Your browser is old and dusty. Try Google Chrome!

Details for slr0728

ORF slr0728
Accession NP_439994.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -214 -200 15.4376 0.104
NP_441061.1_2 Reverse -212 -226 3.93283 0.158
NP_440795.1_7 Forward -213 -206 14.6904 0.0123
NP_440795.1_7 Reverse -206 -213 14.6904 0.0123
NP_441418.1_6 Reverse -205 -224 -12.8819 0.0712
NP_442291.1_5 Reverse -204 -220 6.45005 0.0694
NP_440897.1_6 Forward -214 -195 -0.0996487 0.182
NP_441453.1_4 Reverse -205 -213 16.539 0.00633
NP_441453.1_4 Forward -214 -206 16.539 0.00633
NP_442151.1_6 Forward -214 -200 10.4227 0.123
NP_442151.1_6 Reverse -205 -219 7.47274 0.197
NP_441818.1_1 Reverse -206 -217 9.20294 0.25
NP_440226.1_1 Reverse -205 -224 9.43923 0.0726
NP_440226.1_1 Forward -214 -195 1.67108 0.295
NP_441630.1_3 Forward -171 -152 2.85105 0.214
NP_441098.1_3 Reverse -298 -317 -3.43933 0.28
NP_440996.1_4 Reverse -338 -348 15.418 0.27
NP_442173.1_1 Forward -213 -205 15.4574 0.00633
NP_442173.1_1 Reverse -206 -214 15.4574 0.00633
NP_442752.1_4 Forward -214 -207 13.8055 0.0199
NP_442752.1_4 Reverse -205 -212 13.8055 0.0199
NP_443027.1_4 Forward -216 -206 16.2046 0.0437
NP_443027.1_4 Reverse -203 -213 13.2547 0.0521
NP_442975.1_10 Forward -218 -204 12.192 0.0477
NP_442975.1_10 Reverse -201 -215 4.22722 0.245
NP_440784.1_7 Forward -213 -206 15.9687 0.0123
NP_440784.1_7 Reverse -206 -213 15.9687 0.0123
NP_440061.1_9 Forward -216 -202 9.93039 0.134
NP_441054.1_4 Forward -224 -206 2.37909 0.169
NP_442062.1_3 Reverse -356 -375 -2.85214 0.273
NP_442062.1_8 Reverse -205 -215 10.3048 0.0493
NP_442062.1_8 Forward -214 -204 10.3048 0.0493
NP_440761.1_4 Forward -219 -200 -13.4719 0.257
NP_440304.1_4 Forward -216 -206 19.9412 0.00364
NP_440304.1_4 Reverse -203 -213 10.8948 0.051
NP_442242.1_4 Forward -213 -206 14.3954 0.0124
NP_442242.1_4 Reverse -206 -213 14.3954 0.0124
NP_441208.1_9 Reverse -202 -216 7.9644 0.219
NP_441208.1_9 Forward -217 -203 7.76774 0.219
NP_440365.1_1 Forward -146 -127 12.9387 0.256
NP_440132.1_1 Reverse -80 -98 9.95058 0.224
NP_442375.1_6 Reverse -354 -373 16.4207 0.294
NP_442110.1_7 Forward -214 -200 12.3893 0.0586
NP_442110.1_7 Reverse -205 -219 10.6193 0.0644
NP_442367.1_1 Forward -116 -97 -1.08219 0.26
NP_440856.1_4 Reverse -198 -217 -2.45882 0.211
NP_441083.1_5 Forward -214 -204 11.2881 0.0159
NP_441083.1_5 Reverse -205 -215 11.2881 0.0159
NP_441434.1_1 Forward -303 -289 10.8977 0.233
NP_441738.1_2 Forward -212 -205 15.28 0.0102
NP_441738.1_2 Reverse -207 -214 15.28 0.0102
NP_441558.1_5 Forward -216 -197 10.8159 0.0912
NP_441558.1_5 Reverse -142 -161 8.55425 0.147
NP_441558.1_5 Reverse -203 -222 7.47261 0.18
NP_440209.1_1 Reverse -205 -213 18.1123 0.00295
NP_440209.1_1 Forward -214 -206 18.1123 0.00295
NP_441713.1_1 Reverse -199 -218 13.7658 0.0256
NP_440178.1_7 Reverse -204 -223 -23.01 0.287
NP_442570.1_3 Forward -47 -28 -6.98204 0.265
NP_442570.1_3 Reverse -80 -99 -9.24366 0.296
NP_442461.1_2 Forward -355 -336 17.0107 0.216
NP_441792.1_5 Forward -18 -2 11.5633 0.19
NP_441716.1_1 Reverse -205 -219 6.78443 0.19
NP_442111.1_4 Forward -215 -201 19.8624 0.00373
NP_442111.1_4 Reverse -204 -218 13.5693 0.0383
NP_440906.1_5 Forward -213 -206 15.8704 0.0124
NP_440906.1_5 Reverse -206 -213 15.8704 0.0124
NP_440747.1_10 Reverse -202 -214 17.1486 0.000663
NP_440747.1_10 Forward -217 -205 -1.92764 0.0192
NP_442973.1_5 Forward -223 -204 12.4875 0.206
NP_442973.1_5 Reverse -196 -215 11.7008 0.23
NP_441486.1_1 Forward -217 -203 -3.147 0.176
NP_442145.1_4 Reverse -289 -308 6.82725 0.216
NP_442145.1_4 Forward -352 -333 3.67602 0.285
NP_442634.1_4 Reverse -203 -217 16.5192 0.0108
NP_442634.1_4 Forward -216 -202 7.9644 0.0479
NP_441265.1_3 Reverse -199 -213 1.67122 0.2
NP_441014.1_10 Forward -371 -352 9.43841 0.123
NP_442848.1_1 Forward -220 -206 -2.85201 0.263
NP_443018.1_3 Forward -213 -206 14.8871 0.0123
NP_443018.1_3 Reverse -206 -213 14.8871 0.0123
NP_443018.1_3 Reverse -31 -38 10.2655 0.107
NP_441316.1_7 Forward -216 -201 5.19144 0.121
NP_441634.1_8 Reverse -203 -217 -3.83532 0.295
NP_440376.1_1 Forward -214 -205 19.4693 0.000692
