Your browser is old and dusty. Try Google Chrome!

Details for slr0723

ORF slr0723
Accession NP_439990.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -128 -114 0.786239 0.199
NP_440557.1_1 Forward -24 -5 -2.55715 0.292
NP_440795.1_7 Forward -128 -121 14.6904 0.0123
NP_440795.1_7 Reverse -121 -128 14.6904 0.0123
NP_440795.1_7 Forward -77 -70 9.77388 0.169
NP_441418.1_6 Forward -129 -110 -20.0601 0.103
NP_441418.1_6 Reverse -120 -139 -20.5517 0.117
NP_441418.1_6 Reverse -48 -67 -20.945 0.133
NP_441418.1_6 Forward -75 -56 -22.715 0.184
NP_441418.1_6 Reverse -54 -73 -28.7132 0.208
NP_441418.1_6 Forward -72 -53 -30.2865 0.267
NP_443032.1_8 Reverse -166 -185 -3.73712 0.299
NP_440897.1_6 Reverse -66 -85 2.45694 0.165
NP_440897.1_6 Forward -63 -44 -3.54122 0.248
NP_441453.1_4 Reverse -120 -128 16.539 0.00633
NP_441453.1_4 Forward -129 -121 16.539 0.00633
NP_442151.1_6 Forward -129 -115 20.7474 0.0045
NP_442151.1_6 Reverse -120 -134 11.0127 0.109
NP_442151.1_6 Reverse -86 -100 7.47274 0.197
NP_442151.1_6 Forward -180 -166 6.78443 0.221
NP_441818.1_1 Reverse -121 -132 9.79292 0.232
NP_441818.1_9 Reverse -301 -320 -7.37537 0.272
NP_440226.1_1 Reverse -120 -139 9.83255 0.0687
NP_440226.1_1 Forward -129 -110 1.57275 0.3
NP_441465.1_8 Forward -168 -150 10.3439 0.193
NP_440996.1_4 Reverse -180 -190 17.8763 0.15
NP_442173.1_1 Forward -128 -120 15.4574 0.00633
NP_442173.1_1 Reverse -121 -129 15.4574 0.00633
NP_442752.1_4 Forward -129 -122 13.8055 0.0199
NP_442752.1_4 Reverse -120 -127 13.8055 0.0199
NP_442752.1_4 Forward -157 -150 12.1338 0.0546
NP_443027.1_4 Forward -131 -121 11.0914 0.107
NP_440613.1_7 Forward -95 -76 20.7473 0.0329
NP_442975.1_10 Reverse -116 -130 10.2254 0.056
NP_442975.1_10 Reverse -272 -286 5.40719 0.224
NP_441225.1_7 Forward -77 -58 13.1758 0.211
NP_440784.1_7 Forward -128 -121 15.9687 0.0123
NP_440784.1_7 Reverse -121 -128 15.9687 0.0123
NP_440784.1_7 Reverse -371 -378 10.2655 0.0801
NP_440061.1_9 Reverse -118 -132 19.6651 0.00478
NP_440061.1_9 Forward -131 -117 10.422 0.124
NP_440110.1_8 Forward -74 -55 -0.787193 0.228
NP_441476.1_5 Forward -339 -320 -3.63879 0.239
NP_442062.1_8 Forward -129 -119 17.3846 0.00193
NP_442062.1_8 Reverse -120 -130 17.3846 0.00193
NP_442062.1_8 Forward -157 -147 4.40493 0.217
NP_441859.1_3 Reverse -119 -138 8.35677 0.139
NP_440304.1_4 Reverse -130 -140 2.83163 0.299
NP_440304.1_4 Forward -131 -121 1.84832 0.299
NP_440304.1_4 Reverse -118 -128 1.84832 0.299
NP_442242.1_4 Forward -128 -121 14.3954 0.0124
NP_442242.1_4 Reverse -121 -128 14.3954 0.0124
NP_442602.1_3 Forward -150 -131 -2.45882 0.258
NP_439918.1_3 Reverse -117 -136 3.24438 0.266
NP_441594.1_6 Forward -337 -318 15.2408 0.0984
NP_441594.1_6 Forward -81 -62 8.75091 0.153
NP_441594.1_6 Reverse -123 -142 0.687771 0.282
NP_441594.1_6 Forward -78 -59 -0.39387 0.299
NP_442110.1_7 Forward -129 -115 2.06454 0.222
NP_442110.1_7 Reverse -120 -134 1.76955 0.222
NP_440856.1_4 Forward -136 -117 6.19431 0.0772
NP_440856.1_7 Forward -75 -56 -8.94866 0.28
NP_441083.1_3 Forward -58 -48 14.4342 0.175
NP_441083.1_5 Forward -129 -119 20.3345 0.00053
NP_441083.1_5 Reverse -120 -130 20.3345 0.00053
NP_442827.1_8 Reverse -58 -77 -3.14789 0.298
NP_442245.1_7 Forward -83 -65 16.1454 0.153
NP_441738.1_2 Forward -127 -120 15.28 0.0102
NP_441738.1_2 Reverse -122 -129 15.28 0.0102
NP_441558.1_5 Forward -131 -112 22.7139 0.00172
NP_440209.1_1 Reverse -120 -128 18.1123 0.00295
NP_440209.1_1 Forward -129 -121 18.1123 0.00295
NP_442889.1_8 Forward -132 -118 5.40719 0.227
NP_440447.1_5 Forward -135 -125 12.1731 0.291
NP_440447.1_6 Forward -137 -119 5.72234 0.145
NP_441713.1_1 Forward -135 -116 -6.78538 0.121
NP_442675.1_4 Forward -77 -59 -4.60241 0.257
NP_441770.1_4 Forward -65 -46 -11.5053 0.29
NP_442706.1_5 Forward -294 -275 14.4971 0.245
NP_442570.1_3 Reverse -317 -336 -7.37537 0.27
NP_442570.1_8 Reverse -259 -277 16.1454 0.112
NP_441716.1_1 Reverse -120 -134 19.9608 0.00829
NP_441716.1_1 Reverse -262 -276 3.34284 0.268
NP_442111.1_4 Reverse -119 -133 14.3559 0.0307
NP_442111.1_4 Forward -130 -116 11.111 0.0515
NP_441163.1_1 Forward -277 -260 6.52796 0.255
NP_441163.1_1 Forward -181 -164 4.85634 0.284
NP_440481.1_6 Reverse -124 -142 11.9172 0.294
NP_440906.1_5 Forward -128 -121 15.8704 0.0124
NP_440906.1_5 Reverse -121 -128 15.8704 0.0124
NP_440747.1_1 Forward -330 -312 15.2604 0.183
NP_440747.1_10 Forward -132 -120 26.5883 0.000317
NP_440747.1_10 Reverse -117 -129 14.887 0.00223
NP_441130.1_10 Forward -323 -309 6.3911 0.19
NP_441130.1_10 Forward -77 -63 4.91614 0.258
NP_442973.1_5 Reverse -39 -58 13.3725 0.169
NP_441486.1_1 Forward -132 -118 6.3911 0.0344
NP_441486.1_1 Reverse -117 -131 5.89945 0.0344
NP_441486.1_1 Forward -60 -46 -6.39192 0.294
NP_442330.1_4 Reverse -307 -326 16.1172 0.233
NP_441265.1_3 Forward -135 -121 3.04785 0.181
NP_440842.1_10 Reverse -162 -176 5.21113 0.251
NP_440842.1_10 Forward -58 -44 2.94952 0.269
NP_441014.1_5 Reverse -115 -133 14.0805 0.2
NP_441014.1_9 Forward -357 -338 7.96426 0.188
NP_441014.1_10 Reverse -147 -166 -1.08295 0.257
NP_443018.1_3 Forward -128 -121 14.8871 0.0123
NP_443018.1_3 Reverse -121 -128 14.8871 0.0123
NP_443018.1_3 Forward -378 -371 4.26735 0.267
NP_443018.1_3 Reverse -371 -378 4.16902 0.278
NP_441634.1_8 Forward -80 -66 5.70279 0.114
NP_441634.1_8 Forward -131 -117 -3.147 0.295
NP_441634.1_8 Forward -323 -309 -3.73699 0.295
NP_441182.1_3 Forward -82 -64 17.3254 0.241
NP_440376.1_1 Forward -129 -120 19.4693 0.000692
NP_440376.1_1 Reverse -120 -129 19.4693 0.000692
NP_440376.1_1 Forward -75 -66 4.32629 0.163
NP_440376.1_1 Forward -157 -148 4.0313 0.182
NP_440376.1_1 Forward -174 -165 0.196389 0.283
NP_441588.1_4 Forward -127 -117 15.9097 0.0369
NP_442687.1_7 Forward -130 -120 8.92815 0.0994
