Reverse -201 -208 15.8704 0.0124
NP_440747.1_10 Reverse -197 -209 17.0502 0.000794
NP_440747.1_10 Forward -212 -200 -2.02597 0.0196
NP_440747.1_10 Forward -56 -44 -12.3507 0.27
NP_441130.1_10 Reverse -198 -212 18.2892 0.0142
NP_441130.1_10 Forward -211 -197 11.8976 0.104
NP_441486.1_1 Forward -212 -198 3.73617 0.0553
NP_441486.1_1 Forward -56 -42 0.392915 0.138
NP_441486.1_1 Reverse -197 -211 -5.21195 0.226
NP_442634.1_4 Forward -211 -197 -2.85201 0.156
NP_442634.1_4 Reverse -198 -212 -3.34366 0.161
NP_440403.1_4 Reverse -191 -210 -4.81876 0.213
NP_440403.1_10 Reverse -334 -353 2.3594 0.279
NP_440842.1_5 Reverse -213 -232 14.2289 0.269
NP_440057.1_1 Reverse -377 -396 15.7324 0.138
NP_442848.1_5 Reverse -286 -304 -1.84914 0.276
NP_441012.1_4 Reverse -46 -59 13.7856 0.209
NP_441012.1_4 Reverse -289 -302 7.09911 0.272
NP_443018.1_3 Forward -208 -201 14.8871 0.0123
NP_443018.1_3 Reverse -201 -208 14.8871 0.0123
NP_443018.1_3 Forward -52 -45 10.7572 0.0907
NP_443018.1_3 Forward -22 -15 10.4622 0.103
NP_443018.1_3 Forward -45 -38 6.62729 0.168
NP_443018.1_3 Reverse -45 -52 4.56234 0.241
NP_443018.1_3 Reverse -15 -22 4.36568 0.254
NP_441316.1_7 Reverse -198 -213 -3.16669 0.273
NP_441634.1_8 Reverse -198 -212 15.0442 0.0248
NP_441634.1_8 Forward -298 -284 1.86788 0.178
NP_441634.1_8 Forward -55 -41 -4.62196 0.295
NP_440376.1_1 Forward -209 -200 19.4693 0.000692
NP_440376.1_1 Reverse -200 -209 19.4693 0.000692
NP_440376.1_1 Reverse -44 -53 6.48957 0.0963
NP_440376.1_1 Forward -53 -44 6.19458 0.109
NP_440376.1_1 Forward -199 -190 3.93297 0.188
NP_440376.1_1 Reverse -14 -23 2.75299 0.215
NP_441857.1_5 Forward -216 -198 5.72234 0.2
NP_441588.1_4 Reverse -202 -212 6.96153 0.178
NP_442730.1_8 Forward -310 -291 13.3716 0.139
NP_442687.1_7 Forward -210 -200 15.8113 0.0125
NP_442687.1_7 Reverse -199 -209 15.8113 0.0125
NP_442687.1_7 Forward -136 -126 10.5014 0.0994
NP_442687.1_7 Reverse -36 -46 6.56821 0.159
NP_442687.1_7 Reverse -43 -53 6.37155 0.171
NP_442687.1_7 Forward -54 -44 4.60159 0.243
NP_442191.1_4 Reverse -191 -205 13.514 0.144
NP_442191.1_4 Forward -208 -194 11.3809 0.262
NP_441797.1_7 Reverse -373 -391 11.1305 0.286
NP_442485.1_3 Reverse -332 -351 2.94938 0.207
NP_442485.1_3 Reverse -189 -208 1.96607 0.216
NP_442485.1_3 Forward -211 -192 0.982764 0.234
NP_442946.1_7 Forward -55 -40 12.7079 0.284
NP_441846.1_10 Reverse -13 -32 -22.125 0.257
NP_440642.1_10 Forward -298 -284 2.35894 0.277
NP_441422.1_7 Reverse -198 -215 -2.61609 0.218
NP_441029.1_3 Reverse -329 -348 2.3594 0.277
NP_440533.1_9 Forward -209 -190 6.78429 0.189
NP_441950.1_7 Forward -349 -330 -7.37537 0.278
NP_440360.1_5 Reverse -334 -353 -4.81876 0.297
NP_440360.1_10 Reverse -202 -216 3.8345 0.227
NP_440360.1_10 Reverse -339 -353 2.85119 0.261
NP_442658.1_1 Forward -211 -201 18.7607 0.00222
NP_442658.1_1 Reverse -198 -208 17.0891 0.00615
NP_442658.1_1 Reverse -42 -52 13.4509 0.0397
NP_442658.1_1 Reverse -285 -295 13.1559 0.04
NP_442658.1_1 Reverse -291 -301 6.37109 0.231
NP_442198.1_3 Forward -221 -202 2.55606 0.299
NP_440141.1_4 Forward -389 -370 -7.37537 0.298
NP_440141.1_8 Reverse -328 -347 4.32602 0.291
NP_441855.2_4 Reverse -207 -226 9.33025 0.282
NP_442782.1_2 Reverse -287 -301 3.44117 0.265
NP_442782.1_2 Forward -301 -287 2.16287 0.277
NP_442782.1_2 Forward -209 -195 0.786239 0.284
NP_442782.1_7 Forward -171 -152 -0.885524 0.29
NP_441414.1_9 Reverse -200 -219 4.916 0.0504
NP_441414.1_9 Forward -209 -190 -8.65367 0.242
NP_441487.1_9 Forward -54 -35 2.45773 0.18
NP_441958.1_5 Forward -210 -200 12.2714 0.00183
NP_441958.1_5 Reverse -199 -209 12.2714 0.00183
NP_441958.1_5 Reverse -13 -23 -0.609952 0.215
NP_441958.1_5 Reverse -36 -46 -1.29827 0.236
NP_441127.1_1 Reverse -284 -298 10.6193 0.244
NP_441127.1_5 Reverse -369 -388 16.3861 0.274
NP_440318.1_1 Forward -343 -324 0.294447 0.296
NP_440318.1_3 Reverse -80 -99 6.88262 0.281
NP_442836.1_5 Forward -59 -40 8.35759 0.144
NP_440203.1_5 Forward -20 -10 13.2542 0.122
NP_440203.1_5 Forward -26 -16 10.501 0.224
NP_439905.1_1 Reverse -201 -214 11.6223 0.204
NP_440984.1_7 Forward -214 -200 20.0591 0.00473
NP_440984.1_7 Reverse -39 -53 4.52282 0.299
NP_439990.1_5 Forward -307 -294 8.86907 0.158
NP_442911.1_2 Reverse -190 -209 1.67108 0.0571
NP_442911.1_2 Forward -219 -200 -1.47551 0.086
NP_442911.1_2 Reverse -4 -23 -10.7186 0.286
NP_440153.1_5 Forward -342 -328 9.43936 0.125
NP_440153.1_5 Forward -208 -194 0.786239 0.289
NP_442119.1_9 Reverse -199 -218 11.4058 0.245
NP_442064.1_4 Reverse -190 -209 6.68515 0.246
NP_443055.1_6 Forward -46 -28 5.32826 0.179
NP_443055.1_6 Reverse -36 -54 0.805058 0.239
NP_443055.1_6 Forward -70 -52 0.608397 0.241
NP_440993.1_2 Reverse -195 -211 3.69678 0.256
NP_440827.1_3 Reverse -282 -301 11.9958 0.262
NP_440827.1_3 Forward -198 -179 10.4225 0.298
NP_440496.1_1 Reverse -160 -179 2.26107 0.269
NP_440496.1_9 Reverse -371 -390 -4.13045 0.263
NP_440138.1_6 Forward -208 -189 2.55527 0.267
NP_441348.1_3 Reverse -319 -338 10.7175 0.195
NP_441099.1_5 Forward -21 -2 -9.34199 0.219
NP_441099.1_5 Reverse -190 -209 -11.6036 0.287
NP_442002.1_9 Forward -210 -203 10.7572 0.185
NP_442002.1_9 Reverse -199 -206 10.7572 0.185
NP_440411.1_7 Forward -301 -282 18.9773 0.0838
NP_441646.1_1 Reverse -193 -212 9.14423 0.137
NP_442438.1_10 Forward -214 -200 11.111 0.0463
NP_442438.1_10 Reverse -195 -209 2.94952 0.168
NP_442431.1_10 Forward -212 -194 -0.570838 0.29
NP_441000.1_6 Forward -210 -196 5.80112 0.0933
NP_441000.1_6 Reverse -199 -213 4.81781 0.0933
NP_441000.1_6 Reverse -43 -57 -5.50694 0.279
NP_442771.1_1 Forward -211 -193 -6.07737 0.166
NP_440147.1_4 Reverse -198 -211 18.1122 0.00478
NP_440147.1_4 Forward -211 -198 9.75405 0.0371
NP_440147.1_4 Reverse -42 -55 6.70579 0.0856
NP_441550.1_8 Forward -211 -201 10.501 0.066
NP_441550.1_8 Reverse -198 -208 8.82935 0.112
NP_441550.1_8 Forward -25 -15 5.28945 0.255
