Your browser is old and dusty. Try Google Chrome!

Details for slr0698

ORF slr0698
Accession NP_442659.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -377 -391 13.2743 0.0413
NP_441061.1_2 Forward -229 -215 8.25939 0.0917
NP_441061.1_2 Reverse -32 -46 5.60446 0.132
NP_441061.1_2 Reverse -221 -235 -2.36035 0.29
NP_440795.1_7 Forward -39 -32 14.6904 0.0123
NP_440795.1_7 Reverse -32 -39 14.6904 0.0123
NP_440795.1_7 Forward -255 -248 10.2655 0.154
NP_441418.1_6 Reverse -31 -50 -28.8115 0.211
NP_441418.1_6 Forward -391 -372 -29.7948 0.238
NP_441418.1_6 Forward -379 -360 -30.0898 0.256
NP_441418.1_6 Forward -385 -366 -30.5815 0.286
NP_441418.1_6 Forward -300 -281 -30.7781 0.296
NP_442291.1_5 Reverse -30 -46 0.0585348 0.174
NP_441453.1_1 Reverse -24 -42 6.01657 0.242
NP_441453.1_4 Reverse -31 -39 16.539 0.00633
NP_441453.1_4 Forward -40 -32 16.539 0.00633
NP_441453.1_4 Reverse -376 -384 4.14932 0.264
NP_441623.1_6 Forward -240 -221 12.7825 0.252
NP_442151.1_6 Forward -40 -26 14.7492 0.032
NP_442151.1_6 Reverse -220 -234 13.4709 0.0512
NP_442151.1_6 Reverse -31 -45 12.291 0.0771
NP_442151.1_6 Reverse -376 -390 5.99778 0.253
NP_441818.1_1 Reverse -377 -388 10.2846 0.232
NP_441818.1_1 Reverse -32 -43 9.79292 0.232
NP_440226.1_1 Forward -40 -21 3.73603 0.215
NP_441342.1_1 Reverse -207 -226 21.4356 0.0916
NP_440150.1_2 Forward -57 -38 4.22689 0.281
NP_440996.1_4 Forward -179 -169 15.713 0.27
NP_442744.1_8 Reverse -31 -50 2.45773 0.196
NP_442655.1_1 Reverse -26 -45 1.37609 0.238
NP_442173.1_1 Forward -39 -31 15.4574 0.00633
NP_442173.1_1 Reverse -32 -40 15.4574 0.00633
NP_442752.1_4 Forward -40 -33 13.8055 0.0199
NP_442752.1_4 Reverse -31 -38 13.8055 0.0199
NP_443027.1_4 Forward -42 -32 11.0914 0.107
NP_443027.1_4 Reverse -29 -39 7.25653 0.24
NP_441745.1_3 Forward -382 -363 16.2232 0.215
NP_441812.1_3 Forward -41 -27 9.2427 0.245
NP_442975.1_10 Reverse -27 -41 18.0918 0.00914
NP_442975.1_10 Reverse -75 -89 3.34225 0.259
NP_440784.1_7 Forward -39 -32 15.9687 0.0123
NP_440784.1_7 Reverse -32 -39 15.9687 0.0123
NP_440784.1_7 Reverse -377 -384 10.2655 0.0801
NP_442909.1_7 Forward -161 -147 5.80051 0.269
NP_441250.1_2 Reverse -290 -309 18.7807 0.219
NP_440061.1_9 Reverse -29 -43 18.4851 0.00917
NP_440110.1_4 Forward -51 -32 5.211 0.173
NP_440110.1_7 Forward -266 -247 18.9773 0.212
NP_441499.1_5 Forward -165 -151 11.996 0.292
NP_442062.1_8 Reverse -31 -41 17.3846 0.00193
NP_442062.1_8 Forward -40 -30 10.3048 0.0493
NP_442062.1_8 Reverse -376 -386 4.60159 0.206
NP_440761.1_4 Reverse -26 -45 -13.5702 0.257
NP_441900.1_2 Forward -272 -254 -4.01314 0.288
NP_441859.1_3 Forward -257 -238 4.22689 0.228
NP_440304.1_4 Reverse -29 -39 10.8948 0.051
NP_440304.1_4 Forward -393 -383 5.68323 0.196
NP_440304.1_4 Forward -387 -377 5.28991 0.218
NP_440304.1_4 Forward -231 -221 3.02829 0.299
NP_440304.1_4 Forward -42 -32 1.84832 0.299
NP_442242.1_4 Forward -39 -32 14.3954 0.0124
NP_442242.1_4 Reverse -32 -39 14.3954 0.0124
NP_441208.1_9 Forward -149 -135 5.30946 0.271
NP_441594.1_6 Forward -359 -340 5.11266 0.209
NP_441594.1_6 Reverse -373 -392 4.62101 0.216
NP_440370.1_10 Forward -155 -136 8.25926 0.243
NP_442110.1_7 Reverse -31 -45 10.6193 0.0644
NP_441925.1_4 Reverse -372 -391 -17.2092 0.29
NP_441083.1_3 Forward -386 -376 13.0576 0.23
NP_441083.1_5 Reverse -31 -41 20.3345 0.00053
NP_441083.1_5 Forward -40 -30 11.2881 0.0159
NP_441083.1_5 Reverse -163 -173 3.12662 0.182
NP_441083.1_5 Reverse -376 -386 1.06167 0.218
NP_441083.1_5 Forward -385 -375 0.0783647 0.245
NP_442827.1_8 Forward -48 -29 -2.95123 0.294
NP_441738.1_2 Forward -38 -31 15.28 0.0102
NP_441738.1_2 Reverse -33 -40 15.28 0.0102
NP_441738.1_2 Forward -276 -269 8.29857 0.176
NP_441558.1_5 Forward -42 -23 20.4523 0.00485
NP_441558.1_5 Reverse -29 -48 3.83436 0.296
NP_440209.1_1 Reverse -31 -39 18.1123 0.00295
NP_440209.1_1 Forward -40 -32 18.1123 0.00295
NP_442889.1_8 Reverse -28 -42 8.25877 0.126
NP_441713.1_1 Forward -46 -27 -16.2252 0.278
NP_441770.1_5 Forward -286 -267 0.196116 0.244
NP_440178.1_7 Reverse -375 -394 -13.7669 0.143
NP_440178.1_7 Reverse -43 -62 -23.2067 0.298
NP_442570.1_3 Forward -154 -135 -5.11376 0.24
NP_440538.1_10 Reverse -35 -54 11.5042 0.253
NP_441716.1_1 Reverse -31 -45 10.7177 0.0936
NP_441716.1_1 Forward -385 -371 7.9644 0.153
NP_442111.1_4 Reverse -30 -44 11.6026 0.0488
NP_442111.1_4 Forward -41 -27 9.93102 0.0575
NP_441624.1_7 Forward -262 -248 6.78443 0.275
NP_441163.1_1 Forward -141 -124 10.6578 0.205
NP_441163.1_1 Reverse -255 -272 4.65968 0.286
NP_441163.1_1 Forward -54 -37 4.26636 0.291
NP_440906.1_5 Forward -39 -32 15.8704 0.0124
NP_440906.1_5 Reverse -32 -39 15.8704 0.0124
NP_440747.1_10 Forward -43 -31 26.5883 0.000317
NP_440747.1_10 Reverse -28 -40 5.44718 0.0137
NP_440747.1_10 Forward -388 -376 -11.7607 0.142
NP_441854.1_10 Reverse -45 -64 3.6377 0.282
NP_441486.1_1 Forward -43 -29 -1.96703 0.175