NP_440376.1_1 Reverse -205 -214 19.4693 0.000692
NP_442687.1_7 Forward -215 -205 9.02648 0.0994
NP_442687.1_7 Reverse -204 -214 9.02648 0.0994
NP_442589.1_10 Forward -163 -144 17.1082 0.207
NP_442485.1_3 Forward -102 -83 -2.55715 0.262
NP_442485.1_3 Forward -24 -5 -5.60541 0.293
NP_441846.1_10 Forward -202 -183 -11.9969 0.19
NP_441846.1_10 Forward -230 -211 -23.5016 0.289
NP_441846.1_10 Reverse -87 -106 -23.6 0.294
NP_440642.1_10 Forward -252 -238 6.68548 0.225
NP_441422.1_7 Reverse -203 -220 -7.33598 0.258
NP_441950.1_8 Forward -78 -64 4.91614 0.292
NP_442296.1_9 Reverse -206 -225 -5.31042 0.282
NP_440236.1_2 Reverse -360 -378 -4.40575 0.277
NP_442658.1_1 Reverse -203 -213 14.2375 0.0237
NP_442658.1_1 Forward -216 -206 13.0576 0.04
NP_442782.1_2 Forward -214 -200 8.16106 0.198
NP_442782.1_2 Reverse -205 -219 0.982901 0.282
NP_442205.1_9 Forward -220 -204 16.7748 0.0219
NP_441414.1_9 Forward -39 -20 -10.227 0.279
NP_441487.1_6 Forward -222 -203 -0.197208 0.261
NP_442937.1_5 Reverse -66 -85 9.43923 0.192
NP_441958.1_5 Forward -215 -205 21.2195 0.000805
NP_441958.1_5 Reverse -204 -214 21.2195 0.000805
NP_440203.1_5 Reverse -208 -218 10.4026 0.225
NP_439905.1_5 Reverse -369 -383 18.6825 0.185
NP_440984.1_7 Reverse -200 -214 10.0294 0.126
NP_440984.1_7 Forward -219 -205 4.62115 0.296
NP_439990.1_5 Reverse -200 -213 10.639 0.128
NP_442376.1_2 Forward -219 -200 -13.0786 0.286
NP_442690.1_1 Reverse -334 -353 -17.0118 0.296
NP_442911.1_2 Forward -224 -205 5.01433 0.0356
NP_442911.1_2 Reverse -195 -214 -5.40875 0.158
NP_440153.1_5 Reverse -206 -220 21.3374 0.0215
NP_440153.1_5 Forward -213 -199 5.30946 0.191
NP_442064.1_1 Reverse -200 -219 -10.3253 0.259
NP_440993.1_2 Forward -219 -203 9.10498 0.124
NP_440993.1_2 Reverse -200 -216 4.58176 0.252
NP_440993.1_3 Reverse -195 -214 8.4551 0.129
NP_441348.1_3 Forward -219 -200 14.2574 0.135
NP_441099.1_5 Reverse -195 -214 -7.08038 0.17
NP_440809.1_9 Forward -223 -205 2.96908 0.118
NP_441294.1_7 Forward -218 -204 12.8022 0.0838
NP_441294.1_7 Reverse -54 -68 9.15464 0.256
NP_441646.1_1 Reverse -204 -223 -0.0988766 0.259
NP_441646.1_1 Reverse -51 -70 -1.7705 0.294
NP_442438.1_10 Forward -219 -205 11.996 0.0412
NP_442438.1_10 Reverse -200 -214 1.76955 0.188
NP_441000.1_6 Reverse -204 -218 -5.11362 0.261
NP_440147.1_4 Forward -216 -203 10.7374 0.0355
NP_440147.1_4 Reverse -203 -216 9.65572 0.038
NP_441175.1_7 Forward -214 -195 5.70265 0.276
NP_441550.1_8 Reverse -203 -213 15.8108 0.0132
NP_441550.1_8 Forward -216 -206 13.0576 0.0273
NP_441916.1_7 Forward -214 -204 18.9579 0.00144
NP_441916.1_7 Reverse -205 -215 18.9579 0.00144
NP_440206.1_4 Forward -60 -41 0.981987 0.289
NP_441041.1_4 Forward -220 -201 -2.65548 0.115
NP_441041.1_7 Reverse -202 -214 13.3454 0.0485
NP_441547.1_2 Reverse -194 -212 4.6407 0.246
NP_442004.1_6 Reverse -205 -219 9.14437 0.14
NP_441725.1_4 Reverse -200 -214 13.7653 0.0693
NP_441725.1_5 Reverse -206 -216 11.1898 0.0247
NP_441725.1_5 Forward -213 -203 1.94665 0.115
NP_439966.1_7 Forward -216 -206 14.8275 0.0177
NP_439966.1_7 Reverse -203 -213 14.3359 0.0203
NP_442941.1_3 Reverse -206 -216 19.9412 0.00262
NP_442941.1_3 Forward -213 -203 19.2529 0.00262
NP_440289.1_2 Forward -217 -204 -2.83231 0.262
NP_440289.1_2 Reverse -202 -215 -3.61896 0.267
NP_441678.1_9 Reverse -35 -54 -2.26216 0.257
NP_442281.1_1 Reverse -200 -214 16.5185 0.00772
NP_442281.1_1 Reverse -60 -74 3.53891 0.228
NP_442281.1_1 Reverse -178 -192 1.5723 0.296
NP_441334.1_7 Forward -216 -197 -20.1584 0.275
NP_442256.1_2 Reverse -203 -221 -6.66736 0.214
NP_001035871.2_7 Reverse -6 -16 15.2213 0.17
NP_440437.1_1 Reverse -199 -218 -5.01543 0.273
NP_442500.1_8 Forward -142 -128 15.5771 0.146
NP_440498.1_1 Forward -223 -205 9.0656 0.0786
NP_442982.1_5 Forward -224 -205 3.53937 0.208
NP_442982.1_5 Reverse -195 -214 -0.4922 0.255
NP_441644.1_6 Forward -214 -204 19.0557 0.000803
NP_441644.1_6 Reverse -205 -215 19.0557 0.000803
NP_442029.1_6 Reverse -200 -219 7.27595 0.224
NP_442247.1_5 Reverse -174 -188 16.2061 0.234
NP_442247.1_6 Reverse -81 -100 15.5357 0.14
NP_442247.1_8 Reverse -203 -217 9.14437 0.257