NP_441916.1_7 Forward -209 -199 18.4663 0.00144
NP_441916.1_7 Reverse -200 -210 18.4663 0.00144
NP_441916.1_7 Reverse -44 -54 5.97822 0.111
NP_441916.1_10 Reverse -285 -304 3.73603 0.227
NP_440206.1_10 Reverse -283 -302 13.6675 0.288
NP_440465.1_4 Reverse -199 -218 14.0608 0.184
NP_441041.1_4 Forward -209 -190 -9.14533 0.213
NP_441041.1_4 Reverse -8 -27 -9.53865 0.218
NP_441041.1_4 Forward -307 -288 -10.1286 0.228
NP_441041.1_4 Reverse -287 -306 -11.0136 0.239
NP_441041.1_7 Forward -212 -200 19.5648 0.00277
NP_441041.1_7 Reverse -197 -209 14.6087 0.0342
NP_441041.1_7 Reverse -41 -53 5.76558 0.241
NP_440016.1_9 Reverse -194 -213 10.8159 0.259
NP_443063.1_2 Reverse -335 -354 6.39097 0.283
NP_443063.1_7 Reverse -43 -59 20.8064 0.0658
NP_443063.1_7 Forward -210 -194 4.87675 0.288
NP_442996.1_8 Reverse -334 -353 18.6823 0.0928
NP_441725.1_4 Reverse -195 -209 13.372 0.0693
NP_441725.1_5 Reverse -201 -211 9.02648 0.0553
NP_441725.1_5 Forward -22 -12 8.63316 0.0621
NP_441725.1_5 Forward -208 -198 2.04498 0.115
NP_439966.1_7 Reverse -198 -208 17.9741 0.00631
NP_439966.1_7 Forward -211 -201 17.4824 0.00636
NP_439966.1_7 Forward -25 -15 10.8943 0.0794
NP_439966.1_7 Forward -55 -45 4.50281 0.269
NP_439966.1_9 Forward -211 -202 10.7178 0.0863
NP_439966.1_9 Reverse -51 -60 4.42462 0.253
NP_439966.1_9 Reverse -198 -207 0.884706 0.253
NP_440736.1_3 Forward -55 -36 1.37609 0.282
NP_440202.1_8 Forward -61 -42 14.4749 0.236
NP_442941.1_3 Forward -208 -198 10.7964 0.0116
NP_442941.1_3 Reverse -201 -211 2.53664 0.14
NP_440289.1_2 Forward -212 -199 12.999 0.0132
NP_440289.1_2 Reverse -197 -210 4.44418 0.0668
NP_440289.1_2 Forward -26 -13 -3.81562 0.271
NP_440983.1_2 Forward -67 -48 7.37428 0.289
NP_440983.1_5 Reverse -340 -359 -3.14714 0.236
NP_440983.1_5 Reverse -331 -350 -4.32711 0.257
NP_440260.1_8 Forward -225 -207 -0.177514 0.206
NP_442281.1_1 Reverse -195 -209 20.0584 0.00217
NP_442281.1_1 Forward -214 -200 17.1085 0.00656
NP_442281.1_1 Reverse -39 -53 14.9452 0.0151
NP_442281.1_1 Reverse -288 -302 4.42388 0.195
NP_442281.1_1 Forward -28 -14 4.22722 0.203
NP_442281.1_1 Forward -51 -37 1.96562 0.282
NP_441334.1_7 Forward -211 -192 -18.6834 0.275
NP_442256.1_2 Forward -211 -193 -9.22396 0.254
NP_440437.1_1 Reverse -194 -213 11.3075 0.0411
NP_442012.1_1 Forward -215 -196 1.47442 0.215
NP_441087.1_6 Reverse -72 -90 -1.16155 0.264
NP_443030.1_4 Forward -308 -289 -7.67036 0.299
NP_441644.1_6 Forward -23 -13 10.9926 0.058
NP_441644.1_6 Forward -209 -199 10.1076 0.0628
NP_441644.1_6 Reverse -200 -210 10.1076 0.0628
NP_441644.1_6 Forward -53 -43 4.40448 0.239
NP_441644.1_6 Reverse -14 -24 4.01116 0.253
NP_441644.1_6 Forward -385 -375 3.42118 0.282
NP_443049.1_6 Reverse -13 -23 14.9591 0.114
NP_440867.1_7 Forward -243 -225 13.2938 0.299
NP_442215.1_2 Reverse -368 -384 -0.334789 0.166
NP_442215.1_2 Forward -55 -39 -0.924775 0.175
NP_442215.1_2 Reverse -198 -214 -2.30141 0.195
NP_442215.1_2 Forward -211 -195 -3.28472 0.213
NP_442029.1_10 Reverse -192 -211 7.37428 0.264
NP_440253.1_2 Reverse -200 -218 2.96908 0.126
NP_440253.1_2 Forward -209 -191 0.314141 0.191
NP_440929.1_8 Forward -209 -200 19.2726 0.000701
NP_440929.1_8 Reverse -200 -209 19.2726 0.000701
NP_442933.1_1 Forward -282 -263 7.30471 0.253
NP_442933.1_10 Forward -209 -200 17.601 0.00325
NP_442933.1_10 Reverse -200 -209 17.601 0.00325
NP_442933.1_10 Reverse -44 -53 4.52295 0.24
NP_441095.1_6 Forward -74 -55 7.57094 0.262
NP_441751.2_8 Forward -208 -194 -1.5737 0.129
NP_441751.2_8 Reverse -201 -215 -5.40861 0.206
NP_442554.1_8 Reverse -201 -211 16.008 0.0065
NP_442554.1_8 Forward -208 -198 14.1397 0.0144
NP_442554.1_8 Reverse -15 -25 4.0116 0.2
NP_442554.1_8 Reverse -45 -55 3.91327 0.203
NP_442554.1_8 Forward -22 -12 3.91327 0.203
NP_442554.1_8 Forward -52 -42 2.92996 0.249
NP_441762.1_7 Reverse -199 -211 21.5735 0.00342
NP_441762.1_7 Forward -210 -198 12.1337 0.0142
NP_441762.1_7 Forward -54 -42 -0.354346 0.0772
NP_441762.1_7 Reverse -333 -345 -7.33585 0.287
NP_441762.1_7 Reverse -43 -55 -7.33585 0.287
NP_442313.1_5 Forward -301 -282 9.83255 0.191
NP_442142.1_4 Reverse -197 -210 17.7182 0.0255
NP_442142.1_4 Forward -212 -199 16.4399 0.0264
NP_442142.1_4 Reverse -41 -54 5.0336 0.204
NP_442142.1_4 Forward -56 -43 4.83694 0.209
NP_442142.1_4 Reverse -343 -356 4.44361 0.222
NP_442142.1_4 Reverse -346 -359 2.67367 0.281
NP_442142.1_9 Forward -216 -197 2.45773 0.282
NP_442292.1_1 Forward -208 -199 9.63616 0.0183
NP_442292.1_1 Reverse -201 -210 9.63616 0.0183
NP_442292.1_1 Reverse -257 -266 2.16301 0.227
NP_440122.1_2 Reverse -369 -388 0.982764 0.259
NP_442476.1_6 Reverse -201 -215 7.57108 0.112
NP_442476.1_6 Forward -208 -194 1.08123 0.231
NP_442381.1_8 Forward -212 -193 13.7658 0.0192
NP_443009.1_5 Reverse -199 -210 11.6612 0.0602
NP_443009.1_5 Forward -210 -199 11.6612 0.0602
NP_443009.1_5 Forward -54 -43 5.66304 0.193
NP_442406.1_9 Reverse -37 -56 0.196116 0.291
NP_442301.1_2 Reverse -333 -352 9.93006 0.2
NP_442301.1_2 Reverse -330 -349 8.25844 0.23
NP_441715.1_4 Forward -208 -198 18.8596 0.00741
NP_441715.1_4 Reverse -201 -211 9.32148 0.097
NP_440279.1_6 Reverse -19 -38 5.30933 0.28
NP_440183.1_3 Forward -264 -245 18.822 0.143
NP_440183.1_9 Forward -60 -41 -18.8801 0.276
NP_441198.1_8 Reverse -291 -301 11.1228 0.222
NP_441468.1_1 Forward -208 -201 15.8704 0.0124
NP_441468.1_1 Reverse -201 -208 15.8704 0.0124
NP_441468.1_1 Reverse -45 -52 4.07068 0.263
NP_441468.1_1 Reverse -15 -22 4.07068 0.263
NP_441020.2_6 Forward -211 -194 23.0483 0.00142
NP_441020.2_6 Reverse -198 -215 10.8552 0.133
NP_441020.2_6 Reverse -12 -29 5.9387 0.284
NP_441015.1_10 Forward -348 -329 -4.52377 0.205
NP_441015.1_10 Forward -214 -195 -11.3086 0.294
NP_441015.1_10 Forward -211 -192 -11.6036 0.298
NP_441673.1_1 Forward -209 -200 20.8459 0.000698
NP_441673.1_1 Reverse -200 -209 20.8459 0.000698
NP_441673.1_1 Reverse -44 -53 1.37636 0.114
