Your browser is old and dusty. Try Google Chrome!

Details for slr0712

ORF slr0712
Accession NP_442687.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -352 -338 11.0127 0.0548
NP_441061.1_2 Reverse -345 -359 -2.36035 0.29
NP_441061.1_2 Reverse -289 -303 -2.55701 0.296
NP_440795.1_7 Forward -352 -345 14.6904 0.0123
NP_440795.1_7 Reverse -345 -352 14.6904 0.0123
NP_440795.1_7 Forward -296 -289 10.2655 0.154
NP_441418.1_6 Reverse -344 -363 -10.817 0.0397
NP_441605.1_1 Forward -253 -234 13.0775 0.19
NP_442291.1_5 Forward -354 -338 7.04003 0.0657
NP_441453.1_4 Reverse -344 -352 16.539 0.00633
NP_441453.1_4 Forward -353 -345 7.8859 0.0536
NP_441453.1_4 Reverse -288 -296 4.05099 0.268
NP_442151.1_6 Forward -353 -339 8.06273 0.183
NP_442151.1_6 Reverse -288 -302 5.30946 0.284
NP_441818.1_1 Forward -352 -341 15.8894 0.0244
NP_441818.1_9 Forward -311 -292 -8.16202 0.274
NP_440226.1_1 Reverse -344 -363 15.5357 0.0245
NP_442744.1_9 Reverse -338 -352 15.5501 0.266
NP_442173.1_1 Forward -352 -344 15.4574 0.00633
NP_442173.1_1 Reverse -345 -353 8.27922 0.101
NP_442752.1_4 Reverse -344 -351 13.8055 0.0199
NP_442752.1_4 Forward -9 -2 4.95566 0.26
NP_443027.1_4 Reverse -342 -352 14.0414 0.0452
NP_443027.1_4 Forward -355 -345 7.74818 0.235
NP_441812.1_1 Reverse -296 -310 12.8803 0.247
NP_441812.1_3 Reverse -343 -357 13.9626 0.146
NP_441812.1_3 Forward -354 -340 6.78443 0.291
NP_441812.1_8 Forward -221 -202 19.4742 0.192
NP_442975.1_10 Forward -357 -343 12.782 0.0459
NP_440784.1_7 Forward -352 -345 15.9687 0.0123
NP_440784.1_7 Reverse -345 -352 15.9687 0.0123
NP_442909.1_7 Forward -352 -338 8.94708 0.161
NP_442909.1_7 Forward -358 -344 7.3738 0.219
NP_440061.1_9 Reverse -286 -300 11.602 0.107
NP_442062.1_8 Reverse -344 -354 11.1898 0.0493
NP_442062.1_8 Forward -353 -343 7.84651 0.0871
NP_442062.1_8 Forward -231 -221 4.89658 0.193
NP_442062.1_8 Reverse -288 -298 4.50326 0.212
NP_441859.1_3 Reverse -343 -362 1.76863 0.275
NP_440304.1_4 Reverse -342 -352 10.8948 0.051
NP_442242.1_4 Forward -352 -345 14.3954 0.0124
NP_442242.1_4 Reverse -345 -352 14.3954 0.0124
NP_441781.1_7 Forward -297 -278 -2.75381 0.289
NP_441594.1_6 Forward -300 -281 -0.000545616 0.294
NP_442742.1_1 Forward -107 -88 16.0274 0.189
NP_442726.1_1 Forward -358 -339 7.57094 0.292
NP_440769.1_8 Reverse -44 -63 17.8957 0.0682
NP_440769.1_8 Reverse -357 -376 12.7825 0.159
NP_441083.1_3 Forward -298 -288 15.2208 0.138
NP_441083.1_5 Forward -353 -343 19.0562 0.00147
NP_441083.1_5 Reverse -344 -354 1.65166 0.2
NP_441083.1_5 Forward -297 -287 1.16001 0.215
NP_441083.1_5 Reverse -288 -298 0.963343 0.218
NP_442827.1_8 Forward -361 -342 -1.08295 0.241
NP_441738.1_2 Forward -351 -344 15.28 0.0102
NP_441738.1_2 Reverse -239 -246 6.72528 0.236
NP_441558.1_5 Forward -299 -280 9.14423 0.129
NP_440209.1_1 Reverse -344 -352 18.1123 0.00295
NP_440209.1_1 Forward -353 -345 15.1624 0.00583
NP_442889.1_8 Forward -356 -342 10.6187 0.0817
NP_440407.1_6 Reverse -331 -345 18.5841 0.212
NP_440447.1_1 Reverse -243 -261 4.44404 0.226
NP_442398.1_4 Forward -109 -90 19.6648 0.0804
NP_440178.1_7 Forward -298 -279 -21.0434 0.207
NP_442706.1_5 Reverse -118 -137 15.5543 0.245
NP_440538.1_10 Reverse -286 -305 17.5024 0.154
NP_440331.1_5 Forward -167 -148 0.687771 0.0225
NP_441163.1_9 Forward -362 -343 15.1424 0.224
NP_440906.1_5 Forward -352 -345 15.8704 0.0124
NP_440906.1_5 Reverse -345 -352 15.8704 0.0124
NP_440747.1_10 Reverse -341 -353 -2.32097 0.0331
NP_440747.1_10 Reverse -285 -297 -4.38592 0.0974
NP_440747.1_10 Forward -300 -288 -11.7607 0.142
NP_440747.1_10 Forward -356 -344 -11.9574 0.178
NP_441486.1_1 Reverse -341 -355 2.94952 0.0718
NP_441486.1_1 Reverse -285 -299 2.45787 0.0831
NP_441486.1_1 Forward -356 -342 2.16287 0.0892
NP_441014.1_8 Reverse -289 -308 -5.80207 0.275