NP_440929.1_8 Forward -214 -205 19.2726 0.000701
NP_440929.1_8 Reverse -205 -214 19.2726 0.000701
NP_442933.1_2 Reverse -360 -378 10.6016 0.257
NP_442933.1_6 Forward -342 -323 14.4666 0.284
NP_442933.1_10 Forward -214 -205 17.601 0.00325
NP_442933.1_10 Reverse -205 -214 17.601 0.00325
NP_441751.2_8 Reverse -206 -220 8.84938 0.0325
NP_441751.2_8 Forward -213 -199 -2.16369 0.132
NP_442554.1_8 Forward -213 -203 17.2863 0.00543
NP_442554.1_8 Reverse -206 -216 16.9913 0.0065
NP_442554.1_8 Reverse -145 -155 6.76487 0.107
NP_442167.1_5 Reverse -324 -343 18.6004 0.257
NP_441762.1_7 Forward -215 -203 -6.74586 0.284
NP_441762.1_7 Reverse -204 -216 -6.84419 0.284
NP_442142.1_4 Reverse -202 -215 13.49 0.0348
NP_442142.1_4 Forward -217 -204 6.31189 0.169
NP_442292.1_1 Forward -213 -204 17.5026 0.00435
NP_442292.1_1 Reverse -206 -215 17.5026 0.00435
NP_442476.1_6 Forward -213 -199 3.73617 0.154
NP_443009.1_5 Reverse -204 -215 15.7911 0.0107
NP_443009.1_5 Forward -215 -204 15.7911 0.0107
NP_441715.1_4 Forward -213 -203 16.7946 0.0106
NP_441715.1_4 Reverse -206 -216 14.238 0.0295
NP_441198.1_8 Forward -216 -206 13.2713 0.108
NP_440379.1_5 Forward -218 -199 -9.34199 0.263
NP_441468.1_1 Forward -213 -206 15.8704 0.0124
NP_441468.1_1 Reverse -206 -213 15.8704 0.0124
NP_441015.1_10 Reverse -200 -219 -10.1286 0.283
NP_441015.1_10 Forward -219 -200 -10.9153 0.289
NP_441673.1_1 Forward -214 -205 20.8459 0.000698
NP_441673.1_1 Reverse -205 -214 20.8459 0.000698
NP_441731.1_7 Forward -99 -80 9.3409 0.147
NP_441876.1_9 Reverse -196 -206 10.5993 0.287
NP_441826.1_2 Forward -220 -206 13.0776 0.0235
NP_441826.1_2 Reverse -199 -213 -1.77037 0.254
NP_442868.1_6 Reverse -203 -213 10.4031 0.038
NP_442868.1_6 Forward -216 -206 1.06167 0.205
NP_441612.1_2 Reverse -245 -255 13.3899 0.21
NP_442427.1_3 Reverse -200 -218 7.4923 0.171
NP_442427.1_8 Reverse -135 -154 6.19431 0.247
NP_442808.1_1 Reverse -204 -214 8.73102 0.0481
NP_442808.1_1 Forward -215 -205 8.73102 0.0481
NP_442808.1_1 Forward -98 -88 4.10949 0.207
NP_441101.1_10 Reverse -201 -220 3.73603 0.173
NP_440145.1_3 Reverse -195 -214 10.7175 0.04
NP_442542.1_9 Reverse -58 -72 7.47213 0.196
NP_442050.1_1 Reverse -58 -77 7.47261 0.272
NP_442050.1_2 Forward -62 -43 9.04509 0.236
NP_442050.1_5 Forward -216 -206 18.0724 0.00365
NP_442050.1_5 Reverse -203 -213 15.9091 0.0091
NP_442050.1_8 Forward -220 -201 12.8206 0.272
NP_440038.1_4 Reverse -197 -216 0.687771 0.275
NP_440558.1_2 Reverse -67 -86 -4.6221 0.247
NP_440558.1_2 Forward -83 -64 -4.72043 0.248
NP_441878.1_6 Forward -215 -205 10.5014 0.0176
NP_441878.1_6 Reverse -204 -214 10.5014 0.0176
NP_441878.1_6 Reverse -47 -57 -7.98478 0.285
NP_441036.1_8 Forward -215 -205 15.713 0.00724
NP_441036.1_8 Reverse -204 -214 15.713 0.00724
NP_441557.1_5 Forward -214 -205 19.9609 0.000699
NP_441557.1_5 Reverse -205 -214 19.9609 0.000699
NP_442066.2_4 Forward -214 -195 -6.88371 0.254
NP_441433.1_8 Forward -214 -195 -2.85214 0.272
NP_440084.1_8 Reverse -298 -312 11.8526 0.241
NP_440084.1_8 Reverse -369 -383 11.0887 0.252
NP_441308.1_8 Forward -216 -206 13.353 0.218
NP_440101.1_3 Forward -219 -200 13.0775 0.0777
NP_440248.1_1 Reverse -324 -343 17.404 0.297
NP_440979.1_3 Forward -21 -3 9.65558 0.297
NP_441574.1_1 Reverse -205 -224 -7.08038 0.283
NP_441549.1_9 Reverse -201 -219 3.06741 0.0925
NP_441549.1_9 Forward -218 -200 -5.68405 0.198
NP_442347.1_2 Forward -213 -204 3.34298 0.284
NP_442347.1_2 Reverse -206 -215 3.34298 0.284
NP_442965.1_2 Reverse -31 -50 3.34271 0.168
NP_442965.1_2 Forward -207 -188 -6.58872 0.257
NP_441037.1_4 Forward -216 -206 7.31769 0.237
NP_441037.1_4 Reverse -203 -213 7.22024 0.237
NP_442508.1_8 Reverse -232 -249 11.1502 0.256
NP_440932.1_9 Reverse -88 -107 8.25926 0.187
NP_441633.1_3 Reverse -203 -216 -3.91395 0.177
NP_440136.1_2 Forward -213 -206 15.9687 0.0123
NP_440136.1_2 Reverse -206 -213 15.9687 0.0123
NP_442590.1_10 Reverse -205 -224 15.6341 0.113
NP_442998.1_10 Forward -212 -205 15.5754 0.0102
NP_442998.1_10 Reverse -207 -214 15.5754 0.0102
NP_440899.1_8 Forward -260 -241 -2.55715 0.221