NP_441673.1_1 Forward -53 -44 1.1797 0.163
NP_441673.1_1 Reverse -334 -343 -8.06341 0.254
NP_441731.1_3 Reverse -192 -211 -6.39206 0.29
NP_442253.1_5 Forward -202 -185 -3.79607 0.292
NP_441826.1_2 Forward -215 -201 4.52282 0.102
NP_441826.1_2 Forward -169 -155 2.5562 0.125
NP_441826.1_2 Reverse -194 -208 1.96621 0.137
NP_441826.1_2 Forward -59 -45 -4.52363 0.296
NP_442490.1_9 Forward -209 -190 2.3594 0.165
NP_442490.1_9 Forward -221 -202 -1.08219 0.179
NP_442868.1_6 Reverse -198 -208 10.3048 0.038
NP_442868.1_6 Forward -211 -201 8.53483 0.0555
NP_442361.1_3 Reverse -194 -207 8.08242 0.285
NP_442808.1_1 Forward -210 -200 18.4657 0.00201
NP_442808.1_1 Reverse -199 -209 18.4657 0.00201
NP_442808.1_1 Forward -24 -14 7.15773 0.086
NP_442808.1_1 Forward -54 -44 6.56775 0.107
NP_442808.1_1 Reverse -333 -343 6.0761 0.131
NP_440145.1_3 Reverse -34 -53 -2.65548 0.176
NP_442542.1_2 Forward -211 -198 10.4424 0.126
NP_442542.1_9 Forward -216 -202 11.1104 0.111
NP_442113.1_10 Reverse -339 -358 -7.08038 0.265
NP_442050.1_5 Forward -211 -201 8.23937 0.234
NP_442050.1_5 Reverse -198 -208 6.96107 0.27
NP_441114.1_3 Forward -51 -42 7.37455 0.239
NP_440558.1_2 Forward -305 -286 11.5042 0.0836
NP_440558.1_2 Reverse -283 -302 5.30933 0.145
NP_440558.1_2 Reverse -191 -210 -5.11376 0.253
NP_442789.1_4 Forward -211 -192 -3.3438 0.25
NP_441878.1_6 Forward -210 -200 10.4031 0.0176
NP_441878.1_6 Reverse -199 -209 10.4031 0.0176
NP_441878.1_6 Reverse -43 -53 2.24165 0.0462
NP_441878.1_6 Reverse -13 -23 1.74999 0.0642
NP_441878.1_6 Forward -54 -44 1.16001 0.11
NP_441036.1_8 Forward -210 -200 17.7779 0.000554
NP_441036.1_8 Reverse -199 -209 17.7779 0.000554
NP_441036.1_8 Reverse -279 -289 10.0098 0.174
NP_441036.1_8 Reverse -9 -19 8.1415 0.176
NP_441557.1_5 Forward -209 -200 19.9609 0.000699
NP_441557.1_5 Reverse -200 -209 19.9609 0.000699
NP_441557.1_5 Reverse -44 -53 0.491382 0.144
NP_441557.1_5 Forward -53 -44 0.29472 0.174
NP_441445.1_8 Reverse -162 -181 -3.93378 0.277
NP_442066.2_4 Reverse -200 -219 -0.590531 0.177
NP_442066.2_9 Forward -213 -200 17.9155 0.0209
NP_442419.1_3 Reverse -348 -367 13.8641 0.289
NP_441308.1_8 Forward -211 -201 9.22315 0.226
NP_440101.1_3 Forward -214 -195 10.2259 0.126
NP_440101.1_3 Forward -348 -329 5.11266 0.202
NP_441458.1_10 Reverse -191 -210 12.9791 0.0856
NP_441458.1_10 Forward -218 -199 3.6377 0.244
NP_442183.1_1 Reverse -200 -214 12.8809 0.05
NP_442183.1_1 Forward -209 -195 10.3243 0.0857
NP_442183.1_1 Reverse -14 -28 8.16106 0.121
NP_442166.1_7 Forward -208 -194 10.816 0.19
NP_442397.1_9 Reverse -292 -311 3.14605 0.264
NP_440356.1_2 Reverse -150 -169 -2.55715 0.28
NP_441116.1_9 Reverse -1 -15 16.7159 0.155
NP_441574.1_1 Forward -349 -330 11.2092 0.11
NP_441549.1_9 Forward -27 -9 -3.42244 0.198
NP_442347.1_2 Forward -208 -199 11.1111 0.056
NP_442347.1_2 Reverse -201 -210 11.1111 0.056
NP_442347.1_2 Forward -332 -323 3.7363 0.284
NP_442645.1_2 Forward -61 -42 -16.3235 0.23
NP_442645.1_2 Forward -304 -285 -18.2901 0.27
NP_441037.1_4 Forward -211 -201 16.2838 0.0168
NP_441037.1_4 Reverse -198 -208 6.92787 0.237
NP_441037.1_4 Forward -309 -299 6.73295 0.245
NP_441633.1_3 Reverse -198 -211 22.8321 0.00371
NP_441633.1_3 Forward -211 -198 3.65753 0.0699
NP_441633.1_3 Reverse -42 -55 0.215946 0.13
NP_441633.1_3 Forward -55 -42 -5.88057 0.236
NP_440136.1_2 Forward -208 -201 15.9687 0.0123
NP_440136.1_2 Reverse -201 -208 15.9687 0.0123
NP_440136.1_3 Reverse -28 -41 20.8655 0.26
NP_442590.1_10 Forward -314 -295 11.8975 0.15
NP_442590.1_10 Forward -392 -373 7.27595 0.23
NP_442590.1_10 Forward -59 -40 4.32602 0.276
NP_442590.1_10 Forward -215 -196 3.14605 0.295
NP_442998.1_5 Reverse -382 -392 9.32148 0.243
NP_442998.1_5 Forward -137 -127 7.84651 0.28
NP_442998.1_10 Forward -207 -200 15.5754 0.0102
NP_442998.1_10 Reverse -202 -209 15.5754 0.0102
NP_442998.1_10 Forward -21 -14 6.13563 0.181
NP_440299.1_1 Reverse -196 -209 18.1116 0.00453
NP_441799.1_1 Forward -213 -199 13.8636 0.0293
NP_441799.1_1 Forward -57 -43 8.94708 0.103
NP_441799.1_1 Reverse -196 -210 7.86545 0.13
NP_441799.1_1 Reverse -40 -54 3.8339 0.279
NP_441007.1_10 Forward -214 -201 12.999 0.0499
NP_442201.1_10 Reverse -189 -208 3.53937 0.0961
NP_440256.1_1 Reverse -197 -216 1.47442 0.0744
NP_440256.1_1 Forward -212 -193 -1.47551 0.104
NP_440256.1_1 Forward -305 -286 -6.58872 0.215
NP_440256.1_1 Forward -26 -7 -7.27704 0.232
NP_440256.1_1 Reverse -41 -60 -9.83364 0.289
NP_441957.1_1 Reverse -285 -304 7.27595 0.206
NP_441957.1_7 Forward -237 -218 14.2574 0.245
NP_442007.1_8 Reverse -199 -217 11.5231 0.258
NP_441559.1_8 Reverse -195 -209 12.291 0.0574
NP_441559.1_8 Forward -204 -190 3.93283 0.136
NP_441559.1_8 Reverse -49 -63 2.65453 0.143
NP_441559.1_8 Forward -338 -324 -3.44199 0.203
NP_441559.1_8 Forward -58 -44 -6.39192 0.277
NP_441559.1_8 Forward -57 -43 -6.88358 0.281
NP_441559.1_8 Forward -228 -214 -7.17857 0.287
NP_440915.1_5 Forward -354 -335 19.5865 0.114
NP_440915.1_6 Reverse -196 -210 12.4876 0.0208
NP_440915.1_6 Forward -213 -199 6.29277 0.0828
NP_440915.1_6 Reverse -10 -24 1.96621 0.128
NP_440915.1_6 Forward -167 -153 -0.492064 0.197
NP_440717.1_1 Reverse -201 -220 13.9625 0.159
NP_440749.1_1 Reverse -8 -27 1.57275 0.257
NP_442866.1_1 Forward -214 -195 1.67108 0.158
NP_440748.1_5 Forward -305 -286 1.86774 0.224
NP_440026.1_4 Reverse -11 -30 8.65258 0.264
NP_440026.1_4 Forward -383 -364 8.55425 0.268
NP_440695.1_5 Forward -209 -190 -0.787193 0.284
NP_441939.1_3 Reverse -201 -220 16.8141 0.035
NP_442993.1_1 Reverse -120 -136 -5.15301 0.144
NP_442993.1_1 Reverse -200 -216 -9.28291 0.181
NP_442993.1_1 Reverse -14 -30 -12.7245 0.278
NP_442386.1_5 Reverse -212 -231 3.9319 0.289
NP_442386.1_9 Reverse -199 -208 15.7322 0.0144
NP_442386.1_9 Forward -210 -201 15.7322 0.0144
NP_442386.1_9 Reverse -43 -52 9.93072 0.144
NP_442386.1_9 Reverse -286 -295 7.86578 0.215
NP_442386.1_9 Forward -54 -45 4.7192 0.289