NP_441486.1_1 Reverse -28 -42 -3.04867 0.175
NP_441486.1_1 Forward -388 -374 -6.29359 0.288
NP_442145.1_3 Forward -249 -230 6.09597 0.243
NP_442634.1_4 Forward -42 -28 -1.5737 0.149
NP_442634.1_4 Reverse -29 -43 -1.5737 0.149
NP_442634.1_4 Forward -231 -217 -5.50694 0.258
NP_440403.1_10 Forward -232 -213 10.0292 0.186
NP_440842.1_10 Reverse -373 -387 0.982901 0.296
NP_441014.1_10 Forward -386 -367 -1.08295 0.257
NP_442848.1_1 Reverse -370 -384 -4.4253 0.291
NP_442848.1_1 Forward -391 -377 -4.62196 0.298
NP_441012.1_4 Reverse -243 -256 7.49244 0.272
NP_441012.1_4 Reverse -378 -391 5.62415 0.291
NP_443018.1_3 Forward -39 -32 14.8871 0.0123
NP_443018.1_3 Reverse -32 -39 14.8871 0.0123
NP_443018.1_3 Forward -255 -248 4.36568 0.254
NP_443018.1_3 Forward -384 -377 4.26735 0.267
NP_443018.1_3 Reverse -377 -384 4.16902 0.278
NP_443018.1_3 Reverse -248 -255 4.07068 0.299
NP_441634.1_5 Forward -149 -135 16.4209 0.18
NP_441634.1_8 Forward -42 -28 -3.24533 0.295
NP_440376.1_1 Forward -40 -31 19.4693 0.000692
NP_440376.1_1 Reverse -31 -40 19.4693 0.000692
NP_440376.1_1 Forward -385 -376 6.98123 0.088
NP_440376.1_1 Forward -146 -137 1.96635 0.236
NP_440376.1_1 Reverse -376 -385 0.393051 0.279
NP_441588.1_4 Forward -38 -28 13.943 0.0841
NP_442687.1_7 Reverse -246 -256 10.9931 0.0994
NP_442687.1_7 Reverse -30 -40 9.02648 0.0994
NP_442687.1_7 Forward -41 -31 8.92815 0.0994
NP_442687.1_7 Reverse -375 -385 7.94484 0.121
NP_442687.1_7 Forward -173 -163 5.5849 0.194
NP_442485.1_3 Reverse -42 -61 -1.7705 0.261
NP_442485.1_3 Reverse -209 -228 -2.55715 0.262
NP_441846.1_10 Forward -22 -3 -13.5702 0.206
NP_441846.1_10 Forward -172 -153 -16.1268 0.256
NP_441846.1_10 Forward -133 -114 -23.1083 0.277
NP_441013.1_2 Forward -390 -372 3.95239 0.229
NP_441013.1_2 Forward -261 -243 2.96908 0.231
NP_442770.1_1 Reverse -109 -123 15.8302 0.271
NP_441422.1_7 Reverse -39 -56 -4.97604 0.247
NP_441422.1_7 Forward -237 -220 -8.90928 0.286
NP_440533.1_9 Reverse -247 -266 4.81767 0.216
NP_441950.1_7 Forward -397 -378 -8.26035 0.287
NP_440887.1_8 Forward -379 -365 17.9942 0.124
NP_440360.1_5 Reverse -44 -63 -1.37718 0.297
NP_442658.1_1 Reverse -29 -39 13.0576 0.04
NP_442658.1_1 Forward -42 -32 7.94438 0.199
NP_442658.1_1 Forward -387 -377 6.46942 0.229
NP_442658.1_1 Forward -258 -248 4.89613 0.292
NP_440141.1_4 Forward -394 -375 -11.8986 0.298
NP_442782.1_2 Forward -229 -215 7.76774 0.202
NP_441414.1_9 Forward -40 -21 -2.55715 0.119
NP_440184.1_5 Forward -50 -31 8.25926 0.201
NP_440607.1_8 Forward -258 -239 -0.983855 0.296
NP_441487.1_9 Reverse -115 -134 -2.0655 0.292
NP_441478.1_7 Forward -391 -377 21.9274 0.153
NP_442937.1_5 Forward -390 -371 8.35759 0.225
NP_442321.1_1 Forward -387 -368 -7.86702 0.276
NP_441958.1_5 Reverse -30 -40 21.2195 0.000805
NP_441958.1_5 Forward -41 -31 12.2714 0.00183
NP_441958.1_5 Reverse -375 -385 1.25834 0.108
NP_441127.1_1 Forward -165 -151 7.57108 0.3
NP_442836.1_5 Forward -46 -27 4.71934 0.204
NP_440203.1_5 Reverse -49 -59 12.4676 0.147
NP_442816.1_3 Reverse -214 -233 18.9773 0.229
NP_440984.1_7 Forward -45 -31 9.63603 0.127
NP_440984.1_7 Reverse -26 -40 7.86607 0.161
NP_440984.1_7 Forward -51 -37 4.62115 0.296
NP_439990.1_5 Forward -45 -32 13.7856 0.0889
NP_439990.1_5 Reverse -26 -39 7.78743 0.186
NP_442911.1_2 Reverse -366 -385 2.55606 0.0499
NP_440153.1_5 Reverse -32 -46 11.3077 0.0763
NP_440153.1_8 Reverse -1 -14 6.1158 0.175
NP_440153.1_8 Reverse -220 -233 4.64084 0.196
NP_440153.1_8 Reverse -376 -389 -2.83231 0.266
NP_441591.1_10 Forward -58 -39 4.32602 0.297
NP_440200.1_7 Reverse -187 -206 6.9924 0.204
NP_440993.1_3 Forward -50 -31 -1.96793 0.292
NP_440993.1_4 Reverse -137 -154 2.30045 0.3
NP_440934.1_2 Reverse -132 -151 3.24438 0.239
NP_441348.1_3 Reverse -26 -45 12.7825 0.138
NP_441099.1_5 Reverse -21 -40 -10.1286 0.243
NP_441099.1_5 Reverse -124 -143 -12.0953 0.294
NP_441099.1_5 Forward -395 -376 -12.1936 0.296
NP_440809.1_9 Reverse -22 -40 -8.24065 0.23
NP_441294.1_7 Reverse -27 -41 9.82656 0.223
NP_440411.1_10 Forward -387 -368 16.9955 0.187
NP_441646.1_1 Reverse -369 -388 2.3594 0.218
NP_442438.1_10 Forward -45 -31 9.04604 0.0692
NP_442438.1_10 Forward -390 -376 4.42448 0.147
NP_442438.1_10 Forward -261 -247 2.85119 0.168
NP_442566.1_2 Reverse -277 -296 2.45773 0.289
NP_441292.1_2 Reverse -141 -160 -7.57203 0.263
NP_441752.1_6 Reverse -363 -382 -1.27885 0.287
NP_440484.1_3 Forward -42 -28 10.6193 0.242
NP_440147.1_4 Reverse -29 -42 20.5705 0.00219
NP_440147.1_4 Forward -42 -29 8.18076 0.0546
NP_440147.1_4 Reverse -374 -387 1.69091 0.222
NP_441550.1_8 Reverse -29 -39 15.3192 0.0132
NP_441550.1_8 Forward -42 -32 15.1225 0.0132
NP_441916.1_7 Forward -40 -30 18.9579 0.00144
NP_441916.1_7 Reverse -31 -41 10.3048 0.0261
NP_441916.1_7 Forward -385 -375 4.60159 0.169
NP_440206.1_4 Reverse -216 -235 6.98015 0.212
NP_441041.1_4 Forward -397 -378 -0.295539 0.0941