NP_441014.1_10 Reverse -287 -306 -1.96793 0.269
NP_442848.1_1 Reverse -338 -352 -1.27871 0.263
NP_442848.1_1 Forward -359 -345 -4.4253 0.291
NP_443018.1_3 Forward -352 -345 14.8871 0.0123
NP_443018.1_3 Reverse -345 -352 14.8871 0.0123
NP_443018.1_3 Forward -296 -289 4.36568 0.254
NP_443018.1_3 Reverse -289 -296 4.07068 0.299
NP_441634.1_8 Reverse -342 -356 3.63784 0.145
NP_440376.1_1 Reverse -344 -353 9.73449 0.0365
NP_440376.1_1 Forward -353 -344 9.63616 0.0385
NP_440376.1_1 Reverse -288 -297 7.37455 0.0786
NP_440376.1_1 Forward -297 -288 7.07956 0.0869
NP_441588.1_4 Forward -295 -285 7.74818 0.17
NP_441588.1_4 Forward -351 -341 6.37155 0.2
NP_442687.1_1 Forward -69 -56 16.5383 0.243
NP_442687.1_5 Forward -114 -100 16.8312 0.277
NP_442687.1_7 Forward -354 -344 13.0581 0.0591
NP_442687.1_7 Reverse -287 -297 5.09324 0.221
NP_442687.1_10 Forward -302 -283 22.3206 0.124
NP_442191.1_4 Reverse -239 -253 11.3809 0.262
NP_441077.1_6 Reverse -12 -28 18.9018 0.0733
NP_442530.1_2 Forward -119 -109 12.2714 0.278
NP_440667.1_2 Forward -297 -278 -9.14533 0.297
NP_442658.1_1 Forward -355 -345 13.7459 0.0325
NP_442658.1_1 Reverse -342 -352 6.76441 0.214
NP_440141.1_8 Reverse -329 -348 6.29264 0.265
NP_442782.1_2 Reverse -344 -358 0.88457 0.282
NP_441414.1_9 Forward -353 -334 -1.47551 0.101
NP_441414.1_9 Reverse -344 -363 -5.01543 0.166
NP_441414.1_9 Reverse -288 -307 -5.31042 0.174
NP_441487.1_9 Forward -354 -335 -2.26216 0.293
NP_441256.1_1 Forward -356 -337 -7.08038 0.239
NP_442937.1_5 Reverse -339 -358 13.1758 0.095
NP_442937.1_5 Forward -302 -283 6.4893 0.278
NP_441958.1_5 Reverse -343 -353 3.12662 0.0364
NP_441958.1_5 Forward -354 -344 2.43831 0.0422
NP_441958.1_5 Forward -298 -288 -6.90313 0.293
NP_442486.1_6 Reverse -381 -400 -5.21209 0.273
NP_442836.1_5 Forward -303 -284 1.17943 0.287
NP_440203.1_5 Reverse -239 -249 11.4843 0.19
NP_439905.1_1 Reverse -345 -358 7.78743 0.244
NP_439905.1_1 Reverse -289 -302 6.4108 0.288
NP_439990.1_5 Forward -302 -289 6.90245 0.22
NP_442911.1_2 Forward -363 -344 5.211 0.0344
NP_442911.1_2 Reverse -212 -231 -3.24547 0.11
NP_442911.1_2 Forward -307 -288 -4.72043 0.14
NP_440153.1_5 Forward -352 -338 5.50613 0.191
NP_440153.1_8 Reverse -288 -301 -1.75067 0.225
NP_443055.1_6 Reverse -336 -354 -1.25988 0.276
NP_441099.1_3 Reverse -139 -158 -3.63879 0.299
NP_441712.1_1 Forward -325 -306 10.1007 0.282
NP_441294.1_7 Reverse -284 -298 15.9698 0.0176
NP_440377.1_1 Forward -115 -98 10.0175 0.299
NP_441000.1_6 Forward -354 -340 -3.73699 0.225
NP_440484.1_3 Reverse -342 -356 10.226 0.242
NP_440147.1_4 Reverse -286 -299 8.9674 0.0448
NP_441550.1_8 Reverse -342 -352 12.3692 0.0336
NP_441331.1_10 Reverse -21 -40 19.3367 0.142
NP_441916.1_7 Reverse -344 -354 9.12481 0.0396
NP_441916.1_7 Forward -353 -343 2.04498 0.265
NP_441041.1_4 Forward -297 -278 2.65439 0.071
NP_441041.1_4 Reverse -344 -363 -9.44032 0.216
NP_442396.1_5 Forward -357 -344 6.50913 0.234
NP_441725.1_5 Forward -352 -342 11.2881 0.0247
NP_441725.1_5 Reverse -345 -355 9.32148 0.0553
NP_439966.1_7 Forward -355 -345 19.1541 0.00473
NP_439966.1_7 Reverse -342 -352 15.8108 0.0124
NP_439966.1_9 Forward -355 -346 9.93116 0.186
NP_442941.1_3 Forward -352 -342 19.9412 0.00262
NP_442941.1_3 Reverse -345 -355 2.04498 0.146
NP_440289.1_2 Forward -356 -343 11.4257 0.0196
NP_440289.1_2 Reverse -341 -354 -4.20895 0.283
NP_440983.1_5 Reverse -291 -310 -8.94866 0.298
NP_441079.1_7 Reverse -11 -30 -5.21283 0.264
NP_440177.1_9 Reverse -336 -355 12.9791 0.228
NP_440177.1_9 Forward -305 -286 11.9958 0.239
NP_440177.1_9 Forward -361 -342 10.7175 0.299
NP_001035871.2_7 Reverse -279 -289 13.2547 0.219
NP_440498.1_1 Forward -362 -344 -2.63579 0.244
NP_441644.1_6 Forward -353 -343 14.7292 0.0105
NP_441644.1_6 Forward -297 -287 13.0576 0.0244