NP_441750.1_4 Reverse -196 -215 9.63589 0.157
NP_441340.1_5 Forward -208 -201 15.6737 0.0124
NP_441340.1_5 Reverse -201 -208 15.6737 0.0124
NP_441340.1_5 Reverse -299 -306 8.8889 0.084
NP_441340.1_5 Reverse -15 -22 4.07068 0.239
NP_441340.1_5 Forward -52 -45 3.97235 0.274
NP_442186.1_6 Forward -398 -379 17.404 0.0439
NP_440327.1_6 Forward -361 -342 6.78429 0.231
NP_440161.1_3 Forward -211 -192 13.0775 0.153
NP_441134.1_6 Reverse -188 -206 7.19654 0.276
NP_440211.1_7 Forward -227 -209 9.95058 0.154
NP_440586.1_1 Forward -350 -331 3.34271 0.21
NP_440586.1_1 Forward -353 -334 -0.787193 0.237
NP_440586.1_8 Forward -208 -201 13.2151 0.026
NP_440586.1_8 Reverse -201 -208 13.2151 0.026
NP_440586.1_8 Forward -22 -15 7.61025 0.227
NP_442251.1_6 Forward -208 -201 15.2804 0.0124
NP_442251.1_6 Reverse -201 -208 15.2804 0.0124
NP_440192.1_4 Reverse -121 -140 10.8529 0.232
NP_440969.1_3 Forward -51 -33 6.31156 0.299
NP_441262.1_3 Reverse -200 -207 14.7888 0.0223
NP_441262.1_3 Forward -209 -202 14.7888 0.0223
NP_441262.1_3 Reverse -14 -21 5.25066 0.215
NP_440027.1_3 Reverse -277 -295 6.60656 0.225
NP_440027.1_3 Reverse -190 -208 2.37835 0.29
NP_440027.1_8 Forward -26 -7 8.94676 0.243
NP_443051.1_1 Reverse -199 -208 10.4228 0.00754
NP_443051.1_1 Forward -210 -201 10.4228 0.00754
NP_443051.1_1 Reverse -13 -22 5.40793 0.0926
NP_439937.1_8 Forward -211 -192 9.0459 0.19
NP_439937.1_9 Forward -24 -7 0.234807 0.103
NP_439937.1_9 Reverse -199 -216 -8.22161 0.176
NP_439937.1_9 Forward -210 -193 -10.1882 0.224
NP_442294.1_3 Forward -348 -334 12.782 0.274
NP_441740.2_10 Forward -302 -283 7.27595 0.286
NP_440439.1_1 Reverse -197 -210 17.4239 0.0105
NP_440439.1_1 Forward -212 -199 9.65572 0.0447
NP_440439.1_1 Forward -56 -43 0.0192843 0.203
NP_440372.1_2 Forward -208 -201 16.3621 0.0124
NP_440372.1_2 Reverse -201 -208 16.3621 0.0124
NP_440372.1_2 Reverse -15 -22 4.07068 0.262
NP_440574.1_6 Reverse -214 -233 14.1591 0.274
NP_440316.1_10 Reverse -13 -23 17.2863 0.153
NP_441803.1_2 Reverse -195 -214 9.3409 0.1
NP_441803.1_2 Reverse -338 -357 3.83436 0.189
NP_439977.1_5 Forward -215 -196 -2.36049 0.277
NP_439977.1_5 Reverse -194 -213 -3.14714 0.296
NP_440139.1_1 Reverse -8 -27 5.2102 0.165
NP_440139.1_1 Forward -199 -180 3.83357 0.197
NP_440139.1_1 Reverse -194 -213 0.293673 0.293
NP_441572.1_7 Forward -215 -196 5.40766 0.0876
NP_442384.1_10 Forward -209 -196 19.1938 0.00338
NP_442384.1_10 Reverse -44 -57 8.37742 0.0656
NP_442384.1_10 Reverse -200 -213 0.412608 0.291
NP_442114.1_4 Reverse -200 -211 12.1534 0.107
NP_442114.1_4 Forward -209 -198 9.20345 0.17
NP_440364.1_10 Forward -217 -198 19.5673 0.203
NP_441877.1_7 Reverse -195 -214 13.5683 0.087
NP_441018.1_7 Forward -213 -194 7.07928 0.277
NP_441018.1_7 Forward -306 -287 6.19431 0.297
NP_442790.1_4 Reverse -191 -210 0.884433 0.0876
NP_442262.1_10 Forward -208 -201 14.1988 0.0123
NP_442262.1_10 Reverse -201 -208 14.1988 0.0123
NP_442262.1_10 Forward -22 -15 10.6589 0.14
NP_442262.1_10 Forward -45 -38 10.1672 0.162
NP_442262.1_10 Forward -52 -45 9.87221 0.164
NP_442244.1_3 Reverse -203 -222 5.80098 0.238
NP_440344.1_10 Reverse -193 -210 8.29864 0.0111
NP_440344.1_10 Forward -216 -199 8.20031 0.0113
NP_440282.1_3 Reverse -287 -306 -5.31042 0.298
NP_440531.1_6 Forward -61 -42 7.96426 0.0903
NP_440531.1_6 Forward -217 -198 1.86774 0.166
NP_440531.1_6 Forward -31 -12 -4.6221 0.284
NP_440531.1_6 Forward -294 -275 -4.91709 0.29
NP_440531.1_8 Forward -348 -329 4.62101 0.269
NP_442123.1_3 Reverse -200 -219 14.4541 0.143
NP_442910.1_6 Forward -295 -281 8.16106 0.24
NP_441965.1_10 Forward -212 -196 10.4816 0.107
NP_440297.1_9 Forward -22 -12 9.51814 0.0917
NP_440297.1_9 Forward -208 -198 -0.118297 0.282
NP_440297.1_9 Reverse -201 -211 -0.216628 0.282
NP_441896.1_3 Forward -218 -199 -1.37718 0.258
NP_440894.1_7 Forward -117 -98 8.65176 0.267
NP_440894.1_10 Forward -214 -195 7.66927 0.197
NP_440894.1_10 Reverse -149 -168 2.75272 0.283
NP_440999.1_9 Forward -213 -199 11.6026 0.0438
NP_440999.1_9 Reverse -196 -210 10.9143 0.0483
NP_440999.1_9 Reverse -333 -347 2.94952 0.14
NP_440888.1_2 Reverse -200 -214 17.3052 0.00418
NP_440888.1_2 Forward -209 -195 14.2569 0.0193
NP_440888.1_2 Forward -343 -329 6.98048 0.212
NP_440888.1_2 Forward -53 -39 6.68548 0.223
NP_440888.1_2 Forward -23 -9 6.48882 0.232
NP_440600.1_4 Reverse -192 -210 -7.749 0.294
NP_440491.1_1 Reverse -34 -53 11.4975 0.17
NP_440491.1_1 Reverse -197 -216 10.5229 0.184
NP_440491.1_1 Forward -212 -193 8.67125 0.232
NP_440052.1_5 Forward -220 -201 -5.9004 0.298
NP_439969.1_3 Forward -214 -195 -1.37718 0.278
NP_442277.1_4 Forward -218 -199 10.4217 0.0949
NP_442033.1_10 Forward -211 -192 -5.21209 0.179
NP_440575.1_4 Reverse -14 -33 21.9642 0.0537
NP_441543.1_2 Forward -208 -199 18.486 0.00236
NP_441543.1_2 Reverse -201 -210 18.486 0.00236
NP_441543.1_2 Forward -52 -43 6.5879 0.143
NP_442845.1_2 Forward -343 -329 7.57108 0.195
NP_442845.1_2 Reverse -8 -22 7.37441 0.195
NP_442845.1_2 Reverse -287 -301 4.32615 0.261
NP_441319.1_5 Forward -342 -323 10.1275 0.257
NP_441319.1_6 Forward -211 -192 12.7825 0.271
NP_441319.1_8 Reverse -194 -212 4.73903 0.288
NP_440982.1_1 Reverse -371 -390 6.58682 0.294
NP_441469.1_8 Reverse -199 -208 16.126 0.00797
NP_441469.1_8 Forward -210 -201 16.126 0.00797
NP_441469.1_8 Reverse -43 -52 12.3894 0.111
NP_441469.1_8 Forward -54 -45 5.50626 0.265
NP_442315.1_1 Reverse -3 -21 8.47561 0.213
NP_442315.1_1 Forward -354 -336 7.09898 0.251
NP_443064.1_6 Reverse -154 -164 12.276 0.0946
NP_442337.1_7 Forward -225 -207 15.1621 0.214
NP_442578.1_7 Forward -208 -201 14.5921 0.026
NP_442578.1_7 Reverse -201 -208 14.5921 0.026
NP_441462.1_2 Forward -209 -199 11.5831 0.00406
NP_441462.1_2 Reverse -200 -210 11.5831 0.00406
NP_441462.1_2 Reverse -14 -24 6.46988 0.0664
NP_441621.1_7 Forward -211 -197 15.9292 0.0266
NP_441621.1_7 Reverse -198 -212 5.99778 0.068