NP_441041.1_4 Forward -235 -216 -1.47551 0.1
NP_441041.1_4 Forward -40 -21 -2.95047 0.118
NP_441041.1_7 Reverse -28 -40 8.2922 0.139
NP_441041.1_7 Forward -43 -31 7.51478 0.162
NP_443063.1_7 Forward -386 -370 6.64671 0.288
NP_440703.1_9 Reverse -370 -383 8.08184 0.249
NP_441725.1_4 Forward -45 -31 4.42388 0.278
NP_441725.1_5 Forward -384 -374 2.24165 0.115
NP_441725.1_5 Reverse -32 -42 2.04498 0.115
NP_441725.1_5 Forward -39 -29 1.94665 0.115
NP_441725.1_5 Reverse -343 -353 -1.10161 0.288
NP_439966.1_7 Forward -42 -32 15.3192 0.0152
NP_439966.1_7 Reverse -29 -39 6.27276 0.185
NP_442941.1_3 Reverse -32 -42 19.2529 0.00262
NP_442941.1_3 Forward -39 -29 11.0914 0.0116
NP_440289.1_2 Forward -388 -375 2.67422 0.0907
NP_440289.1_2 Forward -43 -30 -3.71729 0.267
NP_440289.1_2 Reverse -28 -41 -4.89726 0.294
NP_440260.1_8 Forward -394 -376 -2.63579 0.245
NP_440260.1_8 Reverse -122 -140 -7.06068 0.295
NP_440260.1_8 Forward -49 -31 -7.15901 0.295
NP_442281.1_1 Forward -45 -31 16.5185 0.00772
NP_442281.1_1 Reverse -132 -146 1.96562 0.282
NP_440177.1_1 Forward -234 -216 6.31233 0.272
NP_442256.1_2 Forward -42 -24 -8.04399 0.217
NP_440647.1_9 Forward -42 -24 5.91901 0.229
NP_442012.1_1 Reverse -241 -260 -0.4922 0.259
NP_442012.1_5 Forward -236 -217 -0.4922 0.288
NP_441556.1_10 Forward -45 -31 13.0446 0.182
NP_441644.1_6 Forward -40 -30 19.0557 0.000803
NP_441644.1_6 Reverse -31 -41 17.3841 0.00127
NP_441644.1_6 Forward -235 -225 7.64939 0.121
NP_441644.1_6 Reverse -376 -386 6.17443 0.165
NP_441644.1_6 Forward -256 -246 5.28945 0.199
NP_441644.1_6 Forward -385 -375 4.69947 0.228
NP_442215.1_2 Reverse -29 -45 7.92501 0.0666
NP_442215.1_2 Forward -49 -33 -3.48138 0.216
NP_442215.1_2 Reverse -135 -151 -4.75968 0.239
NP_442215.1_2 Forward -387 -371 -7.11963 0.286
NP_442029.1_6 Forward -151 -132 8.84924 0.2
NP_442029.1_6 Reverse -26 -45 7.37428 0.224
NP_442247.1_8 Forward -42 -28 8.35772 0.273
NP_440253.1_2 Forward -40 -22 1.78911 0.152
NP_440253.1_2 Forward -188 -170 -3.32411 0.291
NP_440929.1_8 Forward -40 -31 19.2726 0.000701
NP_440929.1_8 Reverse -31 -40 19.2726 0.000701
NP_440929.1_8 Forward -385 -376 8.25953 0.043
NP_440469.1_3 Reverse -23 -42 16.4207 0.251
NP_442933.1_10 Forward -40 -31 17.601 0.00325
NP_442933.1_10 Reverse -31 -40 17.601 0.00325
NP_442933.1_10 Forward -385 -376 12.3894 0.0245
NP_441751.2_8 Reverse -32 -46 7.57108 0.0339
NP_441751.2_8 Reverse -377 -391 -6.58858 0.273
NP_442554.1_8 Forward -39 -29 16.4013 0.0065
NP_442554.1_8 Reverse -32 -42 16.2046 0.0065
NP_442554.1_8 Reverse -377 -387 7.55152 0.0893
NP_442554.1_8 Forward -384 -374 4.20827 0.193
NP_441762.1_7 Forward -41 -29 0.333971 0.0747
NP_441762.1_7 Forward -257 -245 -5.86088 0.246
NP_441762.1_7 Reverse -30 -42 -6.64753 0.284
NP_442313.1_4 Forward -151 -132 16.8141 0.163
NP_442142.1_4 Forward -43 -30 14.08 0.0317
NP_442142.1_4 Reverse -244 -257 6.21356 0.17
NP_442142.1_4 Reverse -379 -392 5.52525 0.188
NP_442142.1_4 Reverse -373 -386 4.54195 0.217
NP_442142.1_4 Reverse -28 -41 2.37867 0.294
NP_442292.1_1 Reverse -32 -41 18.486 0.00229
NP_442292.1_1 Forward -39 -30 17.5026 0.00435
NP_442292.1_1 Reverse -377 -386 6.09625 0.116
NP_442292.1_5 Reverse -210 -229 -2.26216 0.285
NP_441525.1_1 Reverse -211 -224 11.524 0.291
NP_442476.1_6 Reverse -32 -46 1.96621 0.199
NP_440895.1_6 Forward -46 -33 9.75405 0.218
NP_440895.1_10 Reverse -115 -132 -4.28772 0.215
NP_443009.1_2 Reverse -378 -397 4.03102 0.216
NP_443009.1_5 Forward -41 -30 14.5128 0.02
NP_443009.1_5 Reverse -30 -41 10.1862 0.0792
NP_441715.1_4 Reverse -32 -42 17.3846 0.0106
NP_441715.1_4 Forward -39 -29 7.35486 0.108
NP_440881.1_4 Forward -242 -223 0.491109 0.226
NP_440730.1_4 Reverse -314 -333 -3.73712 0.298
NP_441448.1_2 Reverse -158 -177 7.57013 0.134
NP_440183.1_9 Forward -336 -317 -13.6686 0.26
NP_441198.1_8 Reverse -29 -39 12.783 0.116
NP_440379.1_5 Forward -155 -136 -6.68705 0.238
NP_440379.1_5 Forward -394 -375 -6.78538 0.238
NP_440379.1_5 Reverse -122 -141 -10.6203 0.281
NP_441468.1_1 Forward -39 -32 15.8704 0.0124
NP_441468.1_1 Reverse -32 -39 15.8704 0.0124
NP_441468.1_1 Forward -384 -377 10.2655 0.0906
NP_441468.1_1 Forward -255 -248 4.46401 0.224
NP_441020.2_6 Forward -387 -370 13.6085 0.0708
NP_441020.2_6 Forward -258 -241 6.43035 0.262
NP_441015.1_10 Reverse -26 -45 -5.21209 0.219
NP_441015.1_10 Forward -145 -126 -9.83364 0.282
NP_441015.1_10 Forward -396 -377 -9.93197 0.282
NP_441015.1_10 Forward -390 -371 -10.522 0.284
NP_441015.1_10 Forward -58 -39 -10.817 0.288
NP_441673.1_1 Forward -40 -31 20.8459 0.000698
NP_441673.1_1 Reverse -31 -40 20.8459 0.000698
NP_441673.1_1 Forward -385 -376 1.57302 0.0764
NP_441673.1_1 Reverse -376 -385 1.57302 0.0764
NP_441731.1_3 Forward -155 -136 -1.96717 0.284
NP_441731.1_3 Forward -48 -29 -3.83545 0.284
NP_441826.1_2 Forward -46 -32 16.4209 0.0187
NP_441826.1_2 Reverse -370 -384 1.17956 0.161