NP_440299.1_1 Reverse -201 -214 11.1301 0.0518
NP_440299.1_1 Forward -218 -205 7.09854 0.121
NP_440299.1_1 Forward -157 -144 5.13193 0.187
NP_441799.1_1 Forward -218 -204 17.2068 0.0115
NP_441799.1_1 Reverse -201 -215 8.75042 0.106
NP_441007.1_5 Forward -90 -71 9.73422 0.225
NP_441007.1_10 Forward -219 -206 1.49425 0.203
NP_441007.1_10 Reverse -200 -213 1.29759 0.203
NP_440256.1_1 Reverse -202 -221 18.879 0.00424
NP_440256.1_1 Forward -217 -198 0.196116 0.0858
NP_441559.1_8 Reverse -200 -214 10.9143 0.0574
NP_441559.1_8 Forward -219 -205 -1.08205 0.18
NP_440915.1_6 Reverse -201 -215 19.6658 0.00738
NP_440915.1_6 Forward -218 -204 2.35953 0.119
NP_440997.1_3 Forward -220 -201 10.7175 0.266
NP_441296.1_5 Forward -75 -56 15.3391 0.244
NP_442866.1_1 Forward -219 -200 1.96607 0.158
NP_441939.1_3 Forward -213 -194 6.19431 0.248
NP_441494.1_6 Reverse -200 -213 6.01747 0.289
NP_439985.1_7 Forward -220 -201 9.43923 0.18
NP_442993.1_1 Reverse -205 -221 -8.98791 0.178
NP_442386.1_9 Forward -215 -206 6.39082 0.219
NP_442386.1_9 Reverse -204 -213 6.39082 0.219
NP_441340.1_5 Forward -213 -206 15.6737 0.0124
NP_441340.1_5 Reverse -206 -213 15.6737 0.0124
NP_442240.1_2 Forward -213 -194 8.55425 0.0183
NP_441160.1_5 Forward -187 -168 -5.70374 0.288
NP_441160.1_5 Forward -202 -183 -5.99873 0.288
NP_440586.1_8 Forward -213 -206 13.2151 0.026
NP_440586.1_8 Reverse -206 -213 13.2151 0.026
NP_440586.1_8 Reverse -31 -38 9.08521 0.178
NP_442251.1_6 Forward -213 -206 15.2804 0.0124
NP_442251.1_6 Reverse -206 -213 15.2804 0.0124
NP_441262.1_3 Reverse -205 -212 14.7888 0.0223
NP_441262.1_3 Forward -214 -207 14.7888 0.0223
NP_440027.1_8 Reverse -202 -221 12.0933 0.209
NP_440027.1_8 Forward -217 -198 4.42355 0.287
NP_443051.1_1 Reverse -204 -213 19.5676 0.00335
NP_443051.1_1 Forward -215 -206 19.5676 0.00335
NP_441232.1_10 Forward -50 -31 1.17943 0.287
NP_439937.1_9 Reverse -204 -221 -14.6131 0.287
NP_441595.1_2 Forward -367 -354 8.46506 0.29
NP_440408.1_7 Reverse -52 -71 13.8641 0.175
NP_440408.1_7 Reverse -205 -224 10.6192 0.247
NP_440439.1_1 Forward -217 -204 18.2105 0.0105
NP_440439.1_1 Reverse -202 -215 17.8172 0.0105
NP_440372.1_2 Forward -213 -206 16.3621 0.0124
NP_440372.1_2 Reverse -206 -213 16.3621 0.0124
NP_440316.1_10 Reverse -97 -107 6.66654 0.256
NP_439977.1_5 Reverse -199 -218 0.491109 0.208
NP_441572.1_7 Reverse -199 -218 23.5989 0.00821
NP_441572.1_7 Forward -220 -201 4.22769 0.103
NP_441572.1_7 Reverse -138 -157 -5.60541 0.265
NP_440267.1_2 Reverse -200 -214 11.5037 0.125
NP_440267.1_2 Forward -219 -205 8.16044 0.173
NP_442384.1_10 Forward -214 -201 18.8988 0.00338
NP_442384.1_10 Reverse -205 -218 16.0472 0.00946
NP_440364.1_6 Reverse -81 -94 13.3917 0.282
NP_441604.1_4 Reverse -197 -216 2.65439 0.211
NP_441018.1_7 Forward -180 -161 9.24257 0.23
NP_442262.1_10 Forward -213 -206 14.1988 0.0123
NP_442262.1_10 Reverse -206 -213 14.1988 0.0123
NP_442262.1_10 Reverse -31 -38 9.18389 0.211
NP_441689.1_5 Forward -216 -206 17.8758 0.0158
NP_441689.1_5 Reverse -203 -213 8.3377 0.132
NP_440344.1_10 Reverse -160 -177 -8.51595 0.129
NP_440282.1_10 Forward -224 -205 4.32602 0.125
NP_441965.1_10 Forward -217 -201 9.00665 0.123
NP_440297.1_9 Reverse -206 -216 9.22315 0.0917
NP_440297.1_9 Forward -213 -203 -0.216628 0.282
NP_442280.1_10 Forward -49 -31 13.9283 0.13
NP_441592.1_4 Reverse -4 -23 -2.36049 0.262
NP_440834.1_2 Forward -258 -239 15.8299 0.275
NP_442067.1_4 Reverse -77 -96 3.73603 0.278
NP_442067.1_4 Forward -85 -66 2.65439 0.289
NP_440999.1_9 Reverse -201 -215 7.66941 0.0846
NP_440999.1_9 Reverse -70 -84 -2.65535 0.273
NP_440888.1_2 Reverse -205 -219 17.7968 0.00308
NP_440888.1_2 Forward -214 -200 15.9285 0.00837
NP_442454.1_2 Forward -303 -284 8.25963 0.291
NP_442454.1_2 Reverse -283 -302 7.59119 0.291
NP_442277.1_4 Forward -223 -204 16.5182 0.0326
NP_442277.1_4 Reverse -196 -215 2.16195 0.254
NP_442277.1_7 Reverse -323 -339 -1.71205 0.284
NP_441543.1_2 Forward -213 -204 15.9293 0.00518
NP_441543.1_2 Reverse -206 -215 15.9293 0.00518
NP_442845.1_2 Forward -220 -206 16.7159 0.0608
NP_442845.1_2 Reverse -205 -219 4.81781 0.251
