Your browser is old and dusty. Try Google Chrome!

Details for slr0703

ORF slr0703
Accession NP_442669.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY523i: 3096320 - 3097190]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_4 Reverse -307 -326 9.63507 0.278
NP_441480.1_1 Reverse -301 -320 -0.787193 0.287
NP_440897.1_6 Forward -193 -174 3.9319 0.14
NP_442151.1_1 Forward -356 -337 4.42435 0.287
NP_440226.1_2 Reverse -6 -24 17.4124 0.0782
NP_440226.1_9 Forward -250 -231 12.1925 0.215
NP_441098.1_3 Forward -230 -211 -6.50185 0.28
NP_441098.1_3 Forward -33 -14 -7.17178 0.285
NP_441098.1_8 Reverse -47 -66 2.45773 0.284
NP_440996.1_1 Forward -242 -223 18.6308 0.0234
NP_440996.1_2 Forward -286 -277 14.8477 0.248
NP_439997.1_6 Reverse -37 -56 10.0292 0.212
NP_441812.1_4 Forward -183 -165 11.9172 0.253
NP_440074.1_6 Forward -21 -2 10.6184 0.268
NP_441470.1_4 Forward -113 -94 27.5321 0.0000116
NP_441470.1_6 Forward -256 -237 28.2204 0.0000759
NP_441470.1_7 Forward -157 -138 27.2371 0.000139
NP_442972.1_2 Forward -268 -254 15.2402 0.136
NP_442268.1_3 Reverse -179 -198 12.9783 0.284
NP_441492.1_1 Forward -361 -342 11.1109 0.148
NP_441365.1_5 Forward -361 -342 37.5619 0.000000115
NP_440300.1_5 Reverse -370 -388 12.225 0.271
NP_441434.1_1 Reverse -210 -224 10.0383 0.233
NP_441434.1_1 Forward -224 -210 7.93745 0.26
NP_442889.1_10 Forward -20 -1 15.0359 0.149
NP_440178.1_7 Reverse -186 -205 -23.2067 0.298
NP_440331.1_5 Forward -66 -47 20.4523 0.000117
NP_442973.1_5 Forward -353 -334 9.93088 0.287
NP_442730.1_8 Reverse -307 -326 8.16011 0.185
NP_442687.1_7 Forward -312 -302 4.20827 0.262
NP_442687.1_7 Reverse -82 -92 4.10993 0.266
NP_440642.1_10 Reverse -33 -47 5.40719 0.241
NP_442720.1_8 Reverse -130 -148 7.59063 0.297
NP_442658.1_1 Forward -346 -336 6.37109 0.231
NP_442496.1_5 Forward -294 -276 4.83737 0.288
NP_440200.1_7 Forward -298 -279 6.22677 0.204
NP_441913.1_1 Forward -185 -169 13.6262 0.246
NP_442598.1_2 Reverse -151 -160 14.2577 0.252
NP_441000.1_1 Forward -362 -344 13.3937 0.184
NP_441369.1_1 Forward -396 -377 38.7419 0.000000157
NP_441369.1_2 Forward -366 -347 38.9385 0.0000000955
NP_441076.1_3 Reverse -9 -28 13.3716 0.148
NP_441079.1_3 Forward -342 -323 13.4708 0.166
NP_441566.1_3 Forward -298 -279 14.5524 0.198
NP_001035871.2_4 Reverse -78 -97 10.3234 0.248
NP_442288.1_5 Forward -398 -384 16.7159 0.12
NP_441556.1_6 Forward -394 -376 12.4797 0.296
NP_442247.1_5 Reverse -369 -383 14.4865 0.234
NP_442933.1_1 Reverse -245 -264 7.11373 0.253
NP_442671.1_2 Forward -388 -369 24.6829 0.000359
NP_442970.1_1 Forward -386 -372 9.56081 0.269
NP_441726.1_7 Reverse -53 -72 15.4374 0.0804
NP_440405.1_6 Forward -230 -212 2.18243 0.26
NP_440881.1_10 Reverse -179 -192 11.3273 0.249
NP_442076.1_5 Forward -392 -373 9.93088 0.186
NP_442076.1_5 Forward -51 -32 6.78429 0.256
NP_440183.1_1 Reverse -117 -136 8.25926 0.244
NP_441826.1_2 Forward -193 -179 -0.197071 0.204