NP_442687.1_7 Reverse -119 -129 8.92815 0.0994
NP_442687.1_7 Reverse -68 -78 8.23984 0.11
NP_442687.1_7 Reverse -53 -63 4.10993 0.266
NP_442687.1_7 Forward -335 -325 3.81494 0.286
NP_442485.1_3 Forward -74 -55 6.58763 0.161
NP_442485.1_3 Reverse -64 -83 1.37609 0.229
NP_442485.1_3 Forward -168 -149 1.17943 0.232
NP_442485.1_3 Forward -80 -61 -0.39387 0.252
NP_441846.1_10 Forward -167 -148 -22.9117 0.271
NP_440781.1_1 Reverse -51 -65 16.1259 0.227
NP_440642.1_8 Forward -127 -108 13.803 0.229
NP_441013.1_2 Forward -68 -50 7.19731 0.208
NP_441422.1_7 Forward -323 -306 6.23369 0.0992
NP_440533.1_9 Reverse -120 -139 5.01433 0.214
NP_440360.1_10 Forward -73 -59 4.62115 0.227
NP_442658.1_1 Forward -381 -371 10.796 0.107
NP_442658.1_1 Forward -131 -121 7.94438 0.199
NP_442658.1_1 Reverse -118 -128 6.76441 0.214
NP_442658.1_1 Forward -336 -326 6.46942 0.229
NP_442782.1_2 Reverse -54 -68 7.47274 0.202
NP_441414.1_9 Forward -129 -110 7.17762 0.0358
NP_441414.1_9 Reverse -120 -139 -10.0303 0.275
NP_442937.1_5 Reverse -115 -134 7.86593 0.241
NP_442937.1_5 Forward -134 -115 7.66927 0.244
NP_441317.1_4 Forward -19 -5 14.525 0.161
NP_441958.1_5 Forward -130 -120 12.2714 0.00183
NP_441958.1_5 Reverse -119 -129 12.2714 0.00183
NP_440318.1_1 Forward -115 -96 4.32602 0.24
NP_439905.1_1 Reverse -70 -83 6.31247 0.293
NP_440984.1_7 Reverse -115 -129 11.3077 0.122
NP_439990.1_1 Forward -167 -148 30.0887 0.000162
NP_439990.1_2 Forward -116 -97 28.2204 0.00179
NP_439990.1_3 Forward -356 -337 35.9886 0.00000465
NP_439990.1_4 Forward -86 -67 30.2854 0.0004
NP_439990.1_5 Forward -134 -121 23.3237 0.000299
NP_439990.1_5 Reverse -115 -128 10.934 0.128
NP_439990.1_5 Reverse -365 -378 6.21414 0.249
NP_439990.1_6 Forward -379 -360 24.5822 0.0118
NP_439990.1_7 Forward -299 -280 25.1722 0.0102
NP_439990.1_8 Forward -400 -381 29.5971 0.000655
NP_441338.2_5 Forward -357 -338 4.03102 0.299
NP_442911.1_2 Reverse -110 -129 17.0107 0.00821
NP_442911.1_2 Forward -139 -120 13.8641 0.0116
NP_442911.1_2 Reverse -360 -379 -8.55534 0.237
NP_440153.1_5 Reverse -67 -81 1.57289 0.248
NP_440153.1_8 Reverse -48 -61 -3.4223 0.295
NP_442064.1_4 Forward -67 -48 8.35677 0.232
NP_440200.1_5 Forward -314 -295 8.06259 0.235
NP_443055.1_3 Forward -166 -147 12.555 0.21
NP_443055.1_3 Forward -267 -248 11.6 0.25
NP_443055.1_6 Forward -122 -104 0.0184138 0.251
NP_440993.1_3 Forward -139 -120 12.3883 0.0825
NP_441099.1_5 Forward -139 -120 0.294447 0.0807
NP_441099.1_5 Reverse -155 -174 -4.72043 0.147
NP_441099.1_5 Reverse -110 -129 -10.3253 0.25
NP_442002.1_9 Forward -296 -289 11.3472 0.185
NP_440809.1_9 Forward -138 -120 -7.94566 0.225
NP_440475.1_1 Forward -115 -96 15.0585 0.137
NP_441294.1_7 Reverse -116 -130 9.15464 0.256
NP_441646.1_1 Reverse -41 -60 2.0644 0.221
NP_441646.1_1 Reverse -113 -132 1.96607 0.224
NP_441646.1_1 Forward -265 -246 -1.96717 0.298
NP_442438.1_10 Forward -80 -66 1.17956 0.204
NP_442438.1_10 Forward -134 -120 0.786239 0.213
NP_442438.1_10 Reverse -115 -129 0.0979218 0.239
NP_442438.1_10 Forward -339 -325 -0.688726 0.274
NP_440484.1_3 Forward -131 -117 11.2093 0.242
NP_440147.1_3 Reverse -253 -272 5.40766 0.24
NP_440147.1_4 Reverse -118 -131 18.9972 0.00328
NP_440147.1_4 Forward -131 -118 8.77074 0.0465
NP_440147.1_4 Reverse -46 -59 1.88757 0.216
NP_440147.1_4 Forward -297 -284 0.314277 0.257
NP_441175.1_7 Forward -129 -110 15.5357 0.0804
NP_441295.1_4 Reverse -49 -68 -0.295539 0.29
NP_441550.1_8 Forward -131 -121 15.1225 0.0132
NP_441550.1_8 Reverse -118 -128 14.6309 0.0132
NP_441916.1_7 Forward -129 -119 10.3048 0.0261
NP_441916.1_7 Reverse -120 -130 10.3048 0.0261
NP_441916.1_7 Forward -75 -65 2.83163 0.239
NP_440206.1_4 Forward -67 -48 3.04693 0.282
NP_440465.1_10 Forward -78 -59 1.67108 0.275
NP_440465.1_10 Reverse -63 -82 -0.983855 0.29
NP_441041.1_4 Forward -129 -110 -9.14533 0.213
NP_441041.1_4 Reverse -120 -139 -10.7186 0.236
NP_441041.1_7 Forward -132 -120 7.51478 0.162
NP_442396.1_5 Reverse -116 -129 12.114 0.0913
NP_442004.1_6 Forward -334 -320 1.57289 0.285
NP_440703.1_9 Reverse -48 -61 16.8333 0.138
NP_440703.1_9 Reverse -93 -106 10.8351 0.192
NP_441725.1_4 Forward -134 -120 4.42388 0.278
NP_441725.1_5 Forward -128 -118 2.04498 0.115
NP_441725.1_5 Reverse -121 -131 2.04498 0.115
NP_441725.1_5 Reverse -149 -159 -1.19994 0.294
NP_439966.1_7 Forward -131 -121 15.3192 0.0152
NP_439966.1_7 Reverse -146 -156 9.51767 0.109
NP_439966.1_7 Reverse -118 -128 7.25606 0.15
NP_439966.1_7 Reverse -368 -378 5.19112 0.24
NP_440736.1_3 Reverse -111 -130 -1.96717 0.299
NP_442941.1_3 Reverse -121 -131 19.2529 0.00262
NP_442941.1_3 Forward -128 -118 11.0914 0.0116
NP_440289.1_2 Forward -132 -119 3.06754 0.0811
NP_440289.1_2 Reverse -117 -130 -4.9956 0.294
NP_440983.1_5 Forward -72 -53 1.76941 0.207
NP_440260.1_8 Reverse -111 -129 -7.35568 0.295
NP_442281.1_1 Reverse -115 -129 8.84875 0.075
NP_442281.1_1 Forward -134 -120 8.45543 0.0808
NP_442575.1_8 Reverse -36 -55 -5.9004 0.277
NP_442256.1_2 Forward -131 -113 11.1305 0.0965
NP_442012.1_1 Forward -180 -161 3.6377 0.179
NP_442012.1_1 Reverse -57 -76 -0.000545616 0.249
NP_442012.1_2 Reverse -118 -137 3.93269 0.218
NP_441087.1_6 Reverse -267 -285 -1.16155 0.264
NP_441457.1_7 Forward -80 -61 -1.08219 0.293
NP_441556.1_10 Forward -134 -120 12.4606 0.195
NP_443030.1_4 Reverse -300 -319 -6.58872 0.288
NP_441644.1_6 Forward -129 -119 17.3841 0.00127
NP_441644.1_6 Reverse -120 -130 17.3841 0.00127
NP_441644.1_6 Reverse -165 -175 3.42118 0.282
NP_442215.1_2 Forward -131 -115 8.12167 0.0666
NP_442215.1_2 Reverse -118 -134 6.64671 0.0702
NP_442215.1_2 Forward -59 -43 -0.43312 0.167
NP_442029.1_1 Forward -169 -150 -20.0601 0.297
NP_442029.1_6 Reverse -115 -134 20.1573 0.0431
NP_442029.1_6 Forward -87 -68 12.0942 0.155
NP_440253.1_2 Reverse -120 -138 8.37728 0.0585