NP_441826.1_2 Reverse -376 -390 0.294584 0.19
NP_441826.1_2 Forward -391 -377 -3.24533 0.284
NP_441826.1_2 Reverse -38 -52 -4.52363 0.296
NP_441826.1_5 Forward -397 -378 6.68596 0.222
NP_441826.1_5 Reverse -377 -396 3.83436 0.259
NP_441826.1_5 Reverse -371 -390 1.37609 0.291
NP_441330.1_1 Forward -45 -26 -13.0786 0.183
NP_441330.1_1 Reverse -26 -45 -13.5702 0.195
NP_442745.1_1 Forward -380 -361 12.6841 0.211
NP_442868.1_6 Forward -42 -32 19.2529 0.00563
NP_442868.1_6 Forward -231 -221 5.09324 0.158
NP_442868.1_6 Reverse -29 -39 0.963343 0.205
NP_442868.1_6 Reverse -245 -255 -0.216628 0.273
NP_442719.1_2 Reverse -96 -114 -6.07808 0.224
NP_441612.1_2 Reverse -31 -41 8.54929 0.21
NP_440789.1_8 Forward -136 -117 12.8808 0.28
NP_442427.1_8 Reverse -22 -41 10.0292 0.168
NP_442808.1_1 Reverse -30 -40 8.73102 0.0481
NP_442808.1_1 Forward -41 -31 8.63269 0.0481
NP_442808.1_1 Reverse -136 -146 2.33954 0.27
NP_440145.1_3 Reverse -21 -40 7.27595 0.0481
NP_440145.1_3 Forward -395 -376 7.17762 0.0487
NP_440145.1_3 Forward -50 -31 1.47442 0.128
NP_442542.1_2 Forward -393 -380 8.67241 0.152
NP_442542.1_9 Forward -398 -384 7.86545 0.181
NP_442113.1_3 Reverse -279 -298 10.1275 0.19
NP_442050.1_1 Forward -135 -116 11.2092 0.233
NP_442050.1_1 Forward -263 -244 8.84924 0.25
NP_442050.1_5 Forward -42 -32 14.3359 0.0206
NP_442050.1_5 Reverse -29 -39 9.22267 0.193
NP_442342.1_9 Reverse -374 -390 3.50012 0.26
NP_440558.1_2 Reverse -367 -386 -2.16383 0.223
NP_440558.1_2 Reverse -211 -230 -2.16383 0.223
NP_440558.1_2 Reverse -373 -392 -5.40875 0.258
NP_441878.1_6 Forward -386 -376 10.6981 0.0176
NP_441878.1_6 Reverse -30 -40 10.5014 0.0176
NP_441878.1_6 Forward -41 -31 10.4031 0.0176
NP_441878.1_6 Reverse -375 -385 9.81313 0.0212
NP_441878.1_6 Forward -47 -37 -0.0199663 0.163
NP_441036.1_8 Reverse -30 -40 15.713 0.00724
NP_441036.1_8 Forward -41 -31 8.33817 0.174
NP_442650.1_2 Forward -235 -221 3.04785 0.225
NP_441557.1_5 Forward -40 -31 19.9609 0.000699
NP_441557.1_5 Reverse -31 -40 19.9609 0.000699
NP_441557.1_5 Forward -385 -376 0.688044 0.128
NP_441557.1_5 Reverse -376 -385 0.688044 0.128
NP_441557.1_8 Reverse -156 -166 10.9926 0.269
NP_442066.2_4 Reverse -31 -50 -5.99873 0.246
NP_442066.2_7 Reverse -7 -26 4.62101 0.261
NP_441433.1_8 Forward -127 -108 0.392778 0.24
NP_441433.1_8 Reverse -221 -240 -0.688862 0.249
NP_442419.1_2 Forward -45 -26 -3.73712 0.27
NP_440101.1_3 Reverse -42 -61 2.3594 0.257
NP_440676.1_7 Forward -61 -42 19.469 0.0894
NP_442397.1_9 Forward -53 -34 0.982764 0.299
NP_440356.1_1 Reverse -157 -176 11.7983 0.282
NP_441574.1_1 Forward -397 -378 -5.80207 0.268
NP_441574.1_1 Forward -59 -40 -6.68705 0.277
NP_442170.1_5 Forward -40 -21 -0.39387 0.234
NP_442347.1_2 Reverse -32 -41 12.4878 0.056
NP_442347.1_2 Reverse -80 -89 5.99792 0.201
NP_442347.1_2 Forward -39 -30 3.34298 0.284
NP_442645.1_2 Forward -48 -29 -15.7335 0.209
NP_442965.1_2 Forward -139 -120 -7.4737 0.27
NP_442888.1_7 Forward -55 -36 9.63589 0.295
NP_441037.1_4 Reverse -29 -39 15.0168 0.028
NP_441037.1_4 Forward -88 -78 7.02532 0.237
NP_441037.1_4 Forward -12 -2 6.14821 0.278
NP_442594.1_8 Forward -142 -123 4.03102 0.274
NP_442047.1_2 Forward -60 -46 13.8643 0.203
NP_441633.1_3 Forward -42 -29 3.36254 0.0699
NP_441633.1_3 Reverse -29 -42 -5.97891 0.236
NP_440136.1_2 Forward -39 -32 15.9687 0.0123
NP_440136.1_2 Reverse -32 -39 15.9687 0.0123
NP_442590.1_10 Reverse -208 -227 6.09597 0.25
NP_442998.1_5 Forward -115 -105 14.7297 0.149
NP_442998.1_10 Forward -38 -31 15.5754 0.0102
NP_442998.1_10 Reverse -33 -40 15.5754 0.0102
NP_440299.1_1 Forward -44 -31 20.2748 0.00128
NP_440299.1_1 Reverse -372 -385 8.86849 0.0835
NP_440299.1_1 Reverse -243 -256 5.23026 0.184
NP_440299.1_1 Reverse -27 -40 3.95196 0.224
NP_441799.1_1 Reverse -27 -41 14.7486 0.0222
NP_441799.1_1 Forward -44 -30 7.57046 0.138
NP_441799.1_1 Forward -282 -268 5.30886 0.214
NP_441799.1_9 Forward -173 -154 -0.4922 0.213
NP_441007.1_10 Forward -390 -377 2.47756 0.186
NP_441007.1_10 Forward -396 -383 -0.177378 0.268
NP_441007.1_10 Forward -45 -32 -0.669033 0.287
NP_440256.1_1 Forward -43 -24 -1.27885 0.102
NP_440256.1_1 Forward -303 -284 -5.31042 0.18
NP_440456.1_7 Reverse -257 -271 12.0943 0.281
NP_440456.1_7 Forward -118 -104 11.2093 0.285
NP_441559.1_8 Forward -45 -31 2.94952 0.143
NP_441559.1_8 Reverse -26 -40 -7.67023 0.297
NP_440915.1_6 Forward -44 -30 19.6658 0.00738
NP_440915.1_6 Forward -389 -375 11.6026 0.0254
NP_440915.1_6 Forward -260 -246 -0.0987402 0.182
NP_440997.1_4 Reverse -374 -393 11.3075 0.276
NP_440717.1_1 Reverse -221 -240 8.65258 0.263
NP_440717.1_3 Reverse -127 -141 10.9137 0.23
NP_442785.1_7 Reverse -29 -43 8.35772 0.298
NP_442866.1_1 Forward -157 -138 -0.885524 0.202
NP_441464.1_8 Forward -40 -26 4.81781 0.263
NP_440026.1_7 Forward -18 -3 13.5496 0.295
NP_440306.1_8 Reverse -99 -118 -2.16459 0.245
NP_440695.1_6 Forward -243 -229 11.7688 0.265