NP_443062.1_1 Forward -209 -191 18.4917 0.0224
NP_443062.1_1 Reverse -200 -218 4.54812 0.258
NP_443062.1_1 Reverse -293 -311 3.86557 0.282
NP_443062.1_6 Reverse -192 -211 5.50599 0.204
NP_443062.1_6 Forward -217 -198 3.73603 0.229
NP_442204.1_1 Reverse -196 -207 11.5634 0.0565
NP_442204.1_1 Forward -384 -373 3.10693 0.266
NP_442204.1_5 Forward -219 -200 19.469 0.0265
NP_442204.1_5 Reverse -324 -343 4.52268 0.167
NP_441560.1_5 Reverse -31 -50 20.2556 0.199
NP_441351.1_8 Forward -55 -36 3.93269 0.228
NP_440516.1_6 Forward -62 -48 7.96378 0.258
NP_440516.1_8 Forward -209 -200 16.9127 0.00442
NP_440516.1_8 Reverse -200 -209 16.9127 0.00442
NP_440516.1_8 Reverse -14 -23 9.24284 0.0264
NP_440516.1_8 Forward -163 -154 -0.68859 0.297
NP_442428.1_5 Forward -208 -201 15.8704 0.0124
NP_442428.1_5 Reverse -201 -208 15.8704 0.0124
NP_442428.1_5 Reverse -45 -52 4.46401 0.267
NP_442428.1_5 Reverse -15 -22 4.46401 0.267
NP_441443.1_10 Forward -300 -282 4.54162 0.268
NP_442120.1_10 Reverse -287 -306 -11.5053 0.262
NP_442120.1_10 Reverse -120 -139 -14.4552 0.288
NP_440673.1_3 Forward -207 -200 12.4288 0.0426
NP_440673.1_3 Reverse -202 -209 12.4288 0.0426
NP_440673.1_3 Forward -21 -14 11.6422 0.0724
NP_440673.1_3 Forward -51 -44 8.98723 0.203
NP_440673.1_3 Forward -127 -120 5.54565 0.288
NP_440673.1_7 Forward -57 -38 1.57275 0.244
NP_440865.1_9 Forward -215 -196 -7.17871 0.244
NP_441670.1_2 Forward -373 -354 13.9625 0.286
NP_441052.1_2 Forward -209 -199 10.5014 0.0285
NP_441052.1_2 Reverse -200 -210 10.5014 0.0285
NP_442219.1_9 Forward -208 -199 8.35786 0.0681
NP_442219.1_9 Reverse -201 -210 8.35786 0.0681
NP_440436.1_4 Forward -208 -199 18.1905 0.00233
NP_440436.1_4 Reverse -201 -210 18.1905 0.00233
NP_440436.1_4 Forward -52 -43 11.9957 0.0435
NP_441884.1_8 Forward -210 -191 0.687771 0.138
NP_441884.1_9 Forward -212 -193 -4.72043 0.0594
NP_441884.1_9 Reverse -197 -216 -14.4552 0.138
NP_441884.1_9 Reverse -41 -60 -25.6649 0.29
NP_442864.1_7 Forward -199 -181 8.47561 0.274
NP_441719.1_4 Forward -208 -201 16.3621 0.0124
NP_441719.1_4 Reverse -201 -208 16.3621 0.0124
NP_441733.1_10 Forward -212 -199 19.9805 0.0151
NP_441733.1_10 Reverse -197 -210 7.6891 0.152
NP_441733.1_10 Reverse -321 -334 3.65753 0.293
NP_441004.1_1 Forward -215 -196 -9.63698 0.21
NP_441004.1_1 Forward -140 -121 -17.1101 0.289
NP_441004.1_2 Reverse -282 -301 -2.36049 0.264
NP_441004.1_4 Forward -195 -185 7.94484 0.282
NP_442813.1_4 Forward -217 -198 -5.21209 0.299
NP_442366.1_3 Forward -210 -192 9.65558 0.0543
NP_442366.1_3 Reverse -199 -217 8.18062 0.0687
NP_442366.1_3 Forward -54 -36 0.510803 0.169
NP_442366.1_3 Reverse -36 -54 -2.43913 0.228
NP_440129.1_10 Reverse -193 -207 23.599 0.0105
NP_441115.1_4 Reverse -199 -217 18.3079 0.0148
NP_441115.1_4 Forward -210 -192 9.6548 0.206
NP_442206.1_10 Forward -209 -194 12.1729 0.0896
NP_442206.1_10 Reverse -14 -29 0.471552 0.259
NP_440328.1_4 Forward -52 -33 2.0644 0.211
NP_440328.1_4 Reverse -194 -213 -0.787193 0.289
NP_443054.1_2 Reverse -198 -212 20.0591 0.0121
NP_443054.1_2 Forward -55 -41 9.2427 0.102
NP_443054.1_2 Reverse -332 -346 -0.197071 0.288
NP_442586.1_6 Forward -203 -184 15.9291 0.171
NP_442308.1_4 Reverse -194 -213 2.3594 0.267
NP_441851.1_10 Forward -210 -200 16.008 0.00552
NP_441851.1_10 Reverse -199 -209 16.008 0.00552
NP_441851.1_10 Reverse -43 -53 4.79825 0.247
NP_441851.1_10 Forward -54 -44 4.50326 0.266
NP_442208.1_5 Forward -342 -323 -8.35868 0.275
NP_441542.1_4 Forward -159 -145 4.42448 0.264
NP_442011.1_1 Forward -210 -191 4.81767 0.229
NP_442515.1_1 Reverse -199 -213 -2.16369 0.271
NP_440463.1_8 Forward -353 -334 8.2744 0.264
NP_440463.1_8 Forward -362 -343 5.56364 0.277
NP_440165.1_5 Forward -210 -191 21.3373 0.0166
NP_440940.1_7 Reverse -190 -208 5.32826 0.226
NP_441349.1_10 Reverse -190 -209 3.93269 0.0612
NP_441349.1_10 Forward -56 -37 -5.31042 0.198
NP_442314.1_1 Forward -64 -46 -5.78238 0.288
NP_440432.1_9 Reverse -201 -216 -0.118434 0.164
NP_442843.1_1 Reverse -161 -180 -9.14533 0.264
NP_442843.1_1 Reverse -15 -34 -9.14533 0.264
NP_442843.1_1 Reverse -45 -64 -9.44032 0.266
NP_442843.1_1 Reverse -377 -396 -10.7186 0.28
NP_439960.1_10 Reverse -193 -211 3.26407 0.163
NP_440474.1_8 Reverse -201 -215 17.2068 0.0432
NP_441150.1_6 Reverse -77 -96 18.7798 0.0874
NP_440431.1_3 Reverse -202 -221 -8.26035 0.229
NP_442450.1_5 Forward -165 -155 5.78156 0.227
NP_440588.1_2 Forward -218 -199 -0.000545616 0.149
NP_440588.1_2 Reverse -191 -210 -2.65548 0.17
NP_440588.1_2 Forward -62 -43 -3.54046 0.189
NP_440588.1_2 Forward -172 -153 -3.93378 0.2
NP_442006.1_2 Forward -386 -369 -15.0058 0.214
NP_442006.1_2 Reverse -35 -52 -17.0707 0.269
NP_442006.1_2 Reverse -346 -363 -17.9557 0.285
NP_440483.1_1 Reverse -345 -364 3.93269 0.154
NP_441570.1_1 Reverse -14 -32 3.3624 0.0221
NP_441570.1_1 Forward -209 -191 -0.570838 0.0486
NP_441078.1_4 Forward -209 -200 19.6659 0.0007
NP_441078.1_4 Reverse -200 -209 19.6659 0.0007
NP_441078.1_4 Reverse -44 -53 8.1612 0.039
NP_441078.1_4 Forward -53 -44 0.983037 0.151
NP_441078.1_4 Forward -343 -334 -1.27858 0.246
NP_441078.1_4 Reverse -334 -343 -1.86856 0.272
NP_441078.1_4 Reverse -14 -23 -2.06522 0.295
NP_442729.1_5 Reverse -13 -23 15.9097 0.199
NP_442729.1_8 Forward -213 -200 9.75405 0.125
NP_441663.1_8 Reverse -194 -213 8.06259 0.0936
NP_442443.1_1 Forward -351 -332 2.85105 0.177
NP_440526.1_3 Reverse -201 -212 11.7595 0.0646
NP_441432.1_8 Reverse -199 -208 8.25953 0.0755
NP_441432.1_8 Forward -210 -201 8.25953 0.0755
NP_441432.1_8 Reverse -43 -52 6.48957 0.114
NP_441432.1_8 Reverse -292 -301 5.40793 0.158
NP_441432.1_8 Reverse -13 -22 2.85133 0.281
NP_441432.1_8 Forward -302 -293 2.65466 0.292
NP_442320.1_8 Forward -215 -201 5.89945 0.0309
NP_442320.1_8 Reverse -194 -208 -3.34366 0.117
NP_442320.1_8 Reverse -38 -52 -4.7203 0.185
NP_442344.1_7 Reverse -201 -220 -7.76869 0.191