NP_441644.1_6 Reverse -344 -354 6.37109 0.161
NP_441644.1_6 Reverse -288 -298 6.0761 0.167
NP_443049.1_6 Reverse -343 -353 13.8856 0.139
NP_442215.1_2 Reverse -286 -302 -7.21796 0.289
NP_441810.1_9 Forward -360 -341 0.58944 0.292
NP_442247.1_8 Reverse -342 -356 8.45605 0.272
NP_440253.1_2 Forward -353 -335 3.26407 0.12
NP_440253.1_2 Reverse -344 -362 1.69077 0.155
NP_440253.1_2 Reverse -350 -368 -0.570838 0.216
NP_440929.1_1 Forward -211 -201 15.8188 0.27
NP_440929.1_8 Reverse -344 -353 9.93116 0.0249
NP_440929.1_8 Forward -353 -344 9.83282 0.0254
NP_442933.1_1 Reverse -59 -78 15.2305 0.188
NP_442933.1_10 Reverse -344 -353 9.04618 0.063
NP_442933.1_10 Forward -353 -344 8.94785 0.0643
NP_442933.1_10 Forward -297 -288 5.11294 0.204
NP_441751.2_8 Forward -352 -338 8.16106 0.0327
NP_442554.1_8 Forward -352 -342 15.9097 0.00747
NP_442554.1_8 Reverse -289 -299 7.45319 0.092
NP_442554.1_8 Forward -296 -286 4.79825 0.173
NP_442554.1_8 Reverse -345 -355 4.3066 0.189
NP_441762.1_7 Reverse -343 -355 4.95553 0.0444
NP_441762.1_7 Forward -354 -342 -5.17256 0.191
NP_442142.1_4 Forward -356 -343 10.5401 0.0712
NP_442142.1_4 Reverse -341 -354 5.52525 0.188
NP_442292.1_1 Forward -352 -343 18.486 0.00229
NP_442292.1_1 Reverse -289 -298 5.99792 0.125
NP_442292.1_1 Reverse -345 -354 0.786375 0.23
NP_442292.1_1 Forward -296 -287 -0.68859 0.268
NP_440919.1_7 Reverse -120 -138 9.1144 0.195
NP_442476.1_6 Reverse -345 -359 2.5562 0.179
NP_442381.1_8 Forward -356 -337 -15.0452 0.292
NP_443009.1_5 Reverse -343 -354 9.69459 0.0913
NP_441715.1_4 Forward -352 -342 14.828 0.0268
NP_441715.1_4 Reverse -345 -355 7.15819 0.114
NP_440183.1_1 Forward -146 -127 6.98095 0.27
NP_441758.1_10 Forward -204 -185 -0.689632 0.25
NP_441468.1_1 Forward -352 -345 15.8704 0.0124
NP_441468.1_1 Reverse -345 -352 15.8704 0.0124
NP_441468.1_1 Forward -296 -289 4.46401 0.224
NP_441020.2_6 Reverse -342 -359 13.8052 0.0663
NP_441673.1_1 Reverse -344 -353 11.1111 0.0121
NP_441673.1_1 Forward -353 -344 11.0128 0.018
NP_441673.1_1 Forward -297 -288 1.67135 0.0404
NP_441673.1_1 Reverse -288 -297 1.47469 0.0936
NP_441826.1_2 Reverse -338 -352 4.12949 0.105
NP_441330.1_1 Reverse -339 -358 -13.2752 0.183
NP_442868.1_6 Reverse -342 -352 9.91146 0.038
NP_442868.1_6 Reverse -286 -296 0.766681 0.209
NP_442868.1_6 Forward -355 -345 0.668351 0.213
NP_442719.1_2 Reverse -109 -127 -5.88141 0.224
NP_442719.1_2 Forward -113 -95 -11.2896 0.291
NP_442719.1_2 Reverse -110 -128 -11.3879 0.291
NP_442719.1_2 Forward -166 -148 -11.9779 0.299
NP_441251.1_8 Reverse -97 -110 10.9479 0.27
NP_441056.1_1 Forward -353 -334 -7.76869 0.276
NP_440785.1_1 Forward -213 -194 -0.590531 0.263
NP_440051.1_5 Reverse -190 -204 15.7108 0.206
NP_442427.1_8 Forward -362 -343 13.0775 0.151
NP_442808.1_1 Forward -354 -344 18.8591 0.00201
NP_441315.1_2 Reverse -334 -352 15.471 0.23
NP_442542.1_2 Forward -355 -342 7.98409 0.167
NP_442542.1_2 Reverse -336 -349 4.64084 0.299
NP_442050.1_5 Reverse -342 -352 16.4991 0.00812
NP_442050.1_5 Forward -355 -345 8.14104 0.241
NP_440558.1_2 Reverse -279 -298 -5.9004 0.267
NP_440558.1_2 Forward -300 -281 -7.17871 0.289
NP_441518.1_3 Reverse -334 -353 -14.6519 0.279
NP_441878.1_6 Forward -298 -288 2.53664 0.0363
NP_441878.1_6 Reverse -343 -353 0.668351 0.139
NP_441878.1_6 Forward -354 -344 0.57002 0.14
NP_441878.1_6 Reverse -287 -297 -0.118297 0.167
NP_441036.1_3 Forward -129 -110 -4.6221 0.278
NP_441036.1_8 Forward -354 -344 15.418 0.00944
NP_442721.1_4 Reverse -21 -40 16.2241 0.291
NP_441557.1_5 Reverse -344 -353 10.8161 0.00464
NP_441557.1_5 Forward -353 -344 10.4228 0.00915
NP_441557.1_5 Forward -297 -288 0.786375 0.106
NP_441557.1_5 Reverse -288 -297 0.589713 0.134
NP_441445.1_1 Reverse -279 -298 -0.295539 0.289
NP_442066.2_9 Forward -357 -344 9.36073 0.175