NP_440695.1_6 Reverse -103 -117 10.7022 0.265
NP_441939.1_3 Reverse -32 -51 10.3242 0.126
NP_442993.1_1 Forward -165 -149 -4.07137 0.137
NP_442993.1_1 Forward -40 -24 -9.97122 0.201
NP_442386.1_9 Forward -41 -32 13.8639 0.0289
NP_442386.1_9 Reverse -136 -145 9.43907 0.161
NP_442386.1_9 Reverse -30 -39 6.39082 0.219
NP_442386.1_9 Forward -257 -248 5.21086 0.262
NP_440570.1_5 Forward -266 -247 -2.65548 0.28
NP_441340.1_5 Forward -39 -32 15.6737 0.0124
NP_441340.1_5 Reverse -32 -39 15.6737 0.0124
NP_441340.1_5 Reverse -377 -384 4.07068 0.239
NP_441340.1_5 Reverse -248 -255 3.97235 0.274
NP_440168.1_9 Reverse -252 -271 -2.26216 0.28
NP_440327.1_6 Forward -151 -132 10.5209 0.191
NP_440161.1_3 Forward -42 -23 8.75091 0.264
NP_440586.1_8 Forward -39 -32 13.2151 0.026
NP_440586.1_8 Reverse -32 -39 13.2151 0.026
NP_442251.1_6 Forward -39 -32 15.2804 0.0124
NP_442251.1_6 Reverse -32 -39 15.2804 0.0124
NP_441262.1_3 Reverse -31 -38 14.7888 0.0223
NP_441262.1_3 Forward -40 -33 14.7888 0.0223
NP_440027.1_3 Reverse -31 -49 10.5398 0.173
NP_440027.1_3 Reverse -376 -394 2.57501 0.289
NP_440027.1_3 Reverse -137 -155 2.47668 0.289
NP_443051.1_1 Reverse -30 -39 19.5676 0.00335
NP_443051.1_1 Forward -41 -32 10.4228 0.00754
NP_443051.1_1 Reverse -375 -384 -1.18024 0.297
NP_441595.1_3 Forward -389 -379 17.2863 0.202
NP_440836.1_6 Forward -56 -42 6.58777 0.279
NP_440408.1_7 Reverse -370 -389 12.5858 0.21
NP_440439.1_1 Forward -43 -30 8.86907 0.0488
NP_440372.1_2 Forward -39 -32 16.3621 0.0124
NP_440372.1_2 Reverse -32 -39 16.3621 0.0124
NP_441789.1_7 Reverse -154 -173 9.04509 0.193
NP_440316.1_10 Forward -392 -382 14.533 0.194
NP_440316.1_10 Forward -47 -37 8.4365 0.239
NP_440316.1_10 Forward -123 -113 7.45319 0.251
NP_441803.1_2 Reverse -371 -390 1.47442 0.23
NP_441803.1_2 Reverse -215 -234 -1.18052 0.294
NP_439977.1_5 Reverse -131 -150 -2.26216 0.273
NP_439977.1_5 Forward -391 -372 -2.85214 0.29
NP_441572.1_7 Forward -46 -27 -0.885524 0.184
NP_442384.1_10 Reverse -31 -44 20.8655 0.00194
NP_442384.1_10 Forward -385 -372 7.98409 0.0711
NP_442384.1_10 Forward -40 -27 6.80412 0.0939
NP_440948.1_7 Forward -263 -244 18.9773 0.123
NP_441018.1_7 Forward -395 -376 7.17762 0.276
NP_441018.1_7 Forward -150 -131 6.78429 0.282
NP_441018.1_7 Forward -389 -370 6.09597 0.299
NP_442790.1_4 Forward -49 -30 11.6025 0.0638
NP_442262.1_10 Forward -39 -32 14.1988 0.0123
NP_442262.1_10 Reverse -32 -39 14.1988 0.0123
NP_441689.1_5 Reverse -29 -39 8.3377 0.132
NP_441689.1_5 Forward -42 -32 5.78111 0.197
NP_440163.1_10 Forward -259 -249 14.533 0.102
NP_440344.1_10 Reverse -24 -41 -8.22096 0.124
NP_440344.1_10 Reverse -240 -257 -13.3342 0.282
NP_440282.1_10 Reverse -366 -385 -9.63698 0.286
NP_441060.1_3 Reverse -55 -74 14.5524 0.184
NP_440562.1_1 Forward -168 -149 12.0933 0.269
NP_441965.1_10 Reverse -28 -44 4.77842 0.231
NP_440297.1_9 Forward -384 -374 9.22315 0.0917
NP_440297.1_9 Reverse -32 -42 -0.118297 0.282
NP_440297.1_9 Forward -39 -29 -0.216628 0.282
NP_442280.1_10 Forward -155 -137 4.67522 0.296
NP_441592.1_4 Reverse -31 -50 10.5209 0.124
NP_440894.1_2 Reverse -114 -133 -2.26216 0.296
NP_440999.1_9 Forward -44 -30 7.57108 0.0846
NP_440999.1_9 Reverse -40 -54 -0.787057 0.217
NP_440888.1_2 Reverse -31 -45 17.7968 0.00308
NP_440888.1_2 Reverse -376 -390 15.8302 0.00862
NP_440888.1_2 Reverse -382 -396 9.53707 0.123
NP_440888.1_2 Reverse -247 -261 7.96378 0.175
NP_440888.1_2 Forward -40 -26 7.17714 0.205
NP_439969.1_1 Reverse -245 -264 0.0977854 0.218
NP_441543.1_2 Reverse -32 -41 16.9127 0.00359
NP_441543.1_2 Forward -39 -30 15.9293 0.00518
NP_441543.1_2 Reverse -377 -386 5.21127 0.209
NP_442845.1_2 Forward -391 -377 12.7826 0.104
NP_442845.1_2 Reverse -25 -39 9.2427 0.178
NP_442845.1_2 Forward -46 -32 7.76774 0.195
NP_442845.1_2 Reverse -31 -45 7.37441 0.195
NP_441834.1_10 Forward -390 -371 4.32602 0.26
NP_441469.1_8 Reverse -30 -39 6.5879 0.227
NP_441469.1_8 Forward -41 -32 6.48957 0.227
NP_441469.1_8 Reverse -136 -145 5.21127 0.283
NP_441469.1_8 Forward -257 -248 5.11294 0.289
NP_443064.1_6 Reverse -31 -41 12.5669 0.0796
NP_443064.1_6 Reverse -163 -173 10.8217 0.13
NP_443064.1_6 Forward -40 -30 10.8217 0.13
NP_442337.1_8 Forward -152 -133 8.06259 0.191
NP_442578.1_5 Reverse -104 -123 -0.0988766 0.283
NP_442578.1_7 Forward -39 -32 14.5921 0.026
NP_442578.1_7 Reverse -32 -39 14.5921 0.026
NP_441462.1_2 Forward -40 -30 20.2362 0.000805
NP_441462.1_2 Reverse -31 -41 11.5831 0.00406
NP_441462.1_2 Forward -385 -375 0.865012 0.117
NP_441462.1_5 Reverse -258 -277 2.55606 0.291
NP_441462.1_5 Forward -117 -98 0.392778 0.296
NP_441621.1_7 Forward -264 -250 1.27789 0.145
NP_441621.1_7 Reverse -245 -259 -6.29359 0.283
NP_443062.1_1 Forward -40 -22 5.32818 0.231
NP_443062.1_1 Reverse -31 -49 4.45062 0.26
NP_441601.1_4 Reverse -378 -397 -3.54046 0.293
NP_440519.1_8 Forward -229 -213 2.71347 0.259
NP_442204.1_1 Forward -44 -33 11.5634 0.0565