NP_440253.1_2 Forward -129 -111 0.904127 0.174
NP_440253.1_4 Forward -342 -323 22.2223 0.0236
NP_440929.1_8 Forward -129 -120 19.2726 0.000701
NP_440929.1_8 Reverse -120 -129 19.2726 0.000701
NP_440566.1_6 Forward -131 -112 13.3725 0.18
NP_442933.1_10 Forward -129 -120 17.601 0.00325
NP_442933.1_10 Reverse -120 -129 17.601 0.00325
NP_442933.1_10 Forward -379 -370 3.83464 0.283
NP_440576.1_2 Forward -23 -4 13.1758 0.188
NP_441751.2_8 Reverse -121 -135 5.01447 0.0448
NP_442926.1_1 Forward -75 -56 -5.99873 0.278
NP_440096.1_6 Forward -142 -123 13.1758 0.281
NP_442554.1_8 Reverse -121 -131 16.2046 0.0065
NP_442554.1_8 Forward -128 -118 15.3197 0.00882
NP_442554.1_8 Forward -378 -368 4.10993 0.198
NP_441762.1_7 Forward -130 -118 0.432302 0.0747
NP_441762.1_7 Forward -79 -67 -5.86088 0.246
NP_441762.1_7 Reverse -119 -131 -6.74586 0.284
NP_442142.1_4 Forward -132 -119 13.49 0.0348
NP_442142.1_4 Reverse -117 -130 2.96866 0.269
NP_442292.1_1 Forward -128 -119 18.486 0.00229
NP_442292.1_1 Reverse -121 -130 18.486 0.00229
NP_442476.1_6 Reverse -121 -135 2.2612 0.188
NP_440895.1_6 Forward -135 -122 18.6038 0.039
NP_441711.1_4 Reverse -111 -130 14.4541 0.053
NP_441711.1_4 Forward -66 -47 3.83436 0.232
NP_441523.1_6 Reverse -116 -135 3.83436 0.267
NP_443009.1_5 Reverse -119 -130 8.90795 0.0965
NP_443009.1_5 Forward -130 -119 8.90795 0.0965
NP_443009.1_5 Reverse -324 -335 5.36805 0.206
NP_441715.1_4 Reverse -121 -131 17.3846 0.0106
NP_441715.1_4 Forward -128 -118 7.94484 0.107
NP_441448.1_1 Forward -293 -274 7.57094 0.221
NP_441198.1_5 Forward -127 -114 14.67 0.206
NP_440464.1_10 Forward -128 -118 13.0082 0.169
NP_441468.1_1 Forward -128 -121 15.8704 0.0124
NP_441468.1_1 Reverse -121 -128 15.8704 0.0124
NP_441468.1_1 Forward -378 -371 10.2655 0.0906
NP_441020.2_3 Reverse -76 -95 10.0292 0.297
NP_441015.1_10 Reverse -61 -80 2.85105 0.145
NP_441015.1_10 Forward -134 -115 1.86774 0.157
NP_441015.1_10 Forward -166 -147 -7.96535 0.272
NP_441673.1_1 Forward -129 -120 20.8459 0.000698
NP_441673.1_1 Reverse -120 -129 20.8459 0.000698
NP_441876.1_9 Forward -326 -316 11.091 0.28
NP_441826.1_2 Forward -81 -67 -0.787057 0.224
NP_441826.1_2 Reverse -114 -128 -1.47537 0.248
NP_441826.1_2 Reverse -63 -77 -2.36035 0.271
NP_441826.1_2 Forward -135 -121 -2.65535 0.273
NP_441826.1_2 Reverse -165 -179 -3.34366 0.284
NP_441826.1_5 Reverse -49 -68 4.22769 0.259
NP_441330.1_1 Forward -134 -115 -12.9802 0.183
NP_442811.1_2 Reverse -52 -71 -0.295539 0.252
NP_441637.1_9 Forward -20 -2 4.54237 0.245
NP_442490.1_9 Reverse -42 -61 -5.11376 0.273
NP_442490.1_9 Reverse -48 -67 -5.31042 0.273
NP_442868.1_6 Forward -131 -121 19.2529 0.00563
NP_442868.1_6 Reverse -118 -128 9.81313 0.038
NP_442868.1_6 Forward -317 -307 2.43831 0.205
NP_442719.1_2 Reverse -277 -295 -5.38976 0.219
NP_442719.1_2 Forward -149 -131 -7.4547 0.234
NP_442719.1_2 Forward -20 -2 -11.3879 0.291
NP_441612.1_2 Reverse -120 -130 8.54929 0.21
NP_441612.1_2 Forward -129 -119 8.54929 0.21
NP_441612.1_2 Reverse -319 -329 6.70984 0.277
NP_442361.1_3 Reverse -114 -127 9.36073 0.276
NP_442808.1_1 Reverse -147 -157 12.0743 0.0481
NP_442808.1_1 Reverse -119 -129 8.63269 0.0481
NP_442808.1_1 Forward -130 -120 8.63269 0.0481
NP_441101.1_10 Reverse -62 -81 -7.57203 0.29
NP_440145.1_3 Forward -139 -120 -0.000545616 0.138
NP_442542.1_2 Forward -65 -52 9.45906 0.134
NP_442542.1_2 Reverse -163 -176 7.00078 0.197
NP_442113.1_10 Reverse -341 -360 -8.94866 0.289
NP_442050.1_1 Reverse -53 -72 13.4708 0.187
NP_442050.1_1 Forward -375 -356 7.37428 0.274
NP_442050.1_5 Forward -131 -121 14.3359 0.0206
NP_442050.1_5 Reverse -118 -128 7.64939 0.243
NP_440558.1_2 Reverse -322 -341 4.52268 0.152
NP_440558.1_2 Reverse -161 -180 -4.91709 0.249
NP_440558.1_2 Forward -138 -119 -5.9004 0.267
NP_442789.1_4 Forward -74 -55 -2.0655 0.233
NP_442789.1_4 Reverse -49 -68 -4.6221 0.261
NP_440923.1_9 Reverse -261 -280 9.24257 0.262
NP_441878.1_6 Forward -130 -120 10.4031 0.0176
NP_441878.1_6 Reverse -119 -129 10.4031 0.0176
NP_441878.1_6 Reverse -47 -57 2.53664 0.0363
NP_441878.1_6 Forward -158 -148 1.74999 0.0642
NP_441878.1_6 Forward -174 -164 1.55333 0.0937
NP_441878.1_6 Forward -380 -370 1.06167 0.116
NP_441878.1_6 Reverse -65 -75 0.668351 0.139
NP_441878.1_6 Forward -58 -48 0.57002 0.14
NP_441878.1_6 Reverse -164 -174 -6.60814 0.193
NP_441878.1_6 Forward -79 -69 -7.0998 0.204
NP_441878.1_6 Forward -76 -66 -7.98478 0.285
NP_441036.1_8 Forward -130 -120 8.33817 0.174
NP_441036.1_8 Reverse -119 -129 8.33817 0.174
NP_441557.1_5 Forward -129 -120 19.9609 0.000699
NP_441557.1_5 Reverse -120 -129 19.9609 0.000699
NP_441445.1_1 Forward -138 -119 6.88262 0.14
NP_441445.1_1 Forward -183 -164 3.83436 0.205
NP_442066.2_9 Forward -112 -99 8.47575 0.185
NP_440738.1_2 Reverse -70 -89 8.25926 0.183
NP_442830.1_5 Reverse -147 -161 6.19383 0.219
NP_441564.1_2 Forward -158 -139 10.5209 0.0727
NP_442397.1_9 Forward -63 -44 4.32602 0.254
NP_442397.1_9 Forward -129 -110 1.86774 0.283
NP_440979.1_6 Forward -61 -42 16.6174 0.27
NP_442135.1_4 Reverse -289 -308 16.8552 0.272
NP_441574.1_1 Forward -78 -59 -2.16383 0.224
NP_441549.1_9 Reverse -62 -80 4.05072 0.0925
NP_441549.1_9 Forward -82 -64 -10.7973 0.288
NP_442347.1_2 Forward -128 -119 12.4878 0.056
NP_442347.1_2 Reverse -121 -130 12.4878 0.056
NP_442645.1_2 Reverse -112 -131 -22.2233 0.29
NP_442645.1_2 Forward -137 -118 -22.715 0.293
NP_442888.1_9 Forward -346 -327 13.8641 0.235
NP_441037.1_4 Reverse -118 -128 7.9999 0.237
NP_442594.1_9 Forward -53 -34 7.07848 0.242
NP_441633.1_3 Forward -131 -118 3.46087 0.0699
NP_441633.1_3 Reverse -118 -131 1.19926 0.109
NP_441633.1_3 Forward -320 -307 -6.07724 0.236
NP_441633.1_3 Forward -77 -64 -6.07724 0.236
NP_442764.1_8 Reverse -153 -172 2.85105 0.275