NP_442066.2_9 Forward -301 -288 7.29578 0.237
NP_442419.1_2 Reverse -339 -358 -3.54046 0.265
NP_441458.1_10 Forward -362 -343 10.7175 0.123
NP_442183.1_1 Reverse -344 -358 20.4524 0.00436
NP_442183.1_1 Forward -353 -339 7.76774 0.131
NP_441574.1_1 Forward -309 -290 -4.32711 0.252
NP_442347.1_2 Forward -352 -343 12.4878 0.056
NP_442347.1_2 Forward -256 -247 6.68623 0.156
NP_442645.1_2 Reverse -280 -299 -4.13045 0.054
NP_442645.1_2 Reverse -336 -355 -15.8318 0.213
NP_440136.1_2 Forward -352 -345 15.9687 0.0123
NP_440136.1_2 Reverse -345 -352 15.9687 0.0123
NP_442998.1_10 Forward -351 -344 15.5754 0.0102
NP_442998.1_10 Reverse -346 -353 5.84064 0.235
NP_440299.1_1 Reverse -284 -297 5.62358 0.169
NP_440299.1_1 Reverse -340 -353 4.54195 0.207
NP_441799.1_1 Reverse -340 -354 10.8154 0.0668
NP_441799.1_1 Forward -357 -343 7.86545 0.13
NP_441799.1_1 Reverse -284 -298 5.50552 0.206
NP_441007.1_10 Forward -302 -289 9.45906 0.0939
NP_441007.1_10 Forward -358 -345 2.08423 0.2
NP_441007.1_10 Reverse -339 -352 -1.06236 0.3
NP_440256.1_1 Reverse -341 -360 -2.95047 0.125
NP_440087.1_1 Reverse -335 -354 2.0644 0.167
NP_441559.1_8 Forward -152 -138 -3.54032 0.205
NP_440915.1_6 Forward -151 -137 -2.45868 0.272
NP_441464.1_8 Reverse -288 -302 5.50613 0.253
NP_440306.1_8 Reverse -191 -210 3.83357 0.204
NP_440695.1_5 Reverse -344 -363 15.1424 0.116
NP_442993.1_1 Forward -353 -337 -7.41462 0.146
NP_442993.1_1 Reverse -344 -360 -9.28291 0.181
NP_440677.1_1 Forward -254 -235 8.06259 0.218
NP_440677.1_6 Forward -256 -237 8.06259 0.277
NP_442386.1_9 Forward -354 -345 17.6988 0.0144
NP_442386.1_9 Reverse -343 -352 13.8639 0.0289
NP_440570.1_5 Reverse -128 -147 3.44104 0.234
NP_440570.1_5 Forward -307 -288 -2.75381 0.28
NP_441750.1_7 Reverse -141 -151 14.3364 0.254
NP_441340.1_5 Forward -352 -345 15.6737 0.0124
NP_441340.1_5 Reverse -345 -352 15.6737 0.0124
NP_441340.1_5 Reverse -289 -296 3.97235 0.274
NP_442327.1_3 Reverse -355 -374 5.87233 0.276
NP_441947.1_10 Forward -233 -215 3.55906 0.276
NP_443028.1_4 Reverse -75 -94 8.63537 0.293
NP_440586.1_1 Forward -313 -294 -6.09707 0.296
NP_440586.1_8 Forward -352 -345 13.2151 0.026
NP_440586.1_8 Reverse -345 -352 13.2151 0.026
NP_442251.1_6 Forward -352 -345 15.2804 0.0124
NP_442251.1_6 Reverse -345 -352 15.2804 0.0124
NP_440684.1_9 Reverse -338 -352 18.4858 0.0378
NP_441262.1_3 Reverse -344 -351 14.7888 0.0223
NP_441262.1_3 Forward -353 -346 6.52896 0.0809
NP_440027.1_3 Reverse -281 -299 1.5917 0.3
NP_443051.1_1 Reverse -343 -352 10.4228 0.00754
NP_443051.1_1 Forward -354 -345 0.983037 0.125
NP_439937.1_9 Reverse -115 -132 -6.94332 0.157
NP_439937.1_9 Forward -152 -135 -11.1715 0.245
NP_441595.1_2 Reverse -111 -124 15.9134 0.277
NP_440372.1_2 Forward -352 -345 16.3621 0.0124
NP_440372.1_2 Reverse -345 -352 16.3621 0.0124
NP_441138.1_5 Reverse -203 -216 3.40399 0.297
NP_440819.1_5 Forward -209 -201 8.08256 0.185
NP_441803.1_2 Reverse -345 -364 -1.08219 0.294
NP_439977.1_5 Forward -359 -340 5.211 0.15
NP_440139.1_1 Reverse -338 -357 8.55343 0.111
NP_440267.1_2 Reverse -297 -311 4.52221 0.3
NP_442384.1_10 Reverse -344 -357 4.44418 0.157
NP_441877.1_5 Forward -387 -368 0.58944 0.276
NP_441018.1_7 Forward -301 -282 8.65258 0.241
NP_442790.1_4 Reverse -335 -354 -4.6221 0.133
NP_442262.1_10 Forward -352 -345 14.1988 0.0123
NP_442262.1_10 Reverse -345 -352 14.1988 0.0123
NP_441689.1_5 Reverse -342 -352 15.3192 0.0403
NP_440163.1_10 Reverse -341 -351 10.4031 0.201
NP_440344.1_10 Forward -360 -343 3.57876 0.0265
NP_441335.1_5 Forward -100 -81 17.404 0.217
NP_441965.1_10 Forward -356 -340 2.71347 0.284
NP_440297.1_9 Forward -352 -342 9.32148 0.0917
NP_440297.1_9 Reverse -345 -355 0.865012 0.282
NP_442187.1_3 Reverse -343 -353 17.188 0.0619
NP_441592.1_4 Forward -353 -334 -1.7705 0.259