NP_440516.1_8 Forward -40 -31 16.9127 0.00442
NP_440516.1_8 Reverse -31 -40 16.9127 0.00442
NP_442428.1_4 Forward -386 -367 4.916 0.222
NP_442428.1_5 Forward -39 -32 15.8704 0.0124
NP_442428.1_5 Reverse -32 -39 15.8704 0.0124
NP_442428.1_5 Forward -255 -248 4.759 0.223
NP_442428.1_5 Forward -384 -377 4.66067 0.244
NP_442859.1_2 Reverse -377 -396 6.88262 0.199
NP_442120.1_10 Reverse -119 -138 -14.0619 0.288
NP_442120.1_10 Forward -229 -210 -14.6519 0.289
NP_442120.1_10 Forward -391 -372 -16.1268 0.296
NP_441867.1_2 Reverse -217 -236 -20.65 0.292
NP_442883.2_1 Forward -61 -42 16.5191 0.242
NP_440673.1_3 Forward -38 -31 12.4288 0.0426
NP_440673.1_3 Reverse -33 -40 12.4288 0.0426
NP_440673.1_3 Reverse -222 -229 6.23397 0.283
NP_440673.1_7 Reverse -33 -52 3.6377 0.198
NP_440865.1_9 Forward -397 -378 -5.99873 0.218
NP_440865.1_9 Reverse -25 -44 -7.4737 0.247
NP_441052.1_2 Reverse -31 -41 19.9412 0.00106
NP_441052.1_2 Forward -40 -30 10.4031 0.0285
NP_441052.1_2 Reverse -376 -386 7.45319 0.0712
NP_441052.1_2 Reverse -79 -89 3.32329 0.181
NP_442219.1_9 Reverse -32 -41 17.7976 0.00718
NP_442219.1_9 Forward -39 -30 8.25953 0.0681
NP_440436.1_4 Reverse -32 -41 17.2072 0.00233
NP_440436.1_4 Forward -39 -30 9.24241 0.0871
NP_440436.1_4 Reverse -377 -386 4.81753 0.239
NP_440436.1_4 Reverse -248 -257 4.42421 0.265
NP_441884.1_9 Reverse -41 -60 -3.44213 0.0594
NP_442086.1_3 Forward -39 -20 17.699 0.0594
NP_440314.1_9 Forward -39 -20 -2.55715 0.161
NP_440314.1_9 Reverse -32 -51 -7.96535 0.243
NP_440648.1_1 Forward -40 -21 4.81767 0.219
NP_442414.1_10 Forward -390 -371 17.0099 0.103
NP_441719.1_4 Forward -39 -32 16.3621 0.0124
NP_441719.1_4 Reverse -32 -39 16.3621 0.0124
NP_441719.1_6 Reverse -111 -130 4.42355 0.297
NP_441004.1_1 Forward -177 -158 -10.3253 0.219
NP_441004.1_1 Forward -139 -120 -10.3253 0.219
NP_441004.1_1 Forward -391 -372 -11.9969 0.243
NP_441004.1_1 Forward -397 -378 -14.2585 0.265
NP_441004.1_1 Forward -235 -216 -17.6018 0.292
NP_441004.1_1 Forward -152 -133 -17.8968 0.295
NP_442813.1_4 Forward -104 -85 -9.047 0.299
NP_442366.1_3 Reverse -30 -48 4.6407 0.094
NP_442366.1_5 Reverse -28 -38 15.4175 0.0374
NP_441729.1_1 Reverse -138 -157 13.6675 0.287
NP_441115.1_4 Reverse -30 -48 13.883 0.067
NP_440328.1_4 Forward -46 -27 16.1257 0.0319
NP_443054.1_2 Reverse -374 -388 4.22782 0.24
NP_443054.1_2 Forward -42 -28 -0.492064 0.295
NP_440864.1_9 Reverse -243 -262 -5.70374 0.234
NP_441851.1_10 Forward -41 -31 15.8113 0.00552
NP_441851.1_10 Reverse -30 -40 8.53483 0.114
NP_441851.1_10 Forward -386 -376 4.79825 0.247
NP_442939.1_4 Reverse -302 -320 17.8162 0.193
NP_441501.1_6 Forward -266 -247 14.0608 0.272
NP_442856.1_7 Forward -49 -30 15.2408 0.0463
NP_441668.1_4 Reverse -366 -385 2.65439 0.194
NP_441668.1_4 Forward -245 -226 0.0977854 0.247
NP_442515.1_1 Forward -41 -27 5.30946 0.107
NP_442515.1_1 Reverse -43 -57 -0.492064 0.224
NP_442515.1_1 Forward -386 -372 -4.52363 0.298
NP_440593.1_3 Forward -390 -371 8.06259 0.109
NP_440593.1_3 Forward -240 -221 -4.22878 0.246
NP_440593.1_3 Reverse -378 -397 -5.50708 0.261
NP_441982.1_6 Forward -117 -108 11.3395 0.288
NP_440463.1_6 Reverse -116 -135 6.39097 0.295
NP_440165.1_5 Reverse -30 -49 3.14605 0.103
NP_441046.1_2 Forward -396 -377 -0.983855 0.287
NP_441349.1_10 Forward -50 -31 7.37428 0.0314
NP_441409.1_6 Reverse -25 -44 -6.29373 0.124
NP_440432.1_9 Forward -39 -24 5.19144 0.0578
NP_439960.1_10 Forward -47 -29 -2.24246 0.252
NP_440474.1_8 Forward -39 -25 3.93223 0.296
NP_440726.1_2 Reverse -139 -158 -0.885524 0.296
NP_441477.1_10 Forward -47 -29 7.09898 0.181
NP_440431.1_5 Reverse -160 -179 6.09597 0.299
NP_442450.1_5 Reverse -374 -384 14.7297 0.095
NP_442450.1_5 Reverse -29 -39 7.64985 0.13
NP_442450.1_5 Reverse -245 -255 5.5849 0.237
NP_440588.1_2 Forward -49 -30 8.45592 0.0455
NP_440588.1_3 Reverse -194 -213 12.2908 0.248
NP_440588.1_10 Forward -61 -42 5.60432 0.239
NP_439950.1_1 Reverse -326 -335 14.7494 0.195
NP_442006.1_2 Forward -62 -45 3.87375 0.0741
NP_440483.1_1 Reverse -249 -268 -8.35868 0.282
NP_442243.1_1 Forward -46 -28 6.99988 0.178
NP_442243.1_1 Forward -236 -218 3.55831 0.203
NP_442243.1_1 Reverse -220 -238 -2.43985 0.292
NP_441570.1_1 Reverse -31 -49 -10.5023 0.171
NP_440078.1_10 Reverse -31 -50 21.6323 0.0558
NP_441078.1_4 Forward -40 -31 19.6659 0.0007
NP_441078.1_4 Reverse -31 -40 19.6659 0.0007
NP_441078.1_4 Forward -385 -376 7.86621 0.0432
NP_441078.1_4 Reverse -376 -385 0.884706 0.154
NP_442729.1_4 Reverse -127 -146 15.7316 0.238
NP_442729.1_5 Forward -123 -113 10.6981 0.235
NP_442729.1_5 Forward -63 -53 7.55152 0.29
NP_442443.1_1 Forward -61 -42 -5.40875 0.282
NP_440526.1_3 Reverse -377 -388 10.5796 0.0646
NP_440526.1_3 Reverse -32 -43 8.02298 0.126
NP_441432.1_8 Reverse -30 -39 16.8143 0.00595
NP_441432.1_8 Forward -41 -32 16.8143 0.00595
NP_441432.1_8 Forward -392 -383 5.80125 0.137