NP_441826.1_6 Forward -232 -218 20.5508 0.0182
NP_442063.1_9 Forward -62 -43 7.47261 0.19
NP_441612.1_2 Forward -288 -278 11.5505 0.21
NP_441911.1_7 Forward -20 -1 37.8559 0.000000595
NP_442775.1_6 Reverse -111 -130 10.5209 0.277
NP_441048.1_6 Forward -19 -5 14.1444 0.296
NP_440274.1_2 Reverse -92 -106 12.3887 0.236
NP_441878.1_6 Forward -93 -83 -7.29646 0.217
NP_441036.1_7 Forward -292 -282 16.7941 0.0578
NP_442356.1_2 Forward -209 -190 12.8206 0.288
NP_441445.1_1 Reverse -169 -188 1.17943 0.259
NP_440084.1_5 Reverse -104 -123 13.7658 0.124
NP_441116.1_10 Reverse -280 -299 4.71934 0.257
NP_442047.1_2 Reverse -166 -180 15.4376 0.161
NP_441633.1_6 Reverse -267 -286 8.75091 0.182
NP_440136.1_1 Reverse -233 -249 9.69426 0.238
NP_442998.1_5 Reverse -8 -18 11.8781 0.176
NP_442998.1_5 Forward -365 -355 8.53483 0.261
NP_442998.1_5 Forward -48 -38 8.33817 0.264
NP_440899.1_8 Reverse -373 -392 -9.14533 0.258
NP_442504.1_4 Forward -28 -9 5.36764 0.114
NP_441118.1_2 Forward -325 -306 24.4839 0.000875
NP_441118.1_10 Forward -193 -175 24.0119 0.000829
NP_441362.1_2 Forward -390 -371 5.55684 0.243
NP_441362.1_5 Forward -29 -11 14.4905 0.144
NP_440306.1_3 Forward -229 -210 4.71934 0.295
NP_440695.1_6 Forward -19 -5 10.5083 0.265
NP_441340.1_5 Forward -186 -179 8.8889 0.084
NP_441248.1_10 Forward -109 -99 14.9073 0.277
NP_442950.1_1 Forward -28 -9 -1.08219 0.206
NP_440192.1_4 Forward -110 -91 12.6963 0.169
NP_440372.1_3 Forward -385 -371 15.0039 0.165
NP_441293.1_6 Reverse -94 -113 16.09 0.1
NP_442910.1_1 Forward -175 -156 -7.57203 0.254
NP_440189.1_2 Forward -100 -81 1.27776 0.268
NP_440562.1_5 Reverse -129 -148 3.04771 0.261
NP_440350.1_5 Reverse -140 -159 1.57275 0.158
NP_442129.1_6 Forward -387 -368 13.9464 0.246
NP_440888.1_2 Forward -92 -78 7.96378 0.175
NP_440888.1_2 Reverse -309 -323 6.19383 0.243
NP_442454.1_2 Reverse -8 -27 6.63627 0.291
NP_441771.1_4 Forward -289 -270 -4.42544 0.292
NP_440179.1_6 Reverse -84 -103 4.03102 0.246
NP_440663.1_6 Reverse -179 -198 14.4541 0.0249
NP_440575.1_1 Reverse -13 -32 -1.8696 0.29
NP_442845.1_2 Forward -193 -179 3.93283 0.272
NP_442710.1_6 Forward -279 -260 6.39097 0.204
NP_442710.1_7 Forward -389 -370 -7.22274 0.294
NP_439907.1_10 Forward -195 -176 11.0117 0.273
NP_441462.1_2 Reverse -83 -93 -0.904945 0.265
NP_441462.1_5 Forward -50 -31 7.27595 0.213
NP_441929.1_3 Reverse -9 -28 2.55606 0.266
NP_440519.1_6 Reverse -304 -318 9.43936 0.29
NP_442204.1_1 Forward -74 -63 1.92696 0.266
NP_440504.1_6 Forward -26 -8 11.0314 0.0768
NP_440544.1_5 Reverse -138 -145 13.8024 0.28
NP_442139.1_10 Reverse -109 -128 12.1917 0.188
NP_442694.1_8 Reverse -372 -390 12.3105 0.191
NP_443054.1_2 Forward -94 -80 0.982901 0.251
NP_441982.1_10 Reverse -344 -363 8.55343 0.143
NP_440005.1_3 Forward -226 -207 21.2407 0.00993
NP_442689.1_8 Reverse -3 -20 -2.81276 0.235
NP_442689.1_8 Reverse -372 -389 -8.61428 0.294
NP_441661.1_3 Forward -151 -134 -3.99273 0.226