NP_440999.1_9 Forward -357 -343 2.2612 0.152
NP_440999.1_9 Forward -151 -137 -0.787057 0.217
NP_440888.1_2 Forward -353 -339 13.8636 0.0231
NP_440888.1_2 Reverse -288 -302 13.6669 0.026
NP_440888.1_2 Reverse -344 -358 5.21053 0.288
NP_440575.1_1 Forward -265 -246 -1.67294 0.29
NP_441543.1_2 Forward -352 -343 16.9127 0.00359
NP_441543.1_2 Reverse -345 -354 8.94785 0.0968
NP_441543.1_2 Reverse -289 -298 5.11294 0.209
NP_442845.1_2 Reverse -338 -352 13.9626 0.088
NP_441469.1_8 Forward -354 -345 15.4377 0.0124
NP_441469.1_8 Reverse -343 -352 6.48957 0.227
NP_443064.1_6 Forward -353 -343 9.46426 0.219
NP_442578.1_7 Forward -352 -345 14.5921 0.026
NP_442578.1_7 Reverse -345 -352 14.5921 0.026
NP_442578.1_7 Reverse -351 -358 6.62729 0.18
NP_441462.1_2 Reverse -344 -354 9.32148 0.0234
NP_441462.1_2 Forward -353 -343 1.74999 0.0811
NP_441462.1_2 Reverse -288 -298 0.275027 0.159
NP_443062.1_1 Forward -353 -335 9.81352 0.127
NP_440519.1_2 Forward -326 -307 10.9142 0.239
NP_440516.1_8 Reverse -344 -353 18.9776 0.00442
NP_440516.1_8 Forward -353 -344 7.07956 0.0867
NP_440128.1_10 Forward -232 -213 13.7658 0.282
NP_442428.1_5 Forward -352 -345 15.8704 0.0124
NP_442428.1_5 Reverse -345 -352 15.8704 0.0124
NP_442428.1_5 Forward -296 -289 4.759 0.223
NP_442120.1_10 Forward -297 -278 -16.0285 0.296
NP_440673.1_3 Reverse -346 -353 13.1171 0.0426
NP_440673.1_3 Forward -351 -344 12.4288 0.0426
NP_441052.1_2 Forward -353 -343 20.5312 0.00106
NP_441052.1_2 Reverse -288 -298 7.35486 0.0742
NP_441052.1_2 Forward -297 -287 7.35486 0.0742
NP_441052.1_2 Reverse -344 -354 0.766681 0.256
NP_442219.1_8 Reverse -334 -353 17.3473 0.0729
NP_442219.1_8 Forward -301 -282 7.78057 0.263
NP_442219.1_9 Forward -352 -343 17.7976 0.00718
NP_442219.1_9 Reverse -345 -354 8.94785 0.0681
NP_440436.1_4 Forward -352 -343 17.2072 0.00233
NP_440436.1_4 Reverse -345 -354 9.04574 0.092
NP_440436.1_4 Reverse -289 -298 4.7192 0.244
NP_440314.1_9 Forward -352 -333 11.2092 0.0289
NP_440314.1_9 Reverse -289 -308 -9.53865 0.269
NP_441719.1_4 Forward -352 -345 16.3621 0.0124
NP_441719.1_4 Reverse -345 -352 16.3621 0.0124
NP_441733.1_10 Reverse -341 -354 9.45906 0.117
NP_441004.1_1 Forward -309 -290 -17.7001 0.294
NP_442813.1_4 Forward -144 -125 -6.58872 0.299
NP_442366.1_3 Forward -354 -336 -5.48739 0.288
NP_442366.1_5 Reverse -285 -295 11.091 0.213
NP_442873.1_5 Reverse -218 -237 6.78348 0.298
NP_442873.1_9 Forward -363 -344 5.80018 0.259
NP_442206.1_1 Forward -347 -328 -2.55715 0.153
NP_443054.1_2 Forward -299 -285 -0.0987402 0.284
NP_441851.1_10 Reverse -343 -353 8.33817 0.118
NP_441851.1_10 Forward -354 -344 6.66654 0.159
NP_441851.1_10 Forward -298 -288 4.89658 0.24
NP_442622.1_8 Forward -353 -335 -19.2537 0.296
NP_442515.1_1 Reverse -287 -301 12.8809 0.0308
NP_442515.1_1 Reverse -343 -357 4.12949 0.108
NP_442515.1_1 Forward -354 -340 0.196253 0.2
NP_441982.1_6 Reverse -101 -110 11.3395 0.288
NP_441046.1_2 Forward -308 -289 1.86774 0.254
NP_441046.1_2 Reverse -277 -296 -0.885524 0.287
NP_441349.1_10 Reverse -334 -353 -9.73531 0.297
NP_441409.1_6 Forward -33 -14 -11.4069 0.219
NP_441409.1_6 Forward -359 -340 -12.5869 0.229
NP_440474.1_8 Forward -352 -338 6.78381 0.219
NP_440474.1_8 Reverse -223 -237 5.30886 0.251
NP_441124.1_5 Reverse -18 -28 13.0082 0.215
NP_442450.1_5 Forward -355 -345 9.61647 0.115
NP_442450.1_5 Reverse -342 -352 9.32148 0.115
NP_440588.1_3 Reverse -20 -39 10.2259 0.253
NP_440483.1_1 Forward -140 -121 -8.55534 0.289
NP_441078.1_4 Reverse -344 -353 9.93116 0.0203
NP_441078.1_4 Forward -353 -344 9.83282 0.0226
NP_441078.1_4 Forward -297 -288 7.96454 0.0404
NP_441078.1_4 Reverse -288 -297 0.786375 0.157
NP_442729.1_8 Forward -357 -344 9.2624 0.125
NP_442348.1_2 Reverse -148 -157 7.47288 0.28
NP_442443.1_4 Reverse -15 -25 16.3025 0.155