NP_442845.1_2 Reverse -199 -213 4.42448 0.259
NP_441551.1_5 Forward -218 -202 11.3659 0.174
NP_442710.1_7 Forward -323 -304 -4.82 0.272
NP_441469.1_8 Forward -215 -206 6.5879 0.227
NP_441469.1_8 Reverse -204 -213 6.5879 0.227
NP_443064.1_6 Forward -214 -204 10.8217 0.13
NP_443064.1_6 Reverse -205 -215 10.8217 0.13
NP_442578.1_7 Forward -213 -206 14.5921 0.026
NP_442578.1_7 Reverse -206 -213 14.5921 0.026
NP_440220.1_4 Forward -52 -33 -0.886293 0.262
NP_440148.1_1 Forward -30 -11 -5.21209 0.231
NP_441462.1_2 Forward -214 -204 20.2362 0.000805
NP_441462.1_2 Reverse -205 -215 20.2362 0.000805
NP_441621.1_3 Reverse -28 -46 12.1139 0.254
NP_441621.1_7 Forward -216 -202 -5.01529 0.248
NP_443062.1_1 Forward -214 -196 7.76586 0.168
NP_441410.1_3 Forward -223 -204 15.3391 0.121
NP_442204.1_1 Reverse -201 -212 21.1015 0.0035
NP_442204.1_1 Forward -218 -207 7.72849 0.116
NP_442204.1_2 Forward -224 -205 9.24257 0.225
NP_440516.1_8 Forward -214 -205 16.9127 0.00442
NP_440516.1_8 Reverse -205 -214 16.9127 0.00442
NP_442428.1_5 Forward -213 -206 15.8704 0.0124
NP_442428.1_5 Reverse -206 -213 15.8704 0.0124
NP_441790.1_3 Forward -213 -194 -0.295539 0.243
NP_442859.1_2 Forward -60 -41 2.94938 0.262
NP_440673.1_3 Forward -212 -205 12.4288 0.0426
NP_440673.1_3 Reverse -207 -214 12.4288 0.0426
NP_440673.1_7 Forward -225 -206 0.0977854 0.276
NP_440865.1_9 Forward -220 -201 0.982764 0.128
NP_441052.1_2 Forward -214 -204 10.4031 0.0285
NP_441052.1_2 Reverse -205 -215 10.4031 0.0285
NP_442219.1_9 Forward -213 -204 8.25953 0.0681
NP_442219.1_9 Reverse -206 -215 8.25953 0.0681
NP_440436.1_4 Forward -213 -204 9.24241 0.0871
NP_440436.1_4 Reverse -206 -215 9.24241 0.0871
NP_442086.1_3 Forward -213 -194 6.29264 0.288
NP_441719.1_4 Forward -213 -206 16.3621 0.0124
NP_441719.1_4 Reverse -206 -213 16.3621 0.0124
NP_441004.1_1 Forward -207 -188 -17.5035 0.292
NP_441004.1_2 Forward -90 -71 0.982764 0.228
NP_442366.1_3 Forward -75 -57 -2.53746 0.229
NP_442366.1_3 Forward -215 -197 -4.01242 0.262
NP_441115.1_4 Reverse -204 -222 20.0778 0.00637
NP_441115.1_4 Forward -215 -197 14.8663 0.0484
NP_442206.1_10 Forward -214 -199 2.8315 0.198
NP_440328.1_4 Forward -220 -201 0.786102 0.239
NP_440328.1_4 Reverse -199 -218 -0.4922 0.281
NP_441851.1_10 Forward -215 -205 8.53483 0.114
NP_441851.1_10 Reverse -204 -214 8.53483 0.114
NP_441157.1_1 Forward -349 -335 6.98048 0.187
NP_440593.1_3 Reverse -66 -85 -6.98204 0.285
NP_441046.1_2 Reverse -60 -79 -1.18052 0.288
NP_441349.1_10 Forward -224 -205 2.0644 0.0774
NP_441349.1_10 Reverse -195 -214 -1.08219 0.0988
NP_441409.1_6 Forward -220 -201 -7.67036 0.154
NP_441409.1_6 Reverse -199 -218 -7.86702 0.158
NP_440432.1_9 Forward -213 -198 2.63483 0.111
NP_442843.1_1 Reverse -31 -50 -8.26035 0.255
NP_440474.1_8 Reverse -66 -80 14.0603 0.0658
NP_440474.1_8 Reverse -206 -220 13.4703 0.0696
NP_441477.1_10 Forward -221 -203 9.65558 0.181
NP_440431.1_4 Forward -141 -122 -0.239153 0.194
NP_442450.1_5 Forward -216 -206 9.41981 0.115
NP_442450.1_5 Forward -57 -47 4.69992 0.297
NP_442168.1_5 Reverse -31 -50 1.67108 0.241
NP_442168.1_6 Forward -258 -239 12.7825 0.202
NP_440588.1_2 Reverse -196 -215 5.99764 0.06
NP_440588.1_2 Forward -223 -204 0.491109 0.146
NP_440943.1_5 Forward -263 -249 17.3058 0.218
NP_442006.1_2 Forward -227 -210 -17.7591 0.282
NP_442243.1_1 Reverse -199 -217 1.78836 0.21
NP_442243.1_1 Reverse -233 -251 -1.55487 0.279
NP_441570.1_1 Reverse -205 -223 -6.96235 0.0829
NP_441078.1_4 Forward -214 -205 19.6659 0.0007
NP_441078.1_4 Reverse -205 -214 19.6659 0.0007
NP_442443.1_4 Forward -36 -26 14.1392 0.229
NP_441432.1_8 Reverse -204 -213 16.8143 0.00595
NP_441432.1_8 Forward -215 -206 16.8143 0.00595
NP_441432.1_9 Reverse -290 -303 11.5071 0.226
NP_442320.1_8 Reverse -199 -213 -2.65535 0.0926
NP_441732.1_2 Reverse -201 -217 3.10679 0.0141
NP_441732.1_2 Forward -218 -202 -7.70961 0.0885
NP_441732.1_5 Reverse -101 -115 11.701 0.21
NP_441990.1_8 Reverse -54 -73 16.4199 0.159
NP_441030.1_6 Forward -216 -197 15.2582 0.184
NP_440629.1_6 Reverse -40 -59 15.4332 0.129
NP_440321.1_1 Forward -184 -167 13.6085 0.27