NP_441124.1_5 Forward -393 -383 12.7217 0.215
NP_440431.1_3 Forward -194 -175 -10.7186 0.276
NP_440943.1_5 Forward -347 -333 14.1593 0.22
NP_442348.1_2 Reverse -133 -142 11.7994 0.225
NP_442906.1_9 Reverse -268 -287 4.32602 0.207
NP_441432.1_8 Forward -319 -310 2.85133 0.281
NP_441432.1_9 Reverse -43 -56 14.7067 0.14
NP_440199.1_4 Reverse -2 -20 14.0393 0.203
NP_442489.1_7 Forward -92 -83 -1.47524 0.203
NP_440284.1_8 Forward -355 -336 29.6945 0.000000161
NP_440284.1_9 Forward -287 -268 28.8104 0.00000727
NP_440336.1_1 Forward -263 -244 10.5209 0.286
NP_442799.1_8 Forward -37 -18 10.6204 0.172
NP_441329.1_1 Reverse -282 -301 5.29938 0.265
NP_441329.1_6 Forward -157 -138 12.0793 0.106
NP_441329.1_6 Forward -38 -19 6.44528 0.179
NP_441329.1_6 Forward -57 -38 -2.0535 0.293
NP_441329.1_6 Forward -159 -140 -2.14899 0.293
NP_441895.1_10 Forward -44 -25 -18.5851 0.282
NP_441895.1_10 Forward -61 -42 -27.8282 0.299
NP_442436.1_4 Reverse -244 -258 12.3893 0.218
NP_442045.1_7 Forward -73 -54 4.42435 0.212
NP_442914.1_4 Reverse -47 -66 13.175 0.205
NP_441239.1_9 Reverse -81 -93 4.26721 0.256
NP_442568.1_8 Forward -157 -143 10.7177 0.257
NP_442669.1_1 Forward -70 -51 32.3503 0.00000165
NP_441541.1_1 Forward -376 -358 -3.43572 0.264
NP_440833.1_4 Reverse -128 -146 14.3755 0.0722
NP_442499.1_4 Forward -189 -175 11.0127 0.226
NP_442479.1_5 Reverse -29 -48 7.48109 0.222
NP_442840.1_7 Forward -285 -266 13.5691 0.064
NP_440341.1_7 Reverse -159 -173 12.6843 0.2
NP_441848.1_4 Forward -45 -29 8.50558 0.288
NP_441848.1_4 Reverse -1 -17 7.55067 0.288
NP_441811.1_8 Forward -104 -90 5.80112 0.289
NP_440232.1_2 Forward -60 -41 -2.55715 0.171
NP_442679.1_1 Forward -264 -245 3.83436 0.147
NP_442053.1_1 Forward -92 -83 5.70292 0.172
NP_441959.1_8 Forward -386 -373 8.61288 0.286
NP_442456.1_5 Forward -322 -304 6.80398 0.26
NP_442532.1_1 Forward -27 -13 12.2515 0.215
NP_442532.1_4 Reverse -1 -19 12.5219 0.215
NP_442533.1_6 Forward -92 -83 2.35967 0.259
NP_440854.1_2 Forward -38 -19 8.65258 0.26
NP_441482.1_7 Forward -98 -84 -11.0135 0.229
NP_441697.1_5 Forward -20 -1 -10.6478 0.28
NP_440816.1_2 Forward -33 -14 13.2118 0.157
NP_441028.1_6 Reverse -281 -291 14.6309 0.158
NP_441028.1_6 Reverse -23 -33 5.19112 0.265
NP_441527.1_4 Forward -36 -17 4.24897 0.111
NP_441527.1_4 Forward -37 -18 -0.812105 0.146
NP_441527.1_4 Forward -158 -139 -1.09858 0.146
NP_441527.1_4 Forward -159 -140 -1.28956 0.146
NP_441527.1_4 Forward -156 -137 -1.67153 0.148
NP_441527.1_4 Forward -155 -136 -4.15432 0.179
NP_441527.1_4 Forward -157 -138 -11.5072 0.282
NP_441527.1_4 Forward -296 -277 -12.1756 0.285
NP_439965.1_1 Reverse -124 -143 -10.4236 0.3
NP_442673.1_5 Reverse -262 -280 11.4255 0.272
NP_441106.1_7 Forward -125 -106 13.0766 0.205
NP_441825.1_4 Reverse -133 -143 12.5664 0.249
NP_440670.1_8 Forward -92 -83 3.14632 0.296
NP_442463.1_3 Reverse -303 -322 10.0292 0.275
NP_442125.1_2 Forward -42 -23 27.2371 0.000283