NP_442344.1_7 Forward -52 -33 -7.76869 0.191
NP_441732.1_2 Reverse -196 -212 -6.33298 0.0495
NP_441732.1_2 Reverse -330 -346 -7.41462 0.0849
NP_441732.1_2 Reverse -333 -349 -16.2644 0.165
NP_442540.1_5 Reverse -287 -306 9.34008 0.296
NP_440629.1_6 Reverse -194 -213 13.7741 0.215
NP_440685.1_6 Reverse -197 -216 15.9282 0.248
NP_442797.1_7 Forward -24 -6 5.13236 0.217
NP_440461.1_4 Forward -362 -343 24.5822 0.0151
NP_441057.1_4 Forward -347 -329 3.26407 0.244
NP_442400.1_1 Forward -56 -37 -5.01543 0.283
NP_440713.1_5 Reverse -266 -285 14.7491 0.263
NP_442489.1_7 Forward -209 -200 20.1576 0.000695
NP_442489.1_7 Reverse -200 -209 20.1576 0.000695
NP_442489.1_7 Reverse -44 -53 8.1612 0.0294
NP_442489.1_7 Forward -53 -44 7.76787 0.0518
NP_442489.1_7 Reverse -14 -23 -1.57357 0.213
NP_442489.1_7 Forward -46 -37 -1.77023 0.247
NP_442489.1_7 Reverse -37 -46 -2.16355 0.295
NP_440559.1_1 Reverse -201 -210 8.75118 0.0586
NP_440559.1_1 Forward -208 -199 8.75118 0.0586
NP_441659.2_8 Forward -209 -199 11.9764 0.0147
NP_441659.2_8 Reverse -200 -210 11.9764 0.0147
NP_441659.2_8 Forward -23 -13 4.60159 0.13
NP_441659.2_8 Forward -53 -43 0.0783647 0.277
NP_442913.1_9 Forward -52 -33 11.2092 0.199
NP_442913.1_10 Forward -218 -199 -1.7705 0.176
NP_442008.1_2 Forward -212 -193 5.80098 0.223
NP_440708.1_6 Reverse -180 -199 -0.000545616 0.188
NP_440779.1_5 Reverse -200 -217 3.97208 0.0577
NP_442346.1_5 Forward -210 -200 9.02648 0.118
NP_442346.1_5 Reverse -199 -209 9.02648 0.118
NP_442346.1_5 Reverse -43 -53 5.48657 0.243
NP_440545.1_3 Forward -213 -196 -0.944468 0.161
NP_440545.1_3 Reverse -196 -213 -1.63279 0.171
NP_440545.1_3 Forward -311 -294 -3.79607 0.212
NP_440025.1_3 Reverse -77 -91 12.547 0.264
NP_440831.1_3 Reverse -191 -210 10.0761 0.184
NP_440004.1_5 Reverse -39 -58 14.4541 0.293
NP_440486.1_6 Forward -210 -191 12.2908 0.207
NP_440459.1_2 Reverse -35 -52 14.2968 0.119
NP_441653.1_2 Reverse -189 -208 4.88249 0.252
NP_441653.1_3 Forward -221 -207 15.7325 0.229
NP_442311.1_4 Forward -357 -338 11.1109 0.127
NP_442603.1_7 Forward -209 -195 7.3738 0.208
NP_441585.1_2 Reverse -167 -186 14.1591 0.277
NP_441888.1_7 Reverse -195 -209 23.1074 0.00562
NP_441888.1_7 Forward -58 -44 12.0943 0.0743
NP_440449.1_6 Forward -217 -199 12.5354 0.114
NP_441948.1_4 Reverse -193 -211 7.68896 0.0623
NP_441948.1_4 Forward -216 -198 6.70565 0.0633
NP_440170.1_5 Reverse -190 -209 7.7676 0.142
NP_441833.1_4 Forward -208 -201 15.9687 0.0124
NP_441833.1_4 Reverse -201 -208 15.9687 0.0124
NP_442060.1_5 Forward -350 -331 15.8307 0.235
NP_442699.1_8 Reverse -375 -394 -12.4886 0.253
NP_442162.1_9 Forward -208 -201 16.2637 0.0124
NP_442162.1_9 Reverse -201 -208 16.2637 0.0124
NP_440671.1_4 Forward -169 -155 5.70279 0.275
NP_442199.1_5 Reverse -192 -211 -0.0988766 0.175
NP_442140.1_3 Reverse -201 -211 17.4829 0.0159
NP_442140.1_3 Forward -208 -198 14.238 0.0486
NP_442140.1_3 Reverse -88 -98 8.82982 0.119
NP_442140.1_3 Reverse -45 -55 3.61828 0.288
NP_440875.1_9 Reverse -202 -212 17.619 0.0104
NP_440875.1_9 Forward -207 -197 17.327 0.0126
NP_440875.1_9 Reverse -46 -56 10.1241 0.231
NP_440875.1_9 Forward -383 -373 9.83208 0.233
NP_440875.1_9 Reverse -373 -383 8.85871 0.233
NP_441813.1_5 Reverse -198 -208 19.4496 0.00647
NP_441813.1_5 Forward -211 -201 10.0098 0.0208
NP_441813.1_5 Forward -25 -15 2.92996 0.181
NP_441813.1_5 Forward -55 -45 -0.216628 0.237
NP_441227.1_7 Reverse -299 -318 20.168 0.122
NP_441259.1_8 Reverse -371 -390 11.2084 0.264
NP_440590.1_4 Reverse -201 -214 12.0157 0.0166
NP_440590.1_4 Forward -208 -195 6.4108 0.0575
NP_440590.1_4 Reverse -325 -338 4.24752 0.0627
NP_440590.1_4 Reverse -38 -51 -0.570702 0.192
NP_440567.1_1 Reverse -201 -215 17.1092 0.0153
NP_440567.1_1 Forward -208 -194 6.29277 0.085
NP_440567.1_1 Forward -22 -8 -0.295402 0.276
NP_442497.1_10 Forward -208 -199 10.4228 0.0087
NP_442497.1_10 Reverse -201 -210 10.4228 0.0087
NP_442497.1_10 Forward -22 -13 0.196389 0.208
NP_440821.1_4 Forward -211 -201 18.7612 0.00422
NP_440821.1_4 Reverse -198 -208 10.2065 0.0163
NP_440821.1_4 Reverse -12 -22 0.373358 0.18
NP_441239.1_9 Forward -211 -199 18.6235 0.0114
NP_441239.1_9 Reverse -198 -210 16.7552 0.0157
NP_441239.1_9 Forward -25 -13 14.6903 0.0258
NP_441239.1_9 Reverse -42 -54 12.527 0.0463
NP_441239.1_9 Forward -55 -43 8.29878 0.137
NP_441239.1_9 Reverse -374 -386 5.93884 0.202
NP_441009.1_4 Reverse -287 -306 9.53756 0.3
NP_441009.1_7 Reverse -13 -32 14.2574 0.186
NP_441727.1_7 Reverse -212 -231 14.3558 0.181
NP_441892.1_1 Reverse -191 -208 0.727158 0.163
NP_441892.1_1 Forward -202 -185 -0.551145 0.187
NP_441892.1_1 Forward -32 -15 -5.07437 0.273
NP_440665.1_1 Reverse -340 -359 -16.7168 0.293
NP_440665.1_1 Forward -361 -342 -17.0118 0.297
NP_440604.1_6 Reverse -200 -219 2.0644 0.145
NP_440604.1_6 Forward -209 -190 -0.39387 0.178
NP_442193.1_3 Forward -227 -208 15.4039 0.294
NP_441526.1_6 Forward -354 -335 2.94938 0.271
NP_440949.1_7 Reverse -279 -298 14.5516 0.182
NP_442138.1_10 Forward -209 -190 7.57094 0.0661
NP_440412.1_2 Forward -399 -380 5.70265 0.283
NP_440546.1_4 Reverse -14 -24 15.0878 0.0459
NP_440546.1_4 Forward -209 -199 11.8882 0.0679
NP_440546.1_4 Reverse -200 -210 11.8882 0.0679
NP_440546.1_4 Forward -380 -370 6.45857 0.296
NP_440546.1_6 Forward -353 -334 15.4374 0.137
NP_440462.1_6 Forward -211 -201 17.9746 0.00578
NP_440462.1_6 Reverse -198 -208 17.2863 0.00752
NP_440462.1_6 Forward -25 -15 3.12662 0.26
NP_440868.1_4 Forward -213 -201 12.0354 0.0254
NP_440868.1_4 Reverse -196 -208 10.5604 0.0364
NP_440868.1_4 Forward -57 -45 2.49725 0.153
NP_440868.1_8 Forward -213 -194 5.50599 0.103
NP_441204.1_1 Forward -395 -376 5.70265 0.296
NP_442882.1_7 Reverse -193 -207 11.7003 0.261
NP_442882.1_7 Forward -216 -202 11.2087 0.261
NP_440843.1_8 Reverse -287 -306 13.3725 0.297
NP_442039.1_4 Forward -208 -201 15.1821 0.0124
NP_442039.1_4 Reverse -201 -208 15.1821 0.0124