NP_440760.1_1 Forward -214 -195 -12.7836 0.0947
NP_440199.1_10 Forward -217 -207 12.9597 0.114
NP_441805.1_2 Reverse -194 -213 3.83436 0.138
NP_441057.1_4 Forward -23 -5 -3.6191 0.295
NP_440713.1_4 Forward -224 -205 6.39097 0.19
NP_442489.1_7 Forward -214 -205 20.1576 0.000695
NP_442489.1_7 Reverse -205 -214 20.1576 0.000695
NP_442079.1_7 Reverse -83 -102 6.19431 0.162
NP_440559.1_1 Reverse -206 -215 8.65285 0.0586
NP_440559.1_1 Forward -213 -204 8.65285 0.0586
NP_441659.2_8 Forward -214 -204 20.9245 0.000805
NP_441659.2_8 Reverse -205 -215 20.9245 0.000805
NP_442913.1_10 Reverse -196 -215 -2.55715 0.187
NP_442008.1_2 Reverse -202 -221 12.8808 0.0982
NP_442346.1_5 Forward -215 -205 16.303 0.00248
NP_442346.1_5 Reverse -204 -214 16.303 0.00248
NP_440352.1_5 Forward -212 -193 12.8504 0.222
NP_440545.1_3 Forward -218 -201 17.1484 0.0111
NP_440545.1_3 Reverse -201 -218 13.8052 0.0166
NP_441856.1_3 Forward -217 -198 21.5339 0.014
NP_440459.1_2 Reverse -56 -73 11.9369 0.165
NP_440459.1_2 Forward -244 -227 8.10198 0.27
NP_442603.1_7 Forward -214 -200 10.5204 0.125
NP_441888.1_7 Reverse -200 -214 3.8345 0.225
NP_440449.1_6 Forward -63 -45 7.08868 0.232
NP_440449.1_6 Reverse -197 -215 6.79689 0.24
NP_440449.1_6 Forward -222 -204 6.69963 0.241
NP_441948.1_4 Forward -221 -203 -2.43913 0.166
NP_441358.1_2 Forward -207 -188 5.99764 0.275
NP_441833.1_4 Forward -213 -206 15.9687 0.0124
NP_441833.1_4 Reverse -206 -213 15.9687 0.0124
NP_443040.1_1 Forward -305 -291 9.89403 0.291
NP_441329.1_6 Forward -32 -13 -0.143661 0.266
NP_442162.1_9 Forward -213 -206 16.2637 0.0124
NP_442162.1_9 Reverse -206 -213 16.2637 0.0124
NP_442162.1_9 Reverse -234 -241 5.93897 0.214
NP_440671.1_4 Reverse -199 -213 8.16106 0.202
NP_440671.1_4 Forward -220 -206 7.76774 0.208
NP_440224.1_1 Reverse -194 -213 0.58944 0.133
NP_442140.1_3 Forward -213 -203 4.69992 0.238
NP_440875.1_9 Forward -212 -202 16.5483 0.0145
NP_440875.1_9 Forward -53 -43 7.39866 0.267
NP_441813.1_5 Reverse -203 -213 18.1713 0.00743
NP_441813.1_5 Forward -216 -206 15.9097 0.01
NP_440590.1_4 Forward -213 -200 4.44418 0.0601
NP_440590.1_4 Reverse -206 -219 -5.48725 0.28
NP_440567.1_1 Reverse -206 -220 16.4209 0.0166
NP_440567.1_1 Forward -213 -199 8.35772 0.0584
NP_442497.1_10 Forward -213 -204 17.601 0.00813
NP_442497.1_10 Reverse -206 -215 17.601 0.00813
NP_440821.1_4 Forward -216 -206 11.0914 0.0146
NP_440821.1_4 Reverse -203 -213 2.24165 0.131
NP_440227.1_2 Reverse -335 -351 14.7098 0.271
NP_441239.1_9 Reverse -203 -215 13.0187 0.0389
NP_441239.1_9 Forward -216 -204 12.1337 0.0494
NP_441892.1_1 Forward -223 -206 0.0388413 0.176
NP_442270.1_9 Reverse -213 -232 0.196116 0.14
NP_442643.1_1 Forward -220 -201 -9.63698 0.231
NP_441541.1_1 Reverse -289 -307 4.29912 0.171
NP_441541.1_1 Forward -317 -299 -5.15458 0.293
NP_440354.1_5 Reverse -202 -221 9.73422 0.174
NP_440546.1_4 Reverse -205 -215 13.5365 0.0459
NP_440546.1_4 Forward -214 -204 13.5365 0.0459
NP_442041.1_5 Forward -220 -201 1.17943 0.257
NP_440462.1_6 Reverse -203 -213 18.7612 0.00454
NP_440462.1_6 Forward -216 -206 16.893 0.00853
NP_442611.1_1 Forward -214 -195 3.34271 0.209
NP_440868.1_4 Forward -218 -206 15.7719 0.0164
NP_440868.1_4 Reverse -201 -213 8.00379 0.0602
NP_441497.1_2 Forward -263 -244 5.99764 0.233
NP_441879.1_3 Reverse -206 -225 3.24438 0.261
NP_441868.1_4 Reverse -2 -16 12.4876 0.284
NP_441474.1_1 Reverse -184 -203 -2.95123 0.29
NP_442402.1_1 Reverse -186 -205 10.6192 0.254
NP_442402.1_4 Reverse -186 -205 5.01354 0.144
NP_442402.1_4 Forward -263 -244 -9.53937 0.291
NP_442402.1_6 Forward -206 -197 13.4711 0.284
NP_441848.1_4 Forward -353 -337 9.4605 0.283
NP_441848.1_7 Reverse -175 -194 4.42355 0.215
NP_442039.1_4 Forward -213 -206 15.1821 0.0124
NP_442039.1_4 Reverse -206 -213 15.1821 0.0124
NP_442039.1_7 Forward -37 -27 13.5497 0.211
NP_442039.1_10 Reverse -184 -202 13.883 0.227
NP_441926.1_3 Reverse -205 -221 6.15506 0.17
NP_442837.1_3 Forward -213 -206 15.7721 0.0124
NP_442837.1_3 Reverse -206 -213 15.7721 0.0124
NP_439994.1_3 Forward -215 -196 8.24345 0.291
NP_442053.1_1 Forward -214 -205 18.3876 0.0007