NP_440136.1_2 Forward -128 -121 15.9687 0.0123
NP_440136.1_2 Reverse -121 -128 15.9687 0.0123
NP_442998.1_10 Forward -127 -120 15.5754 0.0102
NP_442998.1_10 Reverse -122 -129 15.5754 0.0102
NP_440899.1_5 Reverse -56 -75 1.86774 0.283
NP_440299.1_1 Reverse -116 -129 22.7331 0.000547
NP_440299.1_1 Forward -133 -120 20.2748 0.00128
NP_440299.1_1 Reverse -366 -379 6.11523 0.152
NP_440299.1_1 Forward -61 -48 5.82024 0.162
NP_440299.1_1 Reverse -50 -63 2.37867 0.291
NP_441799.1_1 Reverse -116 -130 6.98048 0.155
NP_441799.1_1 Forward -133 -119 6.58715 0.167
NP_441799.1_1 Reverse -62 -76 6.58715 0.167
NP_441007.1_10 Reverse -61 -74 0.707601 0.219
NP_441007.1_10 Reverse -115 -128 -0.964025 0.296
NP_442334.1_10 Reverse -48 -67 -16.3235 0.226
NP_442201.1_10 Reverse -109 -128 -4.81876 0.152
NP_442201.1_10 Reverse -308 -327 -13.8652 0.278
NP_440256.1_1 Forward -132 -113 2.16274 0.0669
NP_442007.1_3 Reverse -28 -47 14.7483 0.259
NP_441559.1_8 Forward -134 -120 12.4876 0.0574
NP_440915.1_6 Forward -133 -119 10.6193 0.0301
NP_440915.1_6 Reverse -116 -130 3.44117 0.101
NP_440997.1_7 Forward -43 -24 12.7825 0.13
NP_441704.1_8 Reverse -109 -128 9.7334 0.173
NP_440134.1_2 Forward -296 -277 2.0644 0.298
NP_442452.1_8 Forward -135 -121 11.2087 0.28
NP_441113.1_3 Reverse -1 -15 14.8469 0.27
NP_441199.1_6 Forward -67 -48 1.76941 0.209
NP_442993.1_1 Reverse -312 -328 -10.9545 0.231
NP_442993.1_1 Reverse -99 -115 -14.3961 0.299
NP_442386.1_9 Reverse -119 -128 13.8639 0.0289
NP_442386.1_9 Forward -130 -121 13.8639 0.0289
NP_442386.1_9 Forward -375 -366 9.34074 0.166
NP_440570.1_5 Forward -67 -48 2.85105 0.234
NP_441750.1_4 Forward -319 -300 1.0811 0.289
NP_441750.1_4 Forward -133 -114 0.58944 0.297
NP_441340.1_5 Forward -128 -121 15.6737 0.0124
NP_441340.1_5 Reverse -121 -128 15.6737 0.0124
NP_441340.1_5 Reverse -371 -378 4.07068 0.239
NP_442186.1_9 Forward -131 -112 7.66927 0.228
NP_439909.1_6 Reverse -178 -197 17.109 0.234
NP_442484.1_2 Reverse -109 -128 6.19431 0.156
NP_442484.1_2 Forward -140 -121 1.67108 0.227
NP_442240.1_2 Reverse -121 -140 -19.4701 0.295
NP_440586.1_1 Forward -85 -66 3.73603 0.202
NP_440586.1_1 Reverse -59 -78 -1.27885 0.237
NP_440586.1_1 Forward -76 -57 -1.47551 0.237
NP_440586.1_8 Forward -128 -121 13.2151 0.026
NP_440586.1_8 Reverse -121 -128 13.2151 0.026
NP_442251.1_6 Forward -128 -121 15.2804 0.0124
NP_442251.1_6 Reverse -121 -128 15.2804 0.0124
NP_440192.1_4 Reverse -256 -275 12.9873 0.169
NP_440684.1_9 Reverse -48 -62 6.6861 0.294
NP_441262.1_3 Reverse -120 -127 14.7888 0.0223
NP_441262.1_3 Forward -129 -122 14.7888 0.0223
NP_440027.1_3 Reverse -63 -81 5.42659 0.244
NP_443051.1_1 Reverse -119 -128 10.4228 0.00754
NP_443051.1_1 Forward -130 -121 10.4228 0.00754
NP_439937.1_9 Reverse -119 -136 -6.84499 0.157
NP_439937.1_9 Reverse -65 -82 -7.92662 0.171
NP_439937.1_9 Reverse -68 -85 -9.7949 0.209
NP_442374.1_7 Forward -275 -256 15.5357 0.261
NP_440439.1_1 Forward -132 -119 1.9859 0.138
NP_439943.1_4 Forward -302 -283 7.66927 0.26
NP_439943.1_7 Forward -134 -115 5.211 0.265
NP_440372.1_2 Forward -128 -121 16.3621 0.0124
NP_440372.1_2 Reverse -121 -128 16.3621 0.0124
NP_441789.1_7 Reverse -139 -158 -2.55791 0.257
NP_442285.1_7 Reverse -115 -134 3.73603 0.275
NP_440316.1_10 Forward -79 -69 6.56821 0.257
NP_441803.1_2 Reverse -58 -77 4.916 0.171
NP_441803.1_2 Reverse -301 -320 -0.295539 0.272
NP_441803.1_2 Forward -134 -115 -1.37718 0.298
NP_439977.1_5 Forward -135 -116 10.5209 0.0825
NP_439977.1_5 Reverse -364 -383 1.47442 0.192
NP_439977.1_8 Forward -24 -5 20.7672 0.151
NP_441572.1_7 Reverse -256 -275 -3.54046 0.215
NP_440267.1_2 Reverse -81 -95 5.99717 0.248
NP_442384.1_10 Reverse -120 -133 20.8655 0.00194
NP_442384.1_10 Forward -129 -116 17.7189 0.00567
NP_442384.1_10 Forward -75 -62 0.314277 0.294
NP_442262.1_10 Forward -128 -121 14.1988 0.0123
NP_442262.1_10 Reverse -121 -128 14.1988 0.0123
NP_441689.1_5 Forward -131 -121 5.78111 0.197
NP_441689.1_5 Reverse -118 -128 5.78111 0.197
NP_440344.1_10 Forward -136 -119 3.28376 0.0273
NP_440344.1_10 Forward -164 -147 -8.41762 0.127
NP_440344.1_10 Reverse -113 -130 -8.61428 0.13
NP_440344.1_10 Forward -113 -96 -12.0559 0.239
NP_440282.1_10 Reverse -56 -75 4.12936 0.125
NP_440282.1_10 Forward -67 -48 -6.88371 0.25
NP_440282.1_10 Forward -79 -60 -9.34199 0.277
NP_440531.1_6 Forward -65 -46 3.34271 0.147
NP_440531.1_6 Reverse -156 -175 -1.7705 0.239
NP_440531.1_6 Forward -137 -118 -5.01543 0.291
NP_440531.1_6 Reverse -105 -124 -5.50708 0.299
NP_442910.1_1 Forward -136 -117 0.196116 0.168
NP_440487.1_1 Reverse -48 -67 -5.21209 0.214
NP_441965.1_10 Reverse -117 -133 4.18844 0.247
NP_441640.1_1 Forward -333 -314 2.65439 0.287
NP_442750.1_3 Forward -31 -12 -2.26216 0.184
NP_440297.1_9 Forward -128 -118 -0.118297 0.282
NP_440297.1_9 Reverse -121 -131 -0.118297 0.282
NP_440297.1_9 Reverse -149 -159 -0.314959 0.282
NP_440297.1_9 Forward -62 -52 -0.41329 0.283
NP_441592.1_4 Forward -63 -44 -4.13045 0.296
NP_440894.1_10 Reverse -314 -333 4.62101 0.249
NP_440894.1_10 Forward -275 -256 2.85105 0.281
NP_440834.1_8 Reverse -70 -89 19.0757 0.126
NP_440999.1_9 Forward -133 -119 10.1277 0.055
NP_440999.1_9 Reverse -65 -79 9.2427 0.0667
NP_440999.1_9 Forward -79 -65 1.76955 0.158
NP_440999.1_9 Forward -322 -308 0.0979218 0.193
NP_440888.1_2 Reverse -120 -134 16.1252 0.00789
NP_440888.1_2 Forward -129 -115 13.372 0.0297
NP_440600.1_4 Reverse -112 -130 -1.75081 0.174
NP_440179.1_6 Forward -172 -153 3.14605 0.28
NP_440491.1_1 Forward -132 -113 18.9043 0.0345
NP_440052.1_5 Reverse -329 -348 -4.13045 0.249
NP_442033.1_10 Reverse -118 -137 -8.94866 0.21
NP_440575.1_1 Forward -27 -8 -0.984623 0.29
NP_442077.1_9 Reverse -374 -393 -5.70374 0.277
NP_441543.1_2 Forward -128 -119 16.9127 0.00359