NP_442696.1_2 Reverse -199 -217 10.4422 0.205
NP_442837.1_3 Forward -208 -201 15.7721 0.0124
NP_442837.1_3 Reverse -201 -208 15.7721 0.0124
NP_442053.1_1 Forward -209 -200 18.3876 0.0007
NP_442053.1_1 Reverse -200 -209 18.3876 0.0007
NP_442053.1_1 Forward -23 -14 4.62128 0.235
NP_440505.1_3 Reverse -198 -208 15.9097 0.00857
NP_440505.1_3 Forward -211 -201 14.1397 0.0235
NP_440505.1_7 Reverse -196 -215 8.25926 0.162
NP_442360.1_5 Reverse -377 -387 13.4514 0.278
NP_441701.1_3 Forward -305 -288 12.9202 0.204
NP_440207.2_2 Reverse -335 -354 15.775 0.28
NP_441203.1_1 Reverse -179 -198 -17.6018 0.297
NP_440914.1_1 Reverse -293 -303 10.3717 0.142
NP_440914.1_1 Reverse -14 -24 9.68861 0.178
NP_440914.1_1 Reverse -287 -297 9.10306 0.186
NP_440914.1_1 Forward -209 -199 8.6151 0.186
NP_440914.1_1 Reverse -200 -210 8.6151 0.186
NP_441011.1_8 Forward -208 -199 16.9127 0.00602
NP_441011.1_8 Reverse -201 -210 16.9127 0.00602
NP_441011.1_8 Reverse -15 -24 7.96454 0.163
NP_442533.1_1 Reverse -5 -24 -16.7168 0.275
NP_442533.1_6 Forward -209 -200 17.2076 0.00137
NP_442533.1_6 Reverse -200 -209 17.2076 0.00137
NP_442533.1_6 Forward -53 -44 8.25953 0.0776
NP_442533.1_6 Reverse -44 -53 7.66954 0.0897
NP_442533.1_6 Forward -23 -14 4.71961 0.177
NP_442533.1_6 Reverse -377 -386 1.57302 0.294
NP_442533.1_6 Forward -385 -376 1.57302 0.294
NP_442541.1_10 Forward -296 -282 2.26061 0.263
NP_442232.1_3 Forward -217 -198 -12.4886 0.282
NP_442229.1_1 Forward -211 -197 10.6187 0.18
NP_442229.1_3 Forward -92 -75 13.3135 0.283
NP_443016.1_10 Reverse -191 -210 16.3224 0.169
NP_441482.1_7 Reverse -194 -208 6.88276 0.0257
NP_439944.1_9 Reverse -201 -211 10.4031 0.0887
NP_442269.1_10 Forward -397 -378 5.50599 0.238
NP_440816.1_7 Forward -213 -194 12.9791 0.201
NP_442202.1_4 Forward -348 -334 13.7079 0.252
NP_442202.1_10 Reverse -43 -57 4.91614 0.255
NP_440115.1_6 Reverse -197 -207 7.64985 0.146
NP_440007.1_9 Reverse -289 -303 14.2576 0.163
NP_440007.1_9 Forward -167 -153 8.75105 0.171
NP_440007.1_9 Reverse -10 -24 8.35772 0.18
NP_440007.1_9 Forward -56 -42 2.94952 0.277
NP_441680.1_4 Reverse -198 -217 -0.197208 0.248
NP_441961.1_4 Forward -304 -285 6.19431 0.27
NP_441602.1_3 Forward -351 -332 -0.0988766 0.219
NP_441602.1_3 Reverse -195 -214 -1.08219 0.226
NP_441602.1_3 Forward -348 -329 -1.27885 0.226
NP_441602.1_3 Forward -214 -195 -3.14714 0.241
NP_441602.1_3 Forward -58 -39 -4.72043 0.272
NP_441972.1_5 Reverse -189 -208 11.5042 0.0535
NP_441106.1_1 Reverse -199 -208 18.191 0.0028
NP_441106.1_1 Forward -210 -201 18.191 0.0028
NP_441106.1_1 Reverse -43 -52 5.3096 0.162
NP_440429.1_2 Reverse -195 -214 6.98095 0.295
NP_439903.1_6 Forward -305 -286 0.981987 0.255
NP_441286.1_1 Reverse -199 -211 5.25052 0.0259
NP_441286.1_1 Forward -210 -198 -3.50094 0.145
NP_441286.1_1 Forward -47 -35 -4.87757 0.18
NP_442674.1_2 Forward -65 -46 7.66927 0.27
NP_440670.1_8 Forward -209 -200 18.3876 0.000699
NP_440670.1_8 Reverse -200 -209 18.3876 0.000699
NP_440670.1_8 Forward -53 -44 5.3096 0.167
NP_440670.1_8 Forward -46 -37 3.7363 0.23
NP_441479.1_1 Forward -212 -193 16.4207 0.0989
NP_441479.1_9 Forward -386 -368 14.2771 0.271
NP_441930.1_2 Reverse -53 -63 12.5664 0.258
NP_441930.1_2 Reverse -43 -53 12.2714 0.262
NP_440886.1_7 Forward -210 -200 17.7774 0.0011
NP_440886.1_7 Reverse -199 -209 17.7774 0.0011
NP_440886.1_7 Reverse -342 -352 14.6309 0.0467
NP_440886.1_7 Forward -54 -44 7.64939 0.0865
NP_440886.1_7 Forward -24 -14 6.46942 0.123
NP_440886.1_7 Reverse -43 -53 5.48612 0.181
NP_441001.1_10 Forward -353 -334 11.7992 0.249
NP_442614.1_2 Reverse -200 -214 6.3911 0.291
NP_439995.1_5 Forward -219 -200 21.8289 0.0262
NP_439995.1_7 Forward -27 -13 18.0918 0.214
NP_442072.1_9 Reverse -199 -217 -11.6822 0.0794
NP_442072.1_9 Reverse -36 -54 -23.0886 0.277
NP_440513.1_4 Forward -209 -190 10.0292 0.276
NP_441753.1_10 Reverse -5 -24 4.42435 0.198
NP_441808.1_8 Reverse -322 -341 8.45592 0.26
NP_442022.1_4 Forward -398 -379 15.0441 0.157
NP_440907.2_8 Reverse -201 -211 17.4824 0.00685
NP_440907.2_8 Forward -208 -198 7.94438 0.117
NP_440907.2_8 Forward -45 -35 4.60114 0.257
NP_440664.1_9 Reverse -103 -122 13.5691 0.172
NP_441021.1_8 Reverse -195 -213 10.8356 0.122
NP_441021.1_8 Reverse -39 -57 3.26407 0.23
NP_442459.1_8 Reverse -9 -28 8.65258 0.261
NP_441463.1_3 Reverse -190 -209 -0.590531 0.133
NP_441463.1_3 Forward -306 -287 -8.65367 0.272
NP_441463.1_3 Forward -219 -200 -8.94866 0.276
NP_441626.1_2 Forward -208 -201 15.7721 0.0124
NP_441626.1_2 Reverse -201 -208 15.7721 0.0124
NP_442365.1_5 Forward -208 -189 13.1758 0.121
NP_440107.1_2 Reverse -195 -214 8.35759 0.299
NP_440107.1_2 Forward -58 -39 7.27595 0.299
NP_440107.1_5 Reverse -193 -212 0.392778 0.178
NP_442794.1_1 Reverse -196 -208 10.4621 0.0721
NP_442615.1_1 Forward -218 -200 19.882 0.00455
NP_442615.1_1 Reverse -191 -209 -5.68405 0.22
NP_442615.1_1 Reverse -35 -53 -7.06068 0.273
NP_441962.1_4 Reverse -195 -214 -7.67036 0.192
NP_441962.1_4 Forward -214 -195 -10.3253 0.226
NP_440387.1_1 Forward -209 -193 6.9417 0.0282
NP_440387.1_1 Reverse -200 -216 -2.39974 0.147
NP_440387.1_1 Reverse -334 -350 -6.13632 0.268
NP_441431.1_2 Forward -56 -42 17.1085 0.0303
NP_441431.1_2 Reverse -197 -211 17.0102 0.0303
NP_441431.1_2 Reverse -325 -339 11.7987 0.132
NP_441431.1_2 Forward -212 -198 9.53707 0.183
NP_441836.1_1 Reverse -189 -208 17.5381 0.073
NP_441836.1_2 Forward -215 -196 -0.000545616 0.209
NP_441836.1_2 Reverse -197 -216 -5.60541 0.284
NP_440634.1_10 Reverse -331 -350 16.5182 0.124
NP_441174.1_2 Reverse -197 -211 16.9125 0.0602
NP_440467.1_3 Forward -22 -3 16.5299 0.101
NP_440114.1_10 Reverse -200 -214 14.7492 0.0346
NP_440114.1_10 Reverse -14 -28 14.7492 0.0346
NP_440114.1_10 Reverse -44 -58 10.3243 0.148
NP_440114.1_10 Forward -53 -39 9.2427 0.179
NP_440114.1_10 Forward -23 -9 6.78443 0.258
NP_442323.1_7 Forward -307 -288 7.86512 0.17