NP_440526.1_3 Reverse -289 -300 1.23817 0.267
NP_440526.1_3 Forward -352 -341 0.943182 0.267
NP_441432.1_8 Reverse -343 -352 16.8143 0.00595
NP_441432.1_8 Forward -298 -289 4.81794 0.196
NP_442320.1_8 Reverse -338 -352 11.701 0.0178
NP_442320.1_8 Forward -359 -345 -2.16369 0.0867
NP_442344.1_7 Forward -352 -333 -4.6221 0.168
NP_442344.1_7 Reverse -345 -364 -8.35868 0.211
NP_440760.1_1 Forward -297 -278 -12.6852 0.0945
NP_440760.1_1 Reverse -288 -307 -13.9635 0.119
NP_442797.1_7 Forward -354 -336 6.214 0.21
NP_440199.1_10 Reverse -341 -351 7.64985 0.231
NP_440713.1_4 Reverse -244 -263 2.85105 0.256
NP_442489.1_2 Forward -364 -345 5.50599 0.195
NP_442489.1_7 Reverse -344 -353 10.4228 0.0151
NP_442489.1_7 Forward -353 -344 10.3245 0.0193
NP_442489.1_7 Forward -297 -288 8.45619 0.0206
NP_442489.1_7 Reverse -288 -297 0.786375 0.152
NP_440559.1_1 Forward -352 -343 17.4043 0.00658
NP_441659.2_8 Reverse -288 -298 13.1564 0.0129
NP_441659.2_8 Forward -353 -343 8.63316 0.0405
NP_441659.2_8 Reverse -344 -354 2.43831 0.2
NP_442913.1_10 Reverse -279 -298 -2.65548 0.19
NP_441968.1_1 Forward -209 -201 14.1787 0.286
NP_442346.1_5 Reverse -287 -297 11.6814 0.0606
NP_442346.1_5 Reverse -343 -353 8.23984 0.143
NP_442346.1_5 Forward -298 -288 6.46988 0.201
NP_442346.1_5 Forward -354 -344 5.19158 0.256
NP_440545.1_2 Reverse -94 -113 18.99 0.139
NP_441856.1_6 Reverse -94 -108 20.6491 0.0738
NP_440831.1_3 Reverse -335 -354 4.83391 0.298
NP_440555.1_1 Reverse -333 -352 3.6377 0.294
NP_440459.1_2 Reverse -279 -296 11.1502 0.181
NP_440010.1_4 Reverse -340 -359 3.73524 0.22
NP_440010.1_6 Forward -308 -289 8.94757 0.213
NP_440010.1_10 Reverse -332 -351 9.3409 0.209
NP_442603.1_7 Reverse -288 -302 10.3237 0.129
NP_442603.1_7 Forward -353 -339 7.66879 0.198
NP_442828.1_5 Forward -197 -178 12.585 0.289
NP_441833.1_4 Forward -352 -345 15.9687 0.0124
NP_441833.1_4 Reverse -345 -352 15.9687 0.0124
NP_442162.1_9 Forward -352 -345 16.2637 0.0124
NP_442162.1_9 Reverse -345 -352 16.2637 0.0124
NP_440671.1_4 Reverse -338 -352 9.34103 0.184
NP_442140.1_1 Reverse -213 -232 14.7962 0.21
NP_442140.1_3 Reverse -345 -355 10.1081 0.0926
NP_442140.1_3 Forward -352 -342 4.40493 0.243
NP_441813.1_5 Forward -355 -345 17.188 0.00979
NP_441813.1_5 Reverse -342 -352 15.9097 0.01
NP_440594.1_6 Reverse -282 -301 12.0933 0.169
NP_440590.1_4 Forward -352 -339 -6.07724 0.299
NP_440567.1_1 Reverse -345 -359 7.86607 0.0642
NP_440567.1_1 Forward -352 -338 2.5562 0.17
NP_442497.1_10 Forward -352 -343 10.4228 0.0087
NP_442497.1_10 Reverse -345 -354 1.37636 0.111
NP_440821.1_4 Reverse -342 -352 18.2696 0.00448
NP_440821.1_4 Forward -355 -345 16.6963 0.00797
NP_441239.1_9 Forward -355 -343 13.0187 0.0389
NP_441727.1_3 Forward -298 -279 2.55606 0.299
NP_442669.1_1 Reverse -40 -59 15.0441 0.00715
NP_442669.1_1 Forward -171 -152 4.03102 0.143
NP_440949.1_7 Forward -361 -342 11.11 0.233
NP_440354.1_7 Forward -359 -341 7.4923 0.265
NP_440354.1_7 Reverse -338 -356 6.70565 0.278
NP_441617.1_5 Reverse -68 -87 13.5683 0.297
NP_442138.1_10 Forward -353 -334 -2.55715 0.211
NP_440546.1_4 Reverse -344 -354 13.0517 0.0572
NP_440546.1_4 Forward -353 -343 7.33119 0.246
NP_440462.1_6 Forward -355 -345 14.4347 0.0209
NP_440462.1_6 Reverse -342 -352 7.74818 0.0699
NP_442592.1_2 Forward -263 -244 4.62101 0.285
NP_440868.1_4 Forward -357 -345 11.937 0.0259
NP_440868.1_4 Reverse -340 -352 5.84051 0.0879
NP_442499.1_1 Forward -352 -333 5.60432 0.225
NP_442479.1_9 Forward -116 -97 -9.83364 0.266
NP_442402.1_2 Forward -115 -101 11.5037 0.272
NP_442402.1_10 Reverse -121 -131 14.3359 0.18
NP_440696.1_6 Forward -302 -283 7.57094 0.253
NP_442039.1_3 Reverse -381 -400 19.174 0.107
NP_442039.1_4 Forward -352 -345 15.1821 0.0124
NP_442039.1_4 Reverse -345 -352 15.1821 0.0124
NP_441926.1_3 Forward -353 -337 14.9065 0.0428