NP_440855.1_3 Reverse -152 -171 9.63507 0.185
NP_441431.1_1 Reverse -371 -389 5.06306 0.245
NP_442805.1_6 Forward -325 -306 1.86774 0.292
NP_440114.1_10 Forward -344 -330 7.37441 0.236
NP_440114.1_10 Reverse -83 -97 5.80112 0.292
NP_442324.1_7 Forward -356 -337 6.24429 0.268
NP_440766.1_5 Forward -290 -278 7.65579 0.288
NP_440278.1_1 Forward -132 -113 9.53756 0.155
NP_442930.1_1 Forward -19 -9 13.0576 0.239
NP_442867.1_3 Reverse -8 -27 3.04771 0.193
NP_440213.1_4 Reverse -262 -281 15.6421 0.217
NP_440798.1_1 Forward -19 -1 10.3485 0.294
NP_442680.1_5 Forward -219 -200 7.78977 0.177
NP_441436.1_8 Forward -169 -150 7.07928 0.293
NP_441496.1_1 Reverse -272 -286 14.3354 0.265
NP_440185.1_9 Forward -102 -85 11.9369 0.264
NP_440191.1_4 Reverse -25 -35 13.0511 0.282
NP_440191.1_6 Reverse -371 -385 13.1895 0.294
NP_441397.1_8 Forward -290 -277 15.8179 0.142
NP_441902.1_3 Forward -290 -280 13.0789 0.23
NP_442451.1_7 Forward -391 -372 12.9791 0.113
NP_442451.1_7 Forward -260 -241 8.65258 0.26
NP_441190.1_2 Forward -282 -263 4.03102 0.17
NP_440175.1_4 Forward -100 -81 -2.36049 0.122
NP_440216.1_9 Forward -185 -176 5.50626 0.292
NP_441064.1_4 Reverse -164 -183 7.07928 0.276
NP_442418.1_4 Forward -22 -4 12.6069 0.217
NP_440117.1_7 Forward -249 -235 17.9942 0.0592
NP_442116.1_6 Forward -165 -148 12.5616 0.172
NP_442116.1_6 Reverse -370 -387 7.50051 0.254
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTAACGATGAGAGAATTTAATGTAAAATTATGGAGTGTACAAAATGAACAGGTTTAAACAATGGCTTACAGTTTAGATTTAAGGCAAAGGGTAGTAGCTTATATAGAAGCTGGAGGAAAAATAACTGAGGCTTCCAAGATATATAAAATAGGAAAAGCCTCGATATACAGATGGTTAAATAGAGTAGATTTAAGCCCAATAAAAGTAGAGCGTCGCCATAGGAAATTAGACTGGGAAGCTCTAAAAAAAGACGTAGAAGAAAATCCCGATGCAAGATTGATAGACAGAGCCAAGAAATTTGGAGTGAGGCCGAGTGCCGTATATTACGCATTAGAGCGTGTTTGAAAAGTAGGGTGAAGAATGGAAAATGGTGAAAAGAATAAAATTTTCACCATAATTA

CDS

ATGATAATTCGAGAATTTTACAGCACGGACATCACAGATAGCCAGTGGCAATTGGTAGAACCCCATTTACCCAAAGCAAAAACTGGGGGAAGAAAACGGAAAACTAGTCTGCGGGAGATACTCAATGCTATTTTTTACATGCTCAGAACGGGGTGTGCCTGGCGACTTCTGCCCCATGATTTTCCTAAATGGCGAACGGTCTATGGTTATTTCCAGCCATGGCACGAAGATGGTACCTGGAAAAAATTAAATCGTATCTTCCGTGAGAAAGTTCGGCTCAAAGCTGGAAGAAATACTCACCCTAGTGCCGGTTGTTTAGATTCACAGTCACTTAAAAAGGCTGGAACTGGCCAAGAAACTGGCTATGACGGCGGAAAAAAGGTCAATGGTCGTAAACGTACAATCCTCGTGGATACCATGGGATTACTTCTCGATGTTGTCGTCCATGGTGCCCATCGCTCTGACCATCAGGGTCTGATTCTACTTGCTACCTGGTTTGCTCCCCTTTGGCAGTGCCTGCAAGTTATATGGACTGATAGCACCTTTGGCGGAAAGGATTTTATCTATTGGGTGGAGCATACTTTTGGTTGGAATTTGAATGTCGTCAGCAAAAAGCAGGGACAAAAAGGTTTTGAAGTCTTACCCCGCCGTTGGGTAGTCGAGCGCACCTTTGCTTGGTTTGGTCGCTATCGTCGTTTAAGCAAGGATTATGAATATTTACCTACCACCAGTGAGACCATGCTCTATGTTGCCATGGTTCATCTCATGCTTCAAAGGCTTGCTTAA

Protein

MIIREFYSTDITDSQWQLVEPHLPKAKTGGRKRKTSLREILNAIFYMLRTGCAWRLLPHDFPKWRTVYGYFQPWHEDGTWKKLNRIFREKVRLKAGRNTHPSAGCLDSQSLKKAGTGQETGYDGGKKVNGRKRTILVDTMGLLLDVVVHGAHRSDHQGLILLATWFAPLWQCLQVIWTDSTFGGKDFIYWVEHTFGWNLNVVSKKQGQKGFEVLPRRWVVERTFAWFGRYRRLSKDYEYLPTTSETMLYVAMVHLMLQRLA