NP_441543.1_2 Reverse -121 -130 16.9127 0.00359
NP_442845.1_2 Reverse -114 -128 6.19444 0.215
NP_442845.1_2 Forward -135 -121 3.93283 0.272
NP_440208.1_1 Reverse -318 -337 -8.65367 0.257
NP_441918.1_7 Forward -130 -111 -3.04881 0.297
NP_439904.1_4 Forward -302 -283 20.7301 0.123
NP_441469.1_8 Forward -79 -70 7.17789 0.227
NP_441469.1_8 Reverse -65 -74 7.07956 0.227
NP_441469.1_8 Forward -130 -121 6.48957 0.227
NP_441469.1_8 Reverse -119 -128 6.48957 0.227
NP_443064.1_6 Forward -129 -119 12.5669 0.0796
NP_443064.1_6 Reverse -120 -130 12.5669 0.0796
NP_442578.1_7 Forward -128 -121 14.5921 0.026
NP_442578.1_7 Reverse -121 -128 14.5921 0.026
NP_441462.1_2 Forward -129 -119 11.5831 0.00406
NP_441462.1_2 Reverse -120 -130 11.5831 0.00406
NP_441462.1_2 Forward -75 -65 -0.904945 0.265
NP_441621.1_7 Reverse -310 -324 -4.22864 0.214
NP_441621.1_7 Reverse -64 -78 -6.49025 0.295
NP_441621.1_7 Reverse -52 -66 -6.49025 0.295
NP_443062.1_1 Reverse -120 -138 5.23067 0.235
NP_443062.1_6 Forward -86 -67 1.57275 0.272
NP_440519.1_8 Reverse -307 -323 5.56507 0.21
NP_442204.1_1 Forward -133 -122 11.5634 0.0565
NP_442204.1_2 Forward -139 -120 8.84924 0.239
NP_442204.1_5 Forward -85 -66 10.6192 0.0873
NP_440504.1_7 Forward -62 -43 -4.81876 0.295
NP_441351.1_7 Forward -50 -31 20.1564 0.125
NP_440516.1_2 Forward -135 -117 2.28076 0.177
NP_440516.1_2 Forward -327 -309 -2.83245 0.299
NP_440516.1_8 Forward -129 -120 16.9127 0.00442
NP_440516.1_8 Reverse -120 -129 16.9127 0.00442
NP_442428.1_5 Forward -128 -121 15.8704 0.0124
NP_442428.1_5 Reverse -121 -128 15.8704 0.0124
NP_442428.1_5 Forward -378 -371 4.66067 0.244
NP_442120.1_10 Forward -147 -128 -13.9635 0.288
NP_441835.1_2 Forward -182 -163 3.83436 0.286
NP_441867.1_2 Reverse -252 -271 -13.6686 0.277
NP_440673.1_3 Forward -127 -120 12.4288 0.0426
NP_440673.1_3 Reverse -122 -129 12.4288 0.0426
NP_440673.1_3 Reverse -327 -334 8.98723 0.203
NP_440673.1_7 Reverse -109 -128 2.16274 0.232
NP_441052.1_2 Forward -129 -119 19.9412 0.00106
NP_441052.1_2 Reverse -120 -130 19.9412 0.00106
NP_441052.1_2 Reverse -48 -58 4.10993 0.166
NP_442219.1_9 Forward -128 -119 17.7976 0.00718
NP_442219.1_9 Reverse -121 -130 17.7976 0.00718
NP_440436.1_4 Forward -128 -119 17.2072 0.00233
NP_440436.1_4 Reverse -121 -130 17.2072 0.00233
NP_440436.1_4 Reverse -326 -335 8.75075 0.0995
NP_441884.1_9 Reverse -45 -64 -15.4385 0.138
NP_441884.1_9 Forward -132 -113 -22.715 0.284
NP_441884.1_9 Reverse -36 -55 -22.8133 0.284
NP_441884.1_9 Forward -78 -59 -23.4033 0.284
NP_441884.1_9 Reverse -304 -323 -28.4182 0.295
NP_442864.1_3 Reverse -114 -133 11.7008 0.181
NP_440314.1_9 Reverse -121 -140 -9.34199 0.264
NP_440648.1_1 Forward -129 -110 4.81767 0.219
NP_440577.1_2 Forward -385 -366 12.3892 0.233
NP_441719.1_4 Forward -128 -121 16.3621 0.0124
NP_441719.1_4 Reverse -121 -128 16.3621 0.0124
NP_441004.1_1 Reverse -48 -67 3.6377 0.106
NP_441004.1_1 Reverse -114 -133 -6.39206 0.186
NP_441004.1_2 Forward -345 -326 -3.83545 0.285
NP_441004.1_4 Reverse -162 -172 9.12481 0.259
NP_441004.1_4 Forward -337 -327 7.74818 0.289
NP_442366.1_3 Forward -130 -112 -5.48739 0.288
NP_442366.1_5 Reverse -117 -127 15.4175 0.0374
NP_442139.1_7 Forward -86 -67 7.37428 0.287
NP_440296.1_10 Reverse -45 -64 -14.7502 0.273
NP_441115.1_4 Reverse -254 -272 9.26148 0.221
NP_441115.1_9 Forward -70 -52 7.00065 0.288
NP_442206.1_1 Forward -75 -56 -11.2103 0.219
NP_442206.1_10 Reverse -120 -135 2.43817 0.201
NP_440328.1_4 Forward -324 -305 0.786102 0.239
NP_443054.1_2 Forward -131 -117 -0.393733 0.294
NP_441851.1_10 Forward -130 -120 15.8113 0.00552
NP_441851.1_10 Reverse -119 -129 15.8113 0.00552
NP_441851.1_10 Forward -158 -148 10.7964 0.0851
NP_442208.1_5 Reverse -307 -326 -0.688862 0.248
NP_441157.1_1 Reverse -291 -305 5.21053 0.249
NP_442622.1_3 Forward -339 -320 3.04771 0.215
NP_441542.1_4 Forward -220 -206 4.91614 0.264
NP_441668.1_4 Reverse -110 -129 8.75091 0.137
NP_441668.1_4 Reverse -38 -57 5.70265 0.165
NP_441668.1_4 Forward -183 -164 1.37609 0.215
NP_442515.1_1 Forward -130 -116 4.42448 0.107
NP_442515.1_1 Reverse -119 -133 2.16287 0.141
NP_442515.1_1 Forward -76 -62 -4.4253 0.298
NP_441683.1_7 Forward -158 -139 -12.9802 0.3
NP_440593.1_3 Reverse -115 -134 6.88262 0.112
NP_440593.1_3 Forward -62 -43 -4.81876 0.253
NP_440593.1_3 Reverse -160 -179 -7.4737 0.295
NP_440463.1_8 Reverse -56 -75 14.664 0.18
NP_441046.1_2 Forward -296 -277 1.86774 0.254
NP_442689.1_8 Reverse -277 -294 -4.68105 0.267
NP_441349.1_10 Forward -139 -120 -6.49039 0.23
NP_441409.1_6 Forward -135 -116 -7.86702 0.158
NP_440432.1_9 Forward -128 -113 -1.69173 0.167
NP_442843.1_1 Reverse -251 -270 -9.34199 0.265
NP_440474.1_8 Forward -320 -306 6.78381 0.219
NP_440474.1_8 Forward -77 -63 6.58715 0.222
NP_440431.1_3 Reverse -119 -138 14.2574 0.0393
NP_440431.1_3 Forward -130 -111 -11.5053 0.286
NP_442450.1_5 Reverse -118 -128 7.55152 0.13
NP_440588.1_2 Forward -84 -65 -1.86883 0.157
NP_440588.1_2 Reverse -45 -64 -3.54046 0.189
NP_440588.1_2 Reverse -60 -79 -5.50708 0.252
NP_440588.1_2 Forward -138 -119 -6.58872 0.285
NP_442006.1_2 Forward -166 -149 -17.2674 0.271
NP_441003.1_9 Forward -66 -47 7.96426 0.227
NP_440483.1_1 Reverse -214 -233 -2.16383 0.208
NP_442243.1_1 Forward -135 -117 14.473 0.106
NP_441570.1_1 Forward -95 -77 -1.84914 0.0598
NP_441570.1_1 Reverse -48 -66 -8.92897 0.124
NP_441570.1_1 Reverse -148 -166 -10.3056 0.166
NP_440078.1_10 Reverse -63 -82 10.0292 0.186
NP_440078.1_10 Reverse -54 -73 8.06259 0.215
NP_441078.1_4 Forward -129 -120 19.6659 0.0007
NP_441078.1_4 Reverse -120 -129 19.6659 0.0007
NP_441078.1_4 Reverse -48 -57 6.39124 0.0775
NP_441078.1_4 Forward -57 -48 -1.77023 0.266
NP_441078.1_4 Forward -75 -66 -1.96689 0.282
NP_441078.1_4 Reverse -148 -157 -2.06522 0.295