NP_441053.1_10 Reverse -328 -338 17.9746 0.293
NP_442837.1_3 Forward -352 -345 15.7721 0.0124
NP_442837.1_3 Reverse -345 -352 15.7721 0.0124
NP_442053.1_1 Reverse -344 -353 17.601 0.00138
NP_442053.1_1 Forward -353 -344 16.2243 0.00451
NP_440505.1_3 Reverse -342 -352 16.303 0.00696
NP_440505.1_3 Reverse -94 -104 8.1415 0.147
NP_440505.1_3 Forward -299 -289 4.50326 0.284
NP_442532.1_7 Reverse -344 -358 14.1593 0.0644
NP_440914.1_1 Forward -353 -343 15.0561 0.00832
NP_440914.1_1 Reverse -344 -354 7.34642 0.241
NP_440914.1_1 Forward -297 -287 6.95605 0.257
NP_441011.1_8 Reverse -345 -354 15.3394 0.012
NP_441011.1_8 Forward -352 -343 8.25953 0.144
NP_442533.1_1 Forward -399 -380 -7.08038 0.186
NP_442533.1_6 Forward -297 -288 13.5694 0.021
NP_442533.1_6 Reverse -288 -297 8.1612 0.0807
NP_442533.1_6 Reverse -344 -353 7.86621 0.0862
NP_442533.1_6 Forward -353 -344 7.37455 0.0898
NP_441482.1_7 Forward -359 -345 -1.96703 0.0913
NP_441482.1_7 Reverse -338 -352 -3.34366 0.118
NP_439944.1_9 Forward -352 -342 19.0562 0.00329
NP_440816.1_7 Forward -357 -338 13.6675 0.201
NP_441028.1_6 Reverse -239 -249 3.8145 0.281
NP_441527.1_4 Forward -206 -187 -11.5072 0.282
NP_440608.1_6 Forward -352 -333 11.11 0.238
NP_441972.1_5 Forward -364 -345 -10.0303 0.296
NP_441106.1_1 Reverse -343 -352 9.63616 0.0311
NP_441106.1_1 Forward -354 -345 9.04618 0.0371
NP_439903.1_6 Reverse -341 -360 2.16195 0.231
NP_441286.1_1 Reverse -343 -355 13.5103 0.00683
NP_441286.1_1 Forward -354 -342 2.59558 0.0573
NP_441286.1_1 Reverse -287 -299 2.30059 0.0669
NP_441286.1_1 Forward -298 -286 -6.2542 0.254
NP_442674.1_2 Forward -120 -101 9.53756 0.216
NP_442674.1_3 Reverse -330 -349 2.9486 0.297
NP_440670.1_8 Reverse -344 -353 9.04618 0.0606
NP_440670.1_8 Forward -353 -344 8.75118 0.0606
NP_440886.1_7 Forward -354 -344 17.7774 0.0011
NP_440886.1_7 Reverse -343 -353 6.66608 0.115
NP_440886.1_7 Reverse -287 -297 6.66608 0.115
NP_440886.1_7 Forward -148 -138 4.7978 0.218
NP_442614.1_2 Forward -297 -283 7.17775 0.275
NP_442072.1_9 Forward -298 -280 -22.1053 0.22
NP_442264.1_2 Forward -301 -284 7.90532 0.225
NP_442264.1_2 Reverse -334 -351 6.03703 0.267
NP_441463.1_3 Forward -363 -344 3.6377 0.0997
NP_441463.1_3 Reverse -304 -323 -6.78538 0.249
NP_441463.1_3 Reverse -334 -353 -8.16202 0.266
NP_441463.1_6 Reverse -342 -356 9.02504 0.25
NP_441463.1_6 Reverse -280 -294 8.73514 0.25
NP_441463.1_6 Reverse -234 -248 7.96207 0.25
NP_442893.1_4 Forward -319 -300 8.25844 0.126
NP_441626.1_2 Forward -352 -345 15.7721 0.0124
NP_441626.1_2 Reverse -345 -352 15.7721 0.0124
NP_442365.1_7 Forward -357 -338 -2.55715 0.201
NP_442238.1_7 Reverse -300 -319 14.1583 0.167
NP_442794.1_1 Reverse -340 -352 7.11881 0.148
NP_442615.1_1 Forward -362 -344 -2.63579 0.146
NP_442615.1_1 Reverse -335 -353 -5.19239 0.206
NP_441962.1_4 Reverse -283 -302 7.47261 0.0705
NP_440387.1_1 Forward -353 -337 6.45005 0.0282
NP_440387.1_1 Reverse -344 -360 2.41848 0.0807
NP_440387.1_1 Forward -297 -281 0.746852 0.12
NP_440387.1_1 Reverse -288 -304 -6.03799 0.262
NP_441836.1_2 Forward -303 -284 -5.01543 0.269
NP_440143.1_1 Forward -396 -377 13.1758 0.284
NP_440114.1_10 Reverse -344 -358 11.3077 0.118
NP_440114.1_10 Forward -353 -339 5.60446 0.3
NP_440766.1_4 Reverse -340 -354 1.27789 0.243
NP_440458.1_10 Reverse -293 -311 15.8504 0.245
NP_441133.1_1 Forward -305 -286 13.2741 0.243
NP_439910.1_2 Forward -361 -344 -13.5308 0.162
NP_440457.1_1 Reverse -340 -352 0.0389777 0.25
NP_440801.1_8 Forward -354 -335 15.1424 0.116
NP_441436.1_8 Reverse -287 -306 11.3075 0.261
NP_440473.1_1 Reverse -290 -309 10.8718 0.289
NP_442509.1_9 Reverse -344 -354 14.7292 0.0242
NP_440660.1_7 Forward -302 -283 -3.04881 0.298
NP_440554.1_4 Reverse -345 -355 8.04317 0.0851
NP_440554.1_4 Forward -352 -342 7.05986 0.106