NP_441432.1_8 Forward -230 -221 5.50626 0.151
NP_441432.1_8 Forward -386 -377 4.71961 0.197
NP_442320.1_8 Reverse -25 -39 -1.67204 0.0821
NP_442320.1_8 Forward -391 -377 -3.73699 0.131
NP_442320.1_8 Forward -46 -32 -4.22864 0.151
NP_441732.1_2 Reverse -27 -43 -7.0213 0.0614
NP_441732.1_2 Forward -44 -28 -16.0677 0.164
NP_441732.1_2 Reverse -372 -388 -16.3627 0.165
NP_441732.1_2 Reverse -216 -232 -16.6577 0.186
NP_440685.1_6 Forward -43 -24 16.0265 0.246
NP_440760.1_1 Reverse -376 -395 -5.60541 0.0503
NP_440760.1_1 Reverse -31 -50 -15.8318 0.157
NP_440760.1_1 Forward -385 -366 -20.0601 0.22
NP_442797.1_1 Reverse -114 -133 -6.1954 0.294
NP_440713.1_4 Forward -50 -31 2.65439 0.26
NP_442489.1_7 Forward -40 -31 20.1576 0.000695
NP_442489.1_7 Reverse -31 -40 20.1576 0.000695
NP_442489.1_7 Forward -385 -376 8.35786 0.0225
NP_442489.1_7 Reverse -376 -385 0.884706 0.145
NP_440559.1_1 Reverse -32 -41 17.4043 0.00658
NP_440559.1_1 Forward -39 -30 8.65285 0.0586
NP_441659.2_8 Forward -40 -30 20.9245 0.000805
NP_441659.2_8 Reverse -31 -41 18.1713 0.00133
NP_441659.2_8 Reverse -376 -386 6.76487 0.0678
NP_441659.2_8 Forward -385 -375 0.0783647 0.277
NP_442913.1_10 Forward -49 -30 4.32602 0.0901
NP_442913.1_10 Forward -238 -219 -5.70374 0.276
NP_441040.1_2 Forward -399 -380 -8.26035 0.236
NP_441040.1_2 Forward -170 -151 -13.7669 0.284
NP_442008.1_2 Reverse -28 -47 5.40766 0.226
NP_441800.1_7 Reverse -147 -165 -3.71743 0.279
NP_442776.1_8 Reverse -1 -20 13.7649 0.244
NP_442346.1_5 Forward -41 -31 16.6963 0.00248
NP_442346.1_5 Reverse -30 -40 16.303 0.00248
NP_442346.1_5 Reverse -246 -256 8.63316 0.131
NP_442346.1_5 Forward -230 -220 8.04317 0.149
NP_442346.1_5 Reverse -375 -385 7.45319 0.169
NP_442346.1_5 Forward -386 -376 6.37155 0.205
NP_440545.1_3 Reverse -27 -44 4.26707 0.073
NP_440545.1_3 Forward -233 -216 0.0388413 0.146
NP_440545.1_3 Reverse -243 -260 -2.3211 0.183
NP_440545.1_3 Reverse -148 -165 -3.79607 0.212
NP_440545.1_3 Reverse -149 -166 -4.68105 0.23
NP_440545.1_3 Forward -150 -133 -4.77938 0.232
NP_440545.1_3 Forward -389 -372 -5.1727 0.242
NP_440545.1_3 Forward -395 -378 -5.76269 0.259
NP_441856.1_3 Forward -43 -24 -1.27885 0.236
NP_440025.1_3 Forward -283 -269 9.44903 0.296
NP_440831.1_1 Forward -391 -372 12.7825 0.261
NP_440831.1_3 Forward -49 -30 7.74622 0.245
NP_441923.1_2 Reverse -144 -163 7.7676 0.299
NP_441923.1_6 Forward -258 -244 11.0127 0.25
NP_440459.1_2 Reverse -29 -46 14.9851 0.117
NP_440010.1_4 Forward -395 -376 0.686995 0.244
NP_442603.1_7 Reverse -31 -45 19.7634 0.00895
NP_441585.1_5 Reverse -360 -379 1.6703 0.284
NP_441888.1_7 Forward -45 -31 3.73617 0.225
NP_441833.1_4 Forward -39 -32 15.9687 0.0124
NP_441833.1_4 Reverse -32 -39 15.9687 0.0124
NP_442799.1_2 Forward -237 -218 0.58944 0.276
NP_441112.1_6 Reverse -210 -229 -1.86883 0.296
NP_442162.1_9 Forward -39 -32 16.2637 0.0124
NP_442162.1_9 Reverse -32 -39 16.2637 0.0124
NP_440671.1_4 Forward -46 -32 11.0127 0.142
NP_440671.1_4 Forward -262 -248 7.76774 0.208
NP_440671.1_4 Reverse -376 -390 6.48943 0.245
NP_440671.1_5 Reverse -126 -140 15.8302 0.208
NP_440671.1_5 Reverse -3 -17 13.5686 0.293
NP_440224.1_1 Forward -51 -32 0.392778 0.135
NP_441915.1_4 Reverse -43 -62 9.53674 0.28
NP_442140.1_3 Reverse -32 -42 10.3048 0.0902
NP_442140.1_3 Forward -39 -29 6.66654 0.159
NP_442140.1_3 Forward -255 -245 4.89658 0.238
NP_440875.1_9 Reverse -33 -43 8.37203 0.233
NP_441813.1_3 Forward -127 -108 15.3038 0.238
NP_441813.1_5 Forward -42 -32 18.1713 0.00743
NP_441813.1_5 Reverse -29 -39 8.63316 0.0367
NP_441813.1_7 Reverse -355 -369 20.8451 0.062
NP_440590.1_4 Reverse -32 -45 12.8023 0.013
NP_440590.1_4 Reverse -377 -390 1.78924 0.111
NP_440590.1_4 Forward -39 -26 1.39592 0.125
NP_440567.1_1 Reverse -32 -46 5.80112 0.0959
NP_442497.1_10 Forward -39 -30 17.601 0.00813
NP_442497.1_10 Reverse -32 -41 10.4228 0.0087
NP_442497.1_10 Forward -384 -375 0.589713 0.153
NP_440821.1_4 Forward -42 -32 9.41981 0.0286
NP_440821.1_4 Reverse -29 -39 2.24165 0.131
NP_440821.1_4 Reverse -374 -384 0.57002 0.169
NP_441239.1_9 Reverse -29 -41 11.1504 0.0648
NP_441239.1_9 Forward -387 -375 9.18376 0.113
NP_441239.1_9 Forward -42 -30 5.25052 0.223
NP_441892.1_4 Reverse -375 -394 -1.37718 0.28
NP_440665.1_1 Forward -268 -249 -11.7019 0.244
NP_442105.1_9 Reverse -50 -64 14.1576 0.294
NP_441017.1_6 Reverse -372 -386 13.4703 0.192
NP_440833.1_6 Forward -281 -267 9.93039 0.257
NP_440833.1_6 Reverse -232 -246 7.17714 0.285
NP_442138.1_10 Reverse -31 -50 -4.32711 0.253
NP_440500.1_1 Forward -130 -111 6.78429 0.285
NP_440546.1_4 Forward -40 -30 13.5365 0.0459
NP_440546.1_4 Reverse -31 -41 10.046 0.109
NP_440546.1_4 Forward -385 -375 8.20381 0.199
NP_441230.1_5 Forward -396 -377 7.37428 0.166
NP_441230.1_5 Forward -157 -138 0.786102 0.261
NP_440462.1_6 Reverse -29 -39 10.5014 0.0396
NP_440462.1_6 Forward -42 -32 9.61647 0.0429