NP_442053.1_1 Reverse -205 -214 18.3876 0.0007
NP_440505.1_3 Reverse -203 -213 17.188 0.00332
NP_440505.1_3 Forward -216 -206 15.123 0.014
NP_440505.1_3 Forward -205 -195 5.19158 0.241
NP_441959.1_8 Forward -351 -338 8.03444 0.298
NP_441203.1_1 Forward -213 -194 -11.8986 0.139
NP_442532.1_1 Forward -303 -289 9.82208 0.266
NP_440914.1_1 Forward -214 -204 16.3248 0.00196
NP_440914.1_1 Reverse -205 -215 16.3248 0.00196
NP_441011.1_8 Forward -213 -204 16.6177 0.00602
NP_441011.1_8 Reverse -206 -215 16.6177 0.00602
NP_442101.1_10 Reverse -197 -216 1.27776 0.0848
NP_442533.1_6 Forward -214 -205 17.2076 0.00137
NP_442533.1_6 Reverse -205 -214 17.2076 0.00137
NP_442533.1_6 Reverse -4 -13 2.06468 0.275
NP_442232.1_3 Forward -222 -203 -12.7836 0.282
NP_441482.1_7 Reverse -199 -213 6.88276 0.0257
NP_441482.1_7 Forward -220 -206 -10.8168 0.216
NP_439944.1_9 Reverse -206 -216 17.6796 0.00347
NP_439944.1_9 Forward -213 -203 9.12481 0.1
NP_441697.1_5 Forward -344 -325 -6.15965 0.232
NP_441697.1_5 Forward -345 -326 -11.1252 0.292
NP_441028.1_6 Reverse -195 -205 3.51951 0.292
NP_441527.1_5 Forward -216 -197 12.1147 0.297
NP_440115.1_6 Reverse -202 -212 14.0414 0.0615
NP_440115.1_6 Forward -217 -207 6.46988 0.181
NP_440007.1_9 Reverse -201 -215 10.816 0.163
NP_440007.1_9 Forward -71 -57 1.96621 0.281
NP_440007.1_9 Forward -218 -204 1.08123 0.29
NP_441106.1_1 Reverse -204 -213 18.486 0.0028
NP_441106.1_1 Forward -215 -206 18.486 0.0028
NP_439903.1_6 Reverse -202 -221 5.60352 0.178
NP_441286.1_1 Reverse -204 -216 4.95553 0.027
NP_441286.1_1 Forward -215 -203 -3.50094 0.145
NP_440670.1_8 Forward -214 -205 18.3876 0.000699
NP_440670.1_8 Reverse -205 -214 18.3876 0.000699
NP_440886.1_7 Forward -215 -205 8.04271 0.0805
NP_440886.1_7 Reverse -204 -214 8.04271 0.0805
NP_440886.1_7 Reverse -81 -91 5.19112 0.194
NP_442614.1_2 Reverse -205 -219 6.3911 0.291
NP_442382.1_7 Forward -20 -1 2.75272 0.295
NP_442072.1_9 Reverse -204 -222 -2.53746 0.0317
NP_442072.1_9 Forward -215 -197 -12.4689 0.0852
NP_442072.1_9 Forward -58 -40 -15.0255 0.168
NP_440907.2_8 Forward -213 -203 9.616 0.103
NP_440907.2_8 Reverse -206 -216 9.51767 0.103
NP_440176.1_3 Forward -249 -235 13.5686 0.261
NP_440962.1_5 Forward -254 -244 17.188 0.261
NP_441463.1_3 Forward -224 -205 -1.47551 0.141
NP_441626.1_2 Forward -213 -206 15.7721 0.0124
NP_441626.1_2 Reverse -206 -213 15.7721 0.0124
NP_442365.1_7 Reverse -201 -220 5.70265 0.127
NP_442794.1_1 Reverse -201 -213 10.5604 0.0721
NP_442615.1_1 Forward -223 -205 0.904127 0.0943
NP_442615.1_1 Reverse -196 -214 -2.24246 0.141
NP_441796.1_8 Reverse -81 -99 9.85225 0.249
NP_440387.1_1 Reverse -205 -221 8.31834 0.0282
NP_440387.1_1 Forward -214 -198 -1.02311 0.142
NP_441431.1_2 Reverse -202 -216 6.98048 0.255
NP_441488.1_8 Reverse -200 -214 9.73373 0.146
NP_441836.1_2 Forward -220 -201 -3.63879 0.242
NP_441836.1_2 Reverse -138 -157 -4.42544 0.255
NP_441993.1_1 Forward -220 -201 6.33227 0.181
NP_442084.1_6 Forward -179 -161 9.75391 0.221
NP_440114.1_10 Reverse -205 -219 16.2242 0.0194
NP_442323.1_7 Reverse -200 -219 17.2065 0.042
NP_442323.1_7 Forward -219 -200 6.68515 0.19
NP_440293.1_3 Reverse -2 -21 -0.39387 0.229
NP_439910.1_2 Reverse -258 -275 -13.3342 0.162
NP_442867.1_8 Reverse -227 -246 10.4225 0.208
NP_440457.1_1 Forward -218 -206 11.5437 0.092
NP_440457.1_1 Reverse -201 -213 7.70879 0.101
NP_440457.1_1 Reverse -94 -106 0.137309 0.25
NP_440798.1_6 Reverse -206 -219 12.999 0.0458
NP_440798.1_6 Forward -213 -200 2.08423 0.186
NP_442509.1_9 Reverse -205 -215 8.04271 0.192
NP_442509.1_9 Forward -214 -204 8.04271 0.192
NP_441489.1_3 Forward -351 -337 6.98253 0.287
NP_442439.1_8 Reverse -354 -373 9.24257 0.253
NP_442514.1_5 Forward -257 -238 -1.8696 0.207
NP_442514.1_5 Forward -21 -2 -7.17944 0.275
NP_440554.1_4 Forward -213 -203 17.9746 0.0131
NP_440554.1_4 Reverse -206 -216 16.1063 0.0189
NP_440554.1_4 Forward -152 -142 4.3066 0.195
NP_441885.1_5 Forward -214 -204 11.3864 0.00668
NP_441885.1_5 Reverse -205 -215 11.3864 0.00668
NP_440478.1_4 Reverse -230 -249 10.0292 0.293
NP_440649.2_8 Forward -237 -223 9.93102 0.265