NP_442862.1_3 Forward -47 -30 4.3654 0.29
NP_441885.1_5 Forward -353 -343 11.0914 0.00874
NP_441885.1_5 Reverse -344 -354 2.33998 0.0799
NP_441885.1_5 Reverse -288 -298 2.14332 0.0827
NP_441885.1_5 Forward -297 -287 1.74999 0.0991
NP_441428.1_8 Forward -361 -342 2.65439 0.268
NP_442341.1_7 Reverse -287 -301 6.09611 0.135
NP_442341.1_7 Reverse -343 -357 5.60446 0.151
NP_442341.1_9 Forward -355 -341 4.91554 0.287
NP_441173.1_9 Forward -58 -50 11.8187 0.222
NP_441173.1_9 Reverse -123 -131 11.3271 0.226
NP_442395.2_4 Reverse -72 -91 1.76863 0.234
NP_440423.1_6 Reverse -336 -355 -12.5869 0.198
NP_443000.1_7 Reverse -342 -352 17.0896 0.00865
NP_440507.2_3 Reverse -335 -354 17.3048 0.0598
NP_440507.2_3 Reverse -341 -360 11.0117 0.197
NP_440275.1_3 Reverse -342 -352 8.1415 0.0602
NP_440091.1_1 Reverse -340 -352 7.11881 0.0874
NP_441902.1_3 Forward -333 -323 12.0099 0.281
NP_440149.1_8 Reverse -344 -363 4.42435 0.0825
NP_440216.1_1 Reverse -344 -358 -12.2918 0.256
NP_440216.1_1 Forward -353 -339 -12.6851 0.296
NP_440172.1_1 Reverse -344 -354 9.7148 0.0586
NP_440172.1_1 Forward -353 -343 5.19158 0.149
NP_440172.1_1 Forward -297 -287 2.83163 0.264
NP_442015.1_10 Reverse -218 -231 -0.767364 0.281
NP_441226.1_7 Forward -352 -345 14.4934 0.0123
NP_441226.1_7 Reverse -345 -352 14.4934 0.0123
NP_441111.1_7 Forward -352 -344 18.7023 0.00294
NP_441111.1_7 Reverse -345 -353 8.96754 0.0463
NP_441111.1_7 Forward -296 -288 -0.472234 0.131
NP_441111.1_7 Reverse -289 -297 -0.668896 0.274
NP_441766.1_2 Forward -353 -344 18.2893 0.00297
NP_441766.1_2 Reverse -344 -353 9.14451 0.0337
NP_441766.1_2 Forward -297 -288 4.52295 0.179
NP_442417.1_5 Forward -147 -133 5.89945 0.244
NP_442417.1_5 Forward -353 -339 4.42448 0.299
NP_443052.1_8 Reverse -334 -353 -11.3086 0.226
NP_441974.1_3 Forward -253 -236 14.428 0.263
NP_440591.1_9 Reverse -337 -355 9.26226 0.158
NP_442154.1_1 Forward -305 -287 -14.0422 0.217
NP_442154.1_1 Reverse -336 -354 -14.9272 0.218
NP_440988.1_10 Forward -299 -285 8.4809 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGAAGGTGGTGGAGCTAAAGTCTATCAAGCTTTACATCAATAGTTACCGCGATCGCCATATTCCCCATGAGGAAGTAACCAATCAGATTTTGGATGACTTTGTGGCGGTGGCCAATCCTTTGTACGCTAGACTAAAAGCTGATTTTAATCCCCGGGGGAATGTTCATACGGTGATTGAAGTGGAATATCATCAGGAAAAAGCTAGTTAAAAGCAACTAATCCTAGTTCCTAGGAGCATGTTTCAAAAGTCCCCAGCTACCCCCTAAGTTTTGGGGGAAGTTAGCTCAAAGTTTTCCAGTATTGCCGGAACTTTAGTGGGTCGATTTAGGGTCAAAAATCAGATTTTACAAACAGATTCTGAGCCAGCTTGGAAGATTTTCGCATTTTATGAGGTGAGGCT

CDS

ATGACCGCCTGGCAAAAGATACAAAAAATTGCGCCGGCGGCGATCGGGGCTTGCTTGTTCGTGCTTTCCATTGGGGCCATCAACTCAGAATTACACCACTACGGTTGGCAAAATGTTTTAGCCAGTTTTCAGGGCATTGTCAAAACCCGTTTAGCCGGAGCCTTTGCGCTCATGCTGATCAACTACATAATTTTGACTGGCTACGATACTCTGGCCATGTTTTACCTGGGGCAATCTCTACCCCTGACGAAAACTAGCTTTGTCGGCTTTGTCAGTTACGCCATTAGTAACAGTGTCGGCTTGGCCTTGCTCAGTGGCAGTGCCATCCGGTACCGTCTCTATCAATCCTGGCAGGTTTCTGCCCCCATCATTGCCCAGGCGATCGCCTTTTGTAACCTGAGTTTTTGGGTGGGTTTATTAACGGTGGGGGGCATAACTTTTGTGGTGGATCCCCTACAGTTGCCCGCCTTTCTCCATTTACCGTTTCTTTCTGTCCATCCCATTGGCTTTACTTTCCTTGCCATCATTGGGATTTATTTGTTGATAACGGGCAATTTAATTAAGCCATTCAAAATCGGCCAATGGCAAACTCCCAAAATTCCCTTTGCCGTATCCTTAGCTCAAATTGGTTTGACGGCGGTGGATTGGATTTTAGCCTCTGGTATTTTATACGTGCTATTACCTGGGCACCATCACCTTAGTTTTCCCGGCTTTTTTGGCATTTATCTGCTGGCGCAGGTGGCGGGCATTATCAGTAATGTGCCGGGGGGACTGGGGGTATTTGAAACGGTGGTGTTATTTTTGCTGACTCCTAAATATTCCTCGGTGCAAGTGCTGGGGGCATTGTTGGCATACCGAGTGATTTATTACTGGATTCCCTTGGGCAGTGCGAGCCTCAGCTTGGGGGCATTTGAGCTTTTACAACATCGACGGGAACGACGGCAAAAATCAGGCTCTGAGTCTGAGTAG

Protein

MTAWQKIQKIAPAAIGACLFVLSIGAINSELHHYGWQNVLASFQGIVKTRLAGAFALMLINYIILTGYDTLAMFYLGQSLPLTKTSFVGFVSYAISNSVGLALLSGSAIRYRLYQSWQVSAPIIAQAIAFCNLSFWVGLLTVGGITFVVDPLQLPAFLHLPFLSVHPIGFTFLAIIGIYLLITGNLIKPFKIGQWQTPKIPFAVSLAQIGLTAVDWILASGILYVLLPGHHHLSFPGFFGIYLLAQVAGIISNVPGGLGVFETVVLFLLTPKYSSVQVLGALLAYRVIYYWIPLGSASLSLGAFELLQHRRERRQKSGSESE