NP_441078.1_4 Forward -157 -148 -2.06522 0.295
NP_442729.1_8 Reverse -116 -129 9.36073 0.125
NP_441663.1_8 Forward -356 -337 -2.55715 0.271
NP_442443.1_1 Forward -83 -64 -3.14714 0.264
NP_440526.1_3 Reverse -121 -132 8.02298 0.126
NP_440526.1_3 Forward -128 -117 1.04151 0.267
NP_440526.1_3 Reverse -149 -160 0.844851 0.267
NP_441432.1_8 Reverse -119 -128 16.8143 0.00595
NP_441432.1_8 Forward -130 -121 16.8143 0.00595
NP_443024.1_5 Forward -357 -338 14.1591 0.119
NP_442320.1_8 Reverse -114 -128 4.22782 0.0522
NP_442320.1_8 Forward -135 -121 -2.06536 0.0851
NP_441732.1_2 Forward -133 -117 -6.52964 0.0495
NP_441732.1_2 Reverse -116 -132 -6.82463 0.0533
NP_441732.1_2 Reverse -44 -60 -16.2644 0.165
NP_440497.1_2 Reverse -49 -68 8.84924 0.208
NP_442540.1_5 Reverse -250 -269 16.4199 0.233
NP_440760.1_1 Forward -129 -110 -13.2752 0.1
NP_440760.1_1 Reverse -370 -389 -16.9135 0.189
NP_440760.1_1 Reverse -120 -139 -22.0267 0.248
NP_442797.1_7 Forward -323 -305 0.412472 0.274
NP_440578.1_4 Forward -385 -366 11.3075 0.247
NP_442353.1_4 Reverse -114 -133 9.24175 0.137
NP_440713.1_4 Forward -139 -120 7.86593 0.174
NP_442489.1_2 Forward -134 -115 10.3242 0.168
NP_442489.1_7 Forward -129 -120 20.1576 0.000695
NP_442489.1_7 Reverse -120 -129 20.1576 0.000695
NP_442489.1_7 Reverse -48 -57 -1.37691 0.195
NP_442489.1_7 Forward -75 -66 -1.47524 0.203
NP_442489.1_7 Forward -157 -148 -1.57357 0.213
NP_442079.1_7 Reverse -121 -140 4.71934 0.187
NP_440559.1_1 Forward -128 -119 17.4043 0.00658
NP_440559.1_1 Reverse -121 -130 17.4043 0.00658
NP_441659.2_8 Forward -129 -119 18.1713 0.00133
NP_441659.2_8 Reverse -120 -130 18.1713 0.00133
NP_441022.1_1 Forward -120 -111 10.7788 0.285
NP_440363.1_9 Forward -267 -249 12.7038 0.265
NP_442913.1_9 Reverse -114 -133 10.3242 0.219
NP_442913.1_10 Reverse -111 -130 2.3594 0.126
NP_441040.1_2 Forward -83 -64 -8.35868 0.236
NP_441040.1_2 Forward -326 -307 -15.3402 0.286
NP_441040.1_5 Reverse -115 -134 6.68596 0.229
NP_439956.1_7 Forward -264 -245 3.14605 0.261
NP_441800.1_7 Reverse -64 -82 -3.42244 0.279
NP_440779.1_5 Forward -109 -92 -14.5141 0.246
NP_442346.1_5 Forward -130 -120 16.6963 0.00248
NP_442346.1_5 Reverse -119 -129 16.6963 0.00248
NP_442346.1_5 Forward -380 -370 4.20827 0.296
NP_440545.1_3 Forward -79 -62 5.64371 0.0607
NP_440545.1_3 Reverse -116 -133 3.97208 0.0764
NP_440545.1_3 Forward -61 -44 1.51381 0.118
NP_440545.1_3 Reverse -62 -79 -4.38605 0.224
NP_440545.1_3 Reverse -65 -82 -6.54933 0.283
NP_442929.1_7 Reverse -53 -72 11.7008 0.155
NP_440486.1_6 Reverse -308 -327 8.94757 0.235
NP_440459.1_2 Forward -131 -114 9.38028 0.229
NP_440459.1_2 Reverse -111 -128 8.69197 0.253
NP_440010.1_4 Forward -67 -48 2.6536 0.222
NP_442551.1_4 Forward -59 -44 -0.118434 0.245
NP_442603.1_7 Reverse -120 -134 18.7801 0.0119
NP_442603.1_7 Forward -129 -115 13.2736 0.0897
NP_442603.1_7 Reverse -69 -83 5.70218 0.277
NP_441888.1_7 Forward -264 -250 4.03116 0.225
NP_441888.1_7 Forward -134 -120 3.73617 0.225
NP_441948.1_4 Forward -164 -146 -3.22577 0.189
NP_441502.1_3 Forward -131 -112 12.2908 0.21
NP_441833.1_4 Forward -128 -121 15.9687 0.0124
NP_441833.1_4 Reverse -121 -128 15.9687 0.0124
NP_442162.1_9 Forward -128 -121 16.2637 0.0124
NP_442162.1_9 Reverse -121 -128 16.2637 0.0124
NP_440671.1_4 Forward -135 -121 8.84938 0.188
NP_440671.1_4 Reverse -54 -68 4.91614 0.3
NP_442404.1_9 Reverse -123 -137 8.16044 0.296
NP_440224.1_1 Forward -140 -121 2.26107 0.132
NP_440017.1_4 Forward -171 -153 12.9005 0.268
NP_442199.1_5 Forward -137 -118 -1.7705 0.181
NP_442140.1_3 Forward -128 -118 12.2714 0.0632
NP_442140.1_3 Reverse -121 -131 10.3048 0.0902
NP_442140.1_3 Forward -320 -310 5.97822 0.189
NP_442140.1_3 Forward -378 -368 4.0116 0.265
NP_440875.1_9 Reverse -367 -377 8.95605 0.233
NP_440875.1_9 Reverse -122 -132 8.37203 0.233
NP_441813.1_5 Forward -131 -121 18.1713 0.00743
NP_441813.1_5 Reverse -118 -128 8.63316 0.0367
NP_441813.1_7 Reverse -69 -83 10.0287 0.235
NP_440590.1_4 Forward -128 -115 17.6205 0.00882
NP_440590.1_4 Reverse -121 -134 14.7689 0.0106
NP_440590.1_4 Forward -340 -327 -1.55401 0.223
NP_440567.1_1 Forward -128 -114 11.7993 0.0267
NP_440567.1_1 Reverse -121 -135 0.392915 0.246
NP_442497.1_10 Forward -128 -119 10.4228 0.0087
NP_442497.1_10 Reverse -121 -130 10.4228 0.0087
NP_440821.1_4 Reverse -118 -128 9.41981 0.0286
NP_440821.1_4 Forward -131 -121 9.41981 0.0286
NP_441239.1_9 Forward -175 -163 9.67541 0.0987
NP_441239.1_9 Forward -131 -119 5.25052 0.223
NP_441239.1_9 Forward -381 -369 3.57889 0.283
NP_441239.1_9 Reverse -118 -130 3.38223 0.285
NP_441239.1_9 Forward -266 -254 3.18557 0.292
NP_442897.1_5 Reverse -320 -339 15.9007 0.297
NP_441892.1_1 Forward -166 -149 -1.63279 0.21
NP_440665.1_1 Forward -72 -53 -5.11376 0.193
NP_442643.1_3 Forward -234 -215 -6.29373 0.261
NP_442629.1_5 Forward -344 -330 15.6342 0.279
NP_440833.1_6 Reverse -284 -298 17.4035 0.134
NP_440354.1_7 Reverse -306 -324 7.88563 0.26
NP_441617.1_3 Reverse -187 -206 8.45592 0.196
NP_440391.1_7 Forward -180 -161 6.39016 0.273
NP_442052.1_8 Forward -381 -371 13.1564 0.253
NP_440546.1_4 Forward -129 -119 10.046 0.109
NP_440546.1_4 Reverse -120 -130 10.046 0.109
NP_443033.1_3 Reverse -371 -390 10.2259 0.268
NP_440675.1_3 Forward -48 -29 10.9142 0.186
NP_440462.1_6 Forward -131 -121 9.61647 0.0429
NP_440462.1_6 Reverse -118 -128 1.35667 0.294
NP_442340.1_3 Reverse -50 -69 -1.37718 0.187
NP_440868.1_4 Forward -133 -121 8.00379 0.0602
NP_440868.1_4 Reverse -116 -128 -0.944332 0.284
NP_442402.1_2 Reverse -275 -289 14.8469 0.263
NP_442402.1_4 Forward -337 -318 -7.57277 0.276
NP_440653.1_10 Forward -128 -109 16.9124 0.0798
NP_440653.1_10 Reverse -121 -140 3.34271 0.277
NP_440843.1_8 Reverse -255 -274 12.8808 0.297
NP_442039.1_4 Forward -128 -121 15.1821 0.0124