NP_442341.1_7 Forward -101 -87 1.27789 0.295
NP_442341.1_9 Reverse -203 -217 16.3219 0.0371
NP_442341.1_9 Reverse -44 -58 11.897 0.118
NP_442341.1_9 Forward -216 -202 7.66879 0.192
NP_441756.1_5 Reverse -201 -220 1.86774 0.215
NP_442395.2_4 Reverse -70 -89 1.47364 0.24
NP_443000.1_7 Reverse -203 -213 20.3345 0.00223
NP_443000.1_7 Forward -216 -206 17.4829 0.00719
NP_441842.1_10 Forward -221 -207 9.73436 0.182
NP_440275.1_3 Reverse -203 -213 16.1063 0.0155
NP_440275.1_3 Forward -216 -206 9.12481 0.055
NP_440091.1_1 Forward -218 -206 8.39711 0.0653
NP_443046.1_4 Forward -88 -69 20.059 0.152
NP_442451.1_2 Reverse -66 -85 -8.55534 0.251
NP_442451.1_2 Reverse -63 -82 -10.227 0.265
NP_441207.1_7 Forward -322 -308 14.6769 0.179
NP_442495.1_4 Forward -210 -200 16.303 0.0771
NP_440804.1_4 Forward -30 -21 16.716 0.145
NP_441105.1_3 Reverse -194 -213 -5.40875 0.219
NP_441105.1_3 Forward -225 -206 -10.0303 0.3
NP_442373.1_2 Forward -194 -175 -6.39206 0.227
NP_440216.1_1 Reverse -205 -219 17.4042 0.00188
NP_440216.1_1 Forward -214 -200 17.1092 0.00188
NP_440216.1_9 Forward -37 -28 16.9127 0.116
NP_440216.1_9 Reverse -32 -41 15.9293 0.128
NP_440216.1_9 Reverse -31 -40 6.78456 0.289
NP_440172.1_1 Forward -214 -204 17.5813 0.00421
NP_440172.1_1 Reverse -205 -215 17.5813 0.00421
NP_442371.1_1 Forward -205 -195 12.1726 0.258
NP_442015.1_10 Reverse -201 -214 13.4906 0.0354
NP_442015.1_10 Forward -218 -205 1.88757 0.204
NP_441226.1_7 Forward -213 -206 14.4934 0.0123
NP_441226.1_7 Reverse -206 -213 14.4934 0.0123
NP_441111.1_7 Forward -213 -205 18.7023 0.00294
NP_441111.1_7 Reverse -206 -214 18.7023 0.00294
NP_442379.1_10 Forward -221 -204 14.9851 0.0454
NP_442379.1_10 Reverse -198 -215 -0.452814 0.223
NP_441766.1_2 Forward -214 -205 17.5026 0.00297
NP_441766.1_2 Reverse -205 -214 17.5026 0.00297
NP_442417.1_5 Forward -214 -200 14.3559 0.0633
NP_440416.1_9 Forward -221 -202 -7.76869 0.106
NP_440416.1_9 Reverse -198 -217 -14.9469 0.182
NP_440261.1_5 Forward -213 -200 6.70579 0.0318
NP_440261.1_5 Reverse -206 -219 -2.83231 0.0932
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAACTAAGAACTGTCTGAAATCCTTTATTTTTTCATTGACATAACTTGGATTTAGACAAAATTTAAATCTCTATTTCAGAAAAACATAAACCACTTTAAAAATAGATAATTTAACTTGATGATCAGACAAACGTTGTTTAATCATTGGTTTTCCTCTCCCCAATCGGAAGGAGAGTCAATGCGGAAGGCGATCGCCTGGGGATAATATGGGGAGTGGTAATTTTGGGAGTTGCAGTTGAAAATCCCTTCCCATCTCTTGAAGAAAGAACAACTAGCGGTCTATTGGGGCTTGACCCTACTGCCCTTCAACGCCGTAGCGGGGTTACTGCCACTGCTGTTTGCGAGCCTGAGCCCCTGGTTTTTCCATGGCAAAAAATTAGCGAGCCTACCCCTGGCCAAA

CDS

GTGTGGGCCGCCCTGACCCTATGGTTTTTACTGACCACCATCACCGCCCATGACCGGGGAGAAGCCCTGTTGGGATTGGCCAACTTTGTGCCCTATTTCATAGTTTTTCTTGCCTTTAGCCAAGTAATTTGCCAATTTAAGCAACTCAATACCCTAGCTTGGCTGTTAACTGCTAATACCGTGGTGTTAGTCATCATCGGTTTTGGACAAGTCTATGGCGGCTGGGCCACCCCCAATTGGTTAGTGGCGATCGGTACTAACTTGGTGGCCGGGGGCAGACCAGAAGGGAGAATGTCTTCCCTATTAATGTATGCCAACCTATTTTCCGCTTGGTTATTGATGGTATTTCCCCTCAGTCTGGGGCTATTGATCCAATCCGTCCGTCGTTGGCATTTCACCGCCCCCAGTAACCGCTTCAATCTTCCTCCCCTGGTATGGGCCCTGTTAGTAGCTTGCATCCTAGAGGCGATCGCCTTAGTGTTGACCGGTTCCCGCAGTGCTTGGGGCATTGGGTTACTAATTGGCATTGCCTACGCCATTTATTTAAGTTGGTACTGGTTAGTGGCCCTGGCTGGGGGAGCCACTGCCATGGTGTTATGGGCATCCTTTGGCCCCTTTGGCAAAGAACCATTGCGACAGATAGTGCCTAAATATTTTTGGGGCAGATTATCCGATGAACTTTACCCCGACCGTTACCGCACTGCTCTTCGTAGCACCCAATGGCAATTTAGCTGGGATATGTTCCTGGACCAACCCATTTTTGGCCAGGGCTTGCGGAATTTTACCCCCCTGTACCAAGCCGCCATGAACGTTTGGATTGGCCATCCCCATAACTTGGTGCTGATGATGTTGGGGGAAACGGGCTTGATCGGCACTGCGTTAATGCTGGGAGCGGTGGGCTTCATTCTGGCCCAGGGCATGGTGCTACTGATTCACCTCAGTCGTGGTGGCGGTTTTCGCCGTCGGTCCCAACATTTATTACTGCTGTCCTATGGCATTGCCTTTGCCGCCCTTTGTTTATACAACCTATTCGATGTCACCATTTTTGATATGCGGAATAATGTCTTGGGCTGGATTTTCCTAGCGGCGATCGCCGGGGTGAGCCAACGGTATGGAACCAAATTAGCCCAGGGTGATCCGGCAAAATTACAGGTGCCTGGGTAA

Protein

MWAALTLWFLLTTITAHDRGEALLGLANFVPYFIVFLAFSQVICQFKQLNTLAWLLTANTVVLVIIGFGQVYGGWATPNWLVAIGTNLVAGGRPEGRMSSLLMYANLFSAWLLMVFPLSLGLLIQSVRRWHFTAPSNRFNLPPLVWALLVACILEAIALVLTGSRSAWGIGLLIGIAYAIYLSWYWLVALAGGATAMVLWASFGPFGKEPLRQIVPKYFWGRLSDELYPDRYRTALRSTQWQFSWDMFLDQPIFGQGLRNFTPLYQAAMNVWIGHPHNLVLMMLGETGLIGTALMLGAVGFILAQGMVLLIHLSRGGGFRRRSQHLLLLSYGIAFAALCLYNLFDVTIFDMRNNVLGWIFLAAIAGVSQRYGTKLAQGDPAKLQVPG