NP_441510.2_6 Reverse -190 -209 15.9282 0.132
NP_441510.2_9 Forward -208 -189 10.3242 0.165
NP_441720.1_2 Forward -300 -281 7.57013 0.213
NP_440293.1_3 Forward -303 -284 0.294447 0.221
NP_440766.1_4 Reverse -196 -210 9.04604 0.0871
NP_440766.1_4 Forward -213 -199 8.16106 0.0871
NP_440766.1_4 Forward -167 -153 0.196253 0.298
NP_439988.1_3 Forward -384 -370 6.78443 0.278
NP_439988.1_3 Reverse -372 -386 4.03116 0.296
NP_441237.1_9 Reverse -54 -64 10.8948 0.214
NP_440457.1_1 Reverse -10 -22 20.9835 0.0344
NP_440457.1_1 Reverse -196 -208 7.61046 0.101
NP_440457.1_1 Forward -167 -155 0.923956 0.25
NP_440798.1_6 Reverse -201 -214 3.85419 0.147
NP_440798.1_6 Forward -22 -9 3.75586 0.148
NP_440798.1_6 Forward -215 -202 0.60927 0.254
NP_440801.1_8 Reverse -327 -346 -0.4922 0.265
NP_441984.1_3 Reverse -33 -51 10.9339 0.184
NP_440473.1_9 Reverse -189 -208 -6.68705 0.236
NP_442509.1_9 Forward -209 -199 16.2041 0.00739
NP_442509.1_9 Reverse -200 -210 16.2041 0.00739
NP_442509.1_9 Forward -163 -153 12.3692 0.0947
NP_442514.1_5 Reverse -369 -388 3.83357 0.157
NP_440554.1_4 Forward -208 -198 16.4996 0.0189
NP_440554.1_4 Reverse -201 -211 13.943 0.0218
NP_441885.1_5 Forward -209 -199 11.4848 0.00668
NP_441885.1_5 Reverse -200 -210 11.4848 0.00668
NP_441885.1_5 Reverse -37 -47 -0.314959 0.195
NP_440478.1_10 Forward -211 -197 8.25939 0.257
NP_442341.1_7 Reverse -199 -213 18.2892 0.0111
NP_442341.1_7 Reverse -36 -50 12.4876 0.0451
NP_442341.1_7 Forward -210 -196 10.9143 0.0591
NP_442341.1_7 Reverse -333 -347 3.8345 0.21
NP_442341.1_9 Forward -25 -11 10.2254 0.136
NP_442341.1_9 Reverse -374 -388 7.96378 0.182
NP_441756.1_5 Reverse -196 -215 2.75272 0.206
NP_441173.1_9 Reverse -129 -137 12.9004 0.206
NP_441173.1_9 Reverse -130 -138 9.75379 0.284
NP_442395.2_4 Forward -210 -191 6.68515 0.144
NP_442395.2_4 Reverse -286 -305 3.83357 0.194
NP_442534.1_7 Reverse -36 -55 5.50599 0.297
NP_440409.1_1 Forward -217 -198 -3.93378 0.262
NP_440423.1_6 Reverse -29 -48 -13.3736 0.217
NP_443000.1_7 Reverse -198 -208 11.5831 0.0344
NP_443000.1_7 Forward -211 -201 2.04498 0.226
NP_440507.2_3 Reverse -191 -210 7.86512 0.268
NP_441561.1_4 Reverse -136 -155 11.2092 0.169
NP_441842.1_10 Forward -216 -202 19.1741 0.0142
NP_441842.1_10 Reverse -7 -21 15.3392 0.044
NP_440275.1_3 Forward -211 -201 17.9746 0.0082
NP_440275.1_3 Reverse -198 -208 15.418 0.0178
NP_440091.1_1 Forward -213 -201 12.6253 0.0353
NP_442275.1_1 Reverse -44 -63 7.57094 0.253
NP_441397.1_8 Forward -93 -80 13.9081 0.228
NP_441359.1_5 Reverse -197 -216 8.45592 0.167
NP_441359.1_5 Forward -56 -37 3.34271 0.253
NP_439962.1_4 Reverse -192 -211 -5.50708 0.28
NP_439962.1_4 Forward -217 -198 -8.16202 0.292
NP_442495.1_4 Reverse -375 -385 14.9263 0.156
NP_440149.1_8 Reverse -44 -63 4.81767 0.0805
NP_441105.1_3 Forward -391 -372 0.58944 0.124
NP_441105.1_3 Forward -313 -294 -0.000545616 0.131
NP_441105.1_3 Reverse -189 -208 -1.57384 0.15
NP_440216.1_1 Reverse -200 -214 8.25939 0.0061
NP_440216.1_1 Forward -209 -195 7.57108 0.00935
NP_440216.1_1 Forward -53 -39 -3.44199 0.082
NP_440216.1_1 Forward -23 -9 -4.22864 0.103
NP_440216.1_1 Reverse -44 -58 -10.9151 0.153
NP_440216.1_6 Forward -216 -200 4.58176 0.191
NP_440216.1_9 Forward -94 -85 14.651 0.172
NP_440172.1_1 Forward -209 -199 8.73149 0.0586
NP_440172.1_1 Reverse -200 -210 8.73149 0.0586
NP_440172.1_1 Reverse -14 -24 6.07655 0.115
NP_440172.1_1 Reverse -44 -54 2.7333 0.268
NP_442015.1_10 Reverse -196 -209 21.4554 0.00329
NP_442015.1_10 Reverse -330 -343 4.64084 0.166
NP_441226.1_7 Forward -208 -201 14.4934 0.0123
NP_441226.1_7 Reverse -201 -208 14.4934 0.0123
NP_441226.1_7 Forward -22 -15 11.2485 0.0971
NP_441226.1_7 Forward -336 -329 9.77352 0.131
NP_441226.1_7 Forward -192 -185 9.47853 0.147
NP_441111.1_7 Forward -208 -200 18.7023 0.00294
NP_441111.1_7 Reverse -201 -209 18.7023 0.00294
NP_441177.1_7 Reverse -361 -380 13.175 0.199
NP_441766.1_2 Forward -209 -200 17.5026 0.00297
NP_441766.1_2 Reverse -200 -209 17.5026 0.00297
NP_441766.1_2 Forward -23 -14 4.91628 0.154
NP_442417.1_5 Forward -209 -195 18.6825 0.0203
NP_442252.1_3 Forward -216 -198 9.16393 0.244
NP_440416.1_1 Reverse -14 -33 -14.7502 0.299
NP_440416.1_9 Reverse -193 -212 4.32602 0.0355
NP_440416.1_9 Forward -216 -197 2.85105 0.0381
NP_440416.1_9 Forward -303 -284 -18.5851 0.26
NP_440416.1_9 Reverse -183 -202 -20.2567 0.283
NP_443052.1_8 Forward -219 -200 2.94938 0.0531
NP_443052.1_8 Reverse -190 -209 -9.44032 0.19
NP_443052.1_8 Reverse -324 -343 -11.2103 0.224
NP_443052.1_8 Reverse -34 -53 -11.3086 0.226
NP_441135.1_4 Forward -206 -187 1.17943 0.294
NP_442403.1_9 Forward -349 -330 6.68596 0.193
NP_440591.1_9 Reverse -193 -211 5.23069 0.253
NP_442154.1_1 Forward -354 -336 -6.66736 0.141
NP_441430.1_6 Reverse -282 -301 18.3873 0.121
NP_442564.1_10 Reverse -159 -173 8.25939 0.296
NP_440261.1_5 Reverse -201 -214 8.37742 0.0263
NP_440261.1_5 Forward -208 -195 -2.63565 0.0924
NP_440261.1_5 Reverse -45 -58 -6.07724 0.193
NP_440261.1_7 Reverse -159 -178 -2.16383 0.19
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGGGCTTCATTCTGGCCCAGGGCATGGTGCTACTGATTCACCTCAGTCGTGGTGGCGGTTTTCGCCGTCGGTCCCAACATTTATTACTGCTGTCCTATGGCATTGCCTTTGCCGCCCTTTGTTTATACAACCTATTCGATGTCACCATTTTTGATATGCGGAATAATGTCTTGGGCTGGATTTTCCTAGCGGCGATCGCCGGGGTGAGCCAACGGTATGGAACCAAATTAGCCCAGGGTGATCCGGCAAAATTACAGGTGCCTGGGTAAAAGTCGTTGCTTTCAGGTTCTCGATGTTCTGGTCTACCATGGGAAATGTAGCAAGGTGAAATTAATTGCTCAATGCCGGCCATTGCCGATTGACCCTTCCCAATAAACCCCATCGCCCTCCGAATTTCCC

CDS

ATGACCTCAACTACCCCAGAGATTGAAGCCCTCGCCGCCGACATTGGTGAACAAATTGCCATTGACGTGGCCAAGTGGAATTTATTTTTGGCCGAAGCCCATTTGCATATTCCCCTGGCGGAAAGGGTTTATCCCCTGTTGGAGAAAGATGAACTGGGGCGGGCTGGGGTGGAAGCCGCTCTGAAGGATTTGTCCGTGGCGATCGGTGGGGGCAAAGTGAACATTTCCCTACTGGATGCCCTTTCCAGCACCATGGTTAACCGTTTGCTGACCCTGTTGGAAGAATATCAAAGTAAGAATTTTTAA

Protein

MTSTTPEIEALAADIGEQIAIDVAKWNLFLAEAHLHIPLAERVYPLLEKDELGRAGVEAALKDLSVAIGGGKVNISLLDALSSTMVNRLLTLLEEYQSKNF