NP_442039.1_4 Reverse -121 -128 15.1821 0.0124
NP_442039.1_7 Forward -319 -309 8.1415 0.264
NP_442039.1_7 Forward -377 -367 7.05986 0.283
NP_441811.1_4 Forward -80 -61 0.392778 0.295
NP_441811.1_8 Reverse -319 -333 5.80112 0.289
NP_440825.1_7 Forward -128 -118 12.9096 0.152
NP_442837.1_3 Forward -128 -121 15.7721 0.0124
NP_442837.1_3 Reverse -121 -128 15.7721 0.0124
NP_442053.1_1 Forward -129 -120 18.3876 0.0007
NP_442053.1_1 Reverse -120 -129 18.3876 0.0007
NP_440505.1_3 Forward -131 -121 18.3679 0.00213
NP_440505.1_3 Reverse -118 -128 9.22315 0.122
NP_440505.1_7 Reverse -113 -132 2.45773 0.235
NP_441252.1_6 Forward -298 -291 14.3954 0.168
NP_441203.1_1 Forward -128 -109 -12.6852 0.144
NP_441203.1_1 Reverse -121 -140 -19.3717 0.297
NP_442255.1_1 Reverse -87 -106 8.55425 0.266
NP_442255.1_3 Forward -125 -106 15.6341 0.182
NP_440914.1_1 Forward -129 -119 17.5935 0.000537
NP_440914.1_1 Reverse -120 -130 17.5935 0.000537
NP_441011.1_8 Forward -128 -119 8.25953 0.144
NP_441011.1_8 Reverse -121 -130 8.25953 0.144
NP_442101.1_10 Reverse -112 -131 -10.4236 0.255
NP_442533.1_6 Forward -129 -120 17.2076 0.00137
NP_442533.1_6 Reverse -120 -129 17.2076 0.00137
NP_442533.1_6 Reverse -66 -75 12.2911 0.0304
NP_442533.1_6 Reverse -148 -157 7.17789 0.0948
NP_442533.1_6 Reverse -48 -57 4.91628 0.165
NP_442533.1_6 Reverse -370 -379 2.94966 0.232
NP_442533.1_6 Reverse -165 -174 2.06468 0.275
NP_442533.1_6 Reverse -255 -264 1.96635 0.28
NP_442533.1_6 Forward -108 -99 1.67135 0.293
NP_442533.1_6 Forward -78 -69 1.67135 0.293
NP_442232.1_3 Reverse -317 -336 -0.295539 0.151
NP_441482.1_7 Forward -135 -121 -0.688726 0.0612
NP_441482.1_7 Reverse -114 -128 -10.4235 0.209
NP_441482.1_7 Reverse -48 -62 -11.5051 0.268
NP_439944.1_9 Forward -128 -118 10.5014 0.0887
NP_439944.1_9 Reverse -121 -131 10.5014 0.0887
NP_439944.1_9 Forward -378 -368 5.09324 0.277
NP_442203.1_3 Reverse -12 -31 5.36445 0.268
NP_441028.1_6 Forward -327 -317 4.10949 0.278
NP_440116.1_8 Forward -128 -109 -3.24547 0.15
NP_440116.1_8 Reverse -121 -140 -7.4737 0.231
NP_441527.1_4 Reverse -4 -23 14.4666 0.0458
NP_441527.1_4 Reverse -3 -22 -2.91293 0.162
NP_441527.1_4 Reverse -5 -24 -12.5576 0.291
NP_440115.1_6 Forward -132 -122 16.008 0.0325
NP_440007.1_9 Forward -133 -119 8.25939 0.18
NP_441961.1_2 Reverse -337 -356 18.3873 0.0583
NP_440903.1_2 Forward -286 -276 16.598 0.247
NP_441170.1_4 Reverse -57 -75 2.37909 0.285
NP_441972.1_5 Reverse -121 -140 -1.96717 0.178
NP_441972.1_5 Reverse -49 -68 -3.04881 0.196
NP_441972.1_5 Forward -128 -109 -3.73712 0.201
NP_441972.1_5 Forward -74 -55 -6.29373 0.229
NP_441106.1_1 Forward -130 -121 9.63616 0.0311
NP_441106.1_1 Reverse -119 -128 9.63616 0.0311
NP_441106.1_1 Forward -76 -67 2.458 0.283
NP_440429.1_9 Reverse -48 -67 0.0977854 0.297
NP_440646.1_4 Reverse -57 -76 12.1925 0.128
NP_439903.1_6 Forward -144 -125 -0.984623 0.289
NP_442588.1_6 Reverse -251 -270 5.211 0.175
NP_442306.1_10 Forward -83 -64 -20.5517 0.213
NP_441286.1_1 Forward -130 -118 12.9203 0.00815
NP_441286.1_1 Reverse -119 -131 12.9203 0.00815
NP_442674.1_3 Reverse -40 -59 2.55527 0.3
NP_440670.1_8 Forward -129 -120 18.3876 0.000699
NP_440670.1_8 Reverse -120 -129 18.3876 0.000699
NP_441705.1_3 Forward -301 -282 -0.000545616 0.279
NP_441705.1_3 Reverse -171 -190 -6.49039 0.291
NP_440886.1_7 Forward -130 -120 7.94438 0.0805
NP_440886.1_7 Reverse -119 -129 7.94438 0.0805
NP_440886.1_7 Reverse -68 -78 6.66608 0.115
NP_440886.1_7 Reverse -147 -157 5.48612 0.181
NP_440886.1_7 Forward -70 -60 5.09279 0.201
NP_442614.1_2 Forward -350 -336 9.63603 0.242
NP_442614.1_2 Reverse -120 -134 9.14437 0.242
NP_442072.1_9 Forward -130 -112 -11.9772 0.0799
NP_442072.1_9 Reverse -65 -83 -22.1053 0.22
NP_442072.1_9 Forward -272 -254 -22.892 0.266
NP_442213.1_5 Reverse -41 -60 3.04771 0.231
NP_442213.1_5 Forward -86 -67 0.0977854 0.273
NP_440028.1_6 Forward -368 -350 12.4089 0.24
NP_440907.2_8 Forward -128 -118 7.64939 0.117
NP_439999.1_8 Reverse -314 -333 15.1416 0.236
NP_441021.1_1 Forward -128 -109 -9.44032 0.216
NP_441021.1_1 Reverse -121 -140 -11.7019 0.272
NP_441021.1_8 Forward -162 -144 3.85406 0.226
NP_441463.1_3 Reverse -59 -78 -4.52377 0.207
NP_441626.1_2 Forward -128 -121 15.7721 0.0124
NP_441626.1_2 Reverse -121 -128 15.7721 0.0124
NP_442365.1_7 Forward -133 -114 0.491109 0.177
NP_440107.1_5 Forward -73 -54 7.57094 0.139
NP_442794.1_1 Forward -133 -121 20.0002 0.00523
NP_442794.1_1 Reverse -116 -128 19.1152 0.00716
NP_442794.1_1 Forward -99 -87 7.70879 0.132
NP_442615.1_1 Reverse -111 -129 -0.472507 0.116
NP_442615.1_1 Forward -138 -120 -1.84914 0.134
NP_441962.1_4 Forward -77 -58 -2.26216 0.132
NP_441962.1_4 Reverse -320 -339 -3.24547 0.143
NP_441962.1_4 Forward -134 -115 -12.3902 0.256
NP_441962.1_4 Reverse -115 -134 -14.6519 0.291
NP_440387.1_1 Forward -129 -113 14.3165 0.00649
NP_441431.1_2 Forward -132 -118 10.422 0.159
NP_441431.1_2 Reverse -70 -84 7.07881 0.251
NP_441488.1_7 Reverse -60 -79 5.70265 0.155
NP_441488.1_7 Forward -84 -65 3.34271 0.227
NP_441488.1_8 Reverse -115 -129 10.9137 0.146
NP_441488.1_8 Forward -134 -120 9.73373 0.146
NP_441836.1_2 Reverse -114 -133 -2.65548 0.23
NP_441836.1_2 Forward -135 -116 -5.60541 0.284
NP_441993.1_1 Reverse -114 -133 8.67125 0.141
NP_441993.1_1 Reverse -48 -67 8.57379 0.144
NP_441993.1_1 Forward -78 -59 4.09075 0.225
NP_441993.1_1 Reverse -36 -55 2.53143 0.257
NP_441174.1_4 Forward -355 -345 10.9931 0.288
NP_440467.1_3 Reverse -121 -140 14.5767 0.158
NP_440114.1_10 Reverse -325 -339 6.29277 0.276
NP_442733.1_10 Forward -347 -328 20.7473 0.134
NP_440293.1_3 Reverse -40 -59 0.196116 0.224
NP_439988.1_3 Reverse -43 -57 8.06273 0.266
NP_439988.1_7 Forward -319 -305 17.0102 0.292
NP_441237.1_9 Forward -128 -118 14.828 0.0242
NP_442743.1_1 Reverse -273 -292 4.22689 0.296
NP_441311.1_2 Reverse -114 -128 13.8636 0.229
NP_439910.1_2 Forward -137 -120 -22.3806 0.232
NP_442867.1_8 Reverse -150 -169 10.6192 0.206
NP_440457.1_1 Forward -161 -149 14.002 0.0753
NP_440457.1_1 Forward -133 -121 7.61046 0.101
NP_440213.1_5 Forward -185 -166 15.6341 0.186
NP_442297.1_4 Reverse -116 -135 13.4051 0.245
NP_441984.1_1 Reverse -256 -274 5.23069 0.296
NP_441984.1_3 Forward -112 -94 10.7372 0.184
NP_440473.1_1 Forward -132 -113 11.643 0.267
NP_442509.1_9 Forward -129 -119 8.14104 0.192
NP_442509.1_9 Reverse -120 -130 8.14104 0.192
NP_442514.1_5 Reverse -112 -131 -4.32786 0.239
NP_442514.1_5 Forward -137 -118 -8.75273 0.29
NP_440554.1_4 Reverse -121 -131 8.92815 0.0646
NP_442862.1_3 Forward -292 -275 6.62702 0.263
NP_441885.1_5 Forward -129 -119 20.9245 0.000538
NP_441885.1_5 Reverse -120 -130 20.9245 0.000538
NP_441885.1_5 Reverse -48 -58 0.471689 0.145
NP_440478.1_4 Forward -133 -114 15.2408 0.158
NP_440478.1_4 Reverse -116 -135 14.1591 0.171
NP_440478.1_10 Reverse -118 -132 7.9644 0.257
NP_441428.1_8 Reverse -58 -77 2.85105 0.262
NP_442341.1_7 Forward -130 -116 17.4042 0.012
NP_442341.1_7 Reverse -119 -133 9.2427 0.0751
NP_442341.1_7 Reverse -318 -332 2.45787 0.256
NP_441756.1_5 Forward -66 -47 -1.37718 0.255
NP_441756.1_5 Reverse -154 -173 -4.03212 0.29
NP_441756.1_5 Forward -67 -48 -4.81876 0.296
NP_441173.1_9 Reverse -280 -288 9.75379 0.284
NP_442395.2_4 Forward -64 -45 0.0970122 0.279
NP_440423.1_6 Forward -165 -146 -14.6519 0.229
NP_443000.1_7 Forward -131 -121 19.9412 0.00223
NP_443000.1_7 Reverse -118 -128 10.3048 0.0345
NP_441842.1_10 Forward -341 -327 8.75105 0.211
NP_441842.1_10 Reverse -113 -127 7.17775 0.264
NP_440275.1_3 Forward -131 -121 15.123 0.0182
NP_440275.1_3 Reverse -118 -128 8.04317 0.0602
NP_440275.1_3 Reverse -310 -320 4.69992 0.178
NP_443046.1_7 Forward -113 -94 16.0274 0.141
NP_442275.1_1 Forward -66 -47 1.86774 0.284
NP_440679.1_10 Forward -82 -63 -18.1918 0.278
NP_440679.1_10 Reverse -300 -319 -19.8634 0.283
NP_441359.1_5 Forward -274 -255 1.0811 0.29
NP_442451.1_2 Forward -244 -225 -11.6036 0.297
NP_439962.1_4 Reverse -65 -84 -8.16202 0.292
NP_440804.1_4 Reverse -15 -24 16.716 0.145
NP_440149.1_8 Forward -129 -110 4.32602 0.084
NP_440149.1_8 Forward -75 -56 -5.31042 0.223
NP_441105.1_3 Forward -140 -121 8.65258 0.0474
NP_441105.1_3 Forward -185 -166 -6.1954 0.23
NP_440216.1_1 Reverse -120 -134 -0.492064 0.0284
NP_440216.1_1 Forward -129 -115 -0.787057 0.0284
NP_440216.1_1 Reverse -66 -80 -11.3085 0.178
NP_440216.1_9 Reverse -127 -136 8.65285 0.286
NP_440172.1_1 Forward -129 -119 15.0247 0.00945
NP_440172.1_1 Reverse -120 -130 15.0247 0.00945
NP_440172.1_6 Forward -366 -347 5.70265 0.278
NP_442015.1_10 Forward -133 -120 21.1604 0.00329
NP_442015.1_10 Reverse -116 -129 11.229 0.0372
NP_441226.1_7 Forward -128 -121 14.4934 0.0123
NP_441226.1_7 Reverse -121 -128 14.4934 0.0123
NP_441757.1_3 Forward -130 -111 1.47442 0.162
NP_441111.1_7 Forward -128 -120 18.7023 0.00294
NP_441111.1_7 Reverse -121 -129 18.7023 0.00294
NP_441766.1_2 Forward -129 -120 17.5026 0.00297
NP_441766.1_2 Reverse -120 -129 17.5026 0.00297
NP_442417.1_5 Forward -129 -115 9.14437 0.138
NP_442252.1_4 Reverse -249 -268 16.0274 0.225
NP_440416.1_9 Reverse -113 -132 0.58944 0.0513
NP_440416.1_9 Forward -136 -117 -15.0452 0.184
NP_443052.1_9 Reverse -154 -173 5.01433 0.149
NP_443052.1_9 Reverse -146 -165 -5.21209 0.265
NP_442226.1_8 Reverse -386 -396 14.828 0.256
NP_442226.1_8 Reverse -180 -190 14.238 0.26
NP_442564.1_9 Forward -334 -320 18.8577 0.063
NP_440261.1_5 Reverse -121 -134 4.93583 0.0478
NP_440261.1_5 Forward -74 -61 -4.40561 0.147
NP_440261.1_5 Reverse -70 -83 -6.66722 0.201
NP_440261.1_5 Forward -128 -115 -10.3055 0.201
NP_440988.1_10 Reverse -118 -132 6.44783 0.232
NP_440988.1_10 Reverse -163 -177 6.15739 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGCCCAGTCAAAATAAACTTGAGCGCTGGCAACGCATTGTCACGGAAGCGGCGGAACAGTCGGAGCGGCAATGGTTACCCCCGGTGGCAGCCCCGTTAACGTTTGGGCAATTTGTGGAGAAAGTTGCAGGGCCAGAAACCCTGGCCTTGCTCTGTGTGACCCGTTTAAATAGCCCCATGCTTGGGGCATACTTGAAACAGAGTAATTTACCAGCCCAAATTGTCTTGGCCACTGGCCCAGAAGGGGGATGGACGGATAACGAAATTTCCCTGGCGATCGCCAAAGGGTTTCAGCCGGTGTCCCTTGGTAAACGCATTTTGCGGGCGGTGACGGCCCCCACGGTGGCCCTAGCCCAGATCAATGCTCTGTTGGAAAGCTAATTTTTTTGGCCCTTTTCCCT

CDS

ATGTATAAAGCCATTGCCGATGCCATTGACAGCCAAGACCTGGCCACAGCGGAGCAACTGTTGGCAGCGATGGAGGGGGAGAGTTGGGAAAATCCCATGACGGCCTATTACCAAGCTCGGCTGGCGGAAGCCCAAGGAAATTTGGATGAGGCGGAGCAAAAATTTCGGCAATTGTTGACTACTAGCCATAGTCCCCAACTAGTGGCCAAAATTAGGGCGGGACTGGGTCGCATTCAAGCCCATCGCCAAGCAGAATACCAGGCGGCCATTGAGGACGCTAAGGCAGATCCAGAGGCCCAGTCGGTGGGCATTTTTGTGTTGGAACCGGTTCCTCCAGCGGAAAAGCAAGCCAAGGCAGTACAGTTTGGCAAAATTATGGCCATAGACCCCTACACCGCTCGGCTCCAATTACCCAGTCGGGCGTGGCGGCTCTATCGCACCGGGGCGATCGGGGAATTGAACCATTACCATCAGCAATGTCAGGCCGCAGGGATTCCTAGTTTTTCGGTGGCGTTGGCGGACATTTTGGCGGTGAAAGTTTTCCCGATTTTCCACATTGAAAGTTTGTCCCCAGAGGTCACCGTTACCTATCGGATTAGTCGAGAAGAAGAAGGCACTTTTAGTTTTAGTTGGCAAGATGTCAGTCAAATGGTGGAGGGTTTATTACCCATTTTTGAGGAATGTGTGGATGTGAATATGCGGGGCAAAATCCAGCGCAAAACGGAAATTTTAGATTACGCCCACATTTGTGATTTACATTTACCGCAACAGCAAATTATTCTCCGTTTTTGTGACCAAATTTATGAGTTTACCCGGGGAATCAGTCTAGACACTGCTAACTCTAGTAAGGAGAAGCAAGGAACTTCCCACCAACAATGGCAACAACTGAGCCGCATTTGGCAAACAAATTTACCAGGTAAGCCGGTCTGGAAGGAGTTCAAAGCCTTTGCAGAAACGGCCCTAGATTTTCAGGAATTACTCAAATCAGTGGAGCCCCACATTCCCTTTCTACGGCGGGAAGATACCAATTGGGATCGGGCTTTCCATCTCTACAGCACCCTGGCCTTCTGCCGCGATCGCCGTTTGGAATGA

Protein

MYKAIADAIDSQDLATAEQLLAAMEGESWENPMTAYYQARLAEAQGNLDEAEQKFRQLLTTSHSPQLVAKIRAGLGRIQAHRQAEYQAAIEDAKADPEAQSVGIFVLEPVPPAEKQAKAVQFGKIMAIDPYTARLQLPSRAWRLYRTGAIGELNHYHQQCQAAGIPSFSVALADILAVKVFPIFHIESLSPEVTVTYRISREEEGTFSFSWQDVSQMVEGLLPIFEECVDVNMRGKIQRKTEILDYAHICDLHLPQQQIILRFCDQIYEFTRGISLDTANSSKEKQGTSHQQWQQLSRIWQTNLPGKPVWKEFKAFAETALDFQELLKSVEPHIPFLRREDTNWDRAFHLYSTLAFCRDRRLE