NP_442340.1_3 Reverse -222 -241 -5.60541 0.223
NP_442611.1_1 Reverse -31 -50 8.16093 0.139
NP_440868.1_4 Forward -44 -32 8.00379 0.0602
NP_440868.1_4 Reverse -27 -39 5.84051 0.0879
NP_441497.1_3 Reverse -262 -281 -10.817 0.294
NP_442402.1_2 Reverse -123 -137 12.6836 0.269
NP_442402.1_4 Reverse -71 -90 -3.14789 0.212
NP_442402.1_4 Reverse -267 -286 -7.3761 0.274
NP_442402.1_6 Forward -91 -82 14.0611 0.271
NP_442402.1_10 Reverse -107 -117 15.3192 0.18
NP_441848.1_7 Reverse -103 -122 -3.44288 0.284
NP_441084.1_6 Reverse -374 -388 10.4106 0.241
NP_441084.1_6 Reverse -368 -382 10.0228 0.255
NP_440696.1_9 Reverse -217 -236 16.2232 0.296
NP_442039.1_4 Forward -39 -32 15.1821 0.0124
NP_442039.1_4 Reverse -32 -39 15.1821 0.0124
NP_440008.1_9 Forward -46 -27 8.94757 0.283
NP_441926.1_3 Forward -40 -24 5.86006 0.17
NP_442837.1_3 Forward -39 -32 15.7721 0.0124
NP_442837.1_3 Reverse -32 -39 15.7721 0.0124
NP_439994.1_3 Reverse -30 -49 16.1451 0.0785
NP_442053.1_1 Forward -40 -31 18.3876 0.0007
NP_442053.1_1 Reverse -31 -40 18.3876 0.0007
NP_442053.1_1 Reverse -376 -385 7.47288 0.0996
NP_440505.1_3 Forward -42 -32 18.3679 0.00213
NP_440505.1_3 Reverse -29 -39 8.04317 0.147
NP_440505.1_3 Forward -90 -80 4.89658 0.257
NP_441203.1_1 Reverse -32 -51 -2.65548 0.0655
NP_442471.1_10 Forward -265 -246 13.9625 0.115
NP_441408.2_7 Reverse -29 -48 4.03102 0.191
NP_441408.2_7 Reverse -135 -154 2.16274 0.215
NP_440914.1_1 Reverse -31 -41 17.5935 0.000537
NP_440914.1_1 Forward -40 -30 16.3248 0.00196
NP_440914.1_1 Reverse -215 -225 7.24882 0.242
NP_441011.1_8 Forward -39 -30 16.6177 0.00602
NP_441011.1_8 Reverse -32 -41 8.25953 0.144
NP_442101.1_10 Reverse -23 -42 -8.65367 0.242
NP_442533.1_6 Forward -40 -31 17.2076 0.00137
NP_442533.1_6 Reverse -31 -40 17.2076 0.00137
NP_442533.1_6 Reverse -376 -385 14.8477 0.00858
NP_442533.1_6 Forward -385 -376 6.8829 0.101
NP_442541.1_10 Forward -338 -324 4.22722 0.252
NP_442541.1_10 Reverse -131 -145 4.03056 0.252
NP_442541.1_10 Reverse -220 -234 3.8339 0.252
NP_442541.1_10 Reverse -44 -58 1.17898 0.29
NP_443016.1_1 Forward -277 -258 -6.1954 0.257
NP_441482.1_7 Reverse -370 -384 5.99778 0.0364
NP_441482.1_7 Forward -46 -32 -0.590395 0.0612
NP_439944.1_9 Reverse -32 -42 10.5014 0.0887
NP_439944.1_9 Forward -39 -29 9.12481 0.1
NP_439944.1_9 Forward -384 -374 5.5849 0.239
NP_442269.1_10 Forward -390 -371 7.86593 0.194
NP_441028.1_6 Reverse -80 -90 10.6976 0.197
NP_441028.1_6 Reverse -108 -118 9.91099 0.21
NP_441028.1_6 Reverse -128 -138 5.97777 0.234
NP_440116.1_8 Reverse -32 -51 -9.14533 0.268
NP_441527.1_7 Forward -193 -174 6.88182 0.298
NP_440115.1_6 Forward -43 -33 16.008 0.0325
NP_440007.1_9 Forward -44 -30 8.84938 0.171
NP_440007.1_9 Reverse -217 -231 8.75105 0.171
NP_441602.1_3 Reverse -120 -139 -3.04881 0.241
NP_441106.1_1 Reverse -30 -39 18.486 0.0028
NP_441106.1_1 Forward -41 -32 9.63616 0.0311
NP_441106.1_1 Forward -257 -248 4.71961 0.21
NP_440429.1_2 Reverse -348 -367 7.17762 0.29
NP_440429.1_9 Reverse -44 -63 2.45773 0.278
NP_441286.1_1 Forward -41 -29 5.93884 0.0258
NP_441286.1_1 Forward -386 -374 4.66053 0.031
NP_441286.1_1 Reverse -30 -42 3.48056 0.0467
NP_441286.1_1 Reverse -375 -387 -7.04085 0.3
NP_440670.1_8 Forward -40 -31 18.3876 0.000699
NP_440670.1_8 Reverse -31 -40 18.3876 0.000699
NP_440886.1_7 Reverse -30 -40 8.04271 0.0805
NP_440886.1_7 Forward -41 -31 7.94438 0.0805
NP_440828.1_4 Reverse -375 -394 -7.27777 0.285
NP_442614.1_2 Reverse -31 -45 9.04604 0.242
NP_442072.1_9 Reverse -375 -393 -12.4689 0.0852
NP_442072.1_9 Forward -41 -23 -21.122 0.206
NP_442072.1_9 Reverse -30 -48 -21.712 0.212
NP_440513.1_4 Reverse -253 -272 10.9142 0.254
NP_441808.1_8 Forward -262 -243 8.55425 0.26
NP_442022.1_4 Forward -391 -372 5.11266 0.293
NP_440907.2_8 Forward -39 -29 15.9091 0.0161
NP_442264.1_2 Forward -395 -378 4.95539 0.288
NP_441021.1_1 Reverse -32 -51 -6.09707 0.177
NP_441021.1_1 Reverse -377 -396 -8.85033 0.201
NP_441463.1_3 Reverse -21 -40 -9.14533 0.277
NP_440501.1_2 Forward -136 -117 10.6192 0.215
NP_441626.1_2 Forward -39 -32 15.7721 0.0124
NP_441626.1_2 Reverse -32 -39 15.7721 0.0124
NP_442794.1_1 Forward -44 -32 20.0002 0.00523
NP_442615.1_1 Reverse -22 -40 12.8022 0.0126
NP_442615.1_1 Forward -49 -31 6.214 0.0362
NP_441962.1_4 Forward -390 -371 -0.0988766 0.117
NP_441742.1_7 Forward -56 -37 18.3873 0.244
NP_440387.1_1 Reverse -31 -47 6.64671 0.0282
NP_440387.1_1 Forward -40 -24 -0.334789 0.137
NP_440387.1_1 Forward -385 -369 -3.38305 0.158
NP_440387.1_1 Reverse -376 -392 -3.8747 0.169
NP_441431.1_2 Forward -43 -29 10.8154 0.153
NP_441431.1_2 Reverse -259 -273 9.73373 0.18
NP_441431.1_2 Reverse -153 -167 6.48882 0.269
NP_441488.1_8 Forward -45 -31 10.717 0.146
NP_441836.1_2 Reverse -25 -44 5.01433 0.13
NP_441993.1_1 Forward -391 -372 12.667 0.0957
NP_441993.1_1 Forward -53 -34 9.84073 0.135
NP_441993.1_1 Reverse -25 -44 4.18821 0.223
NP_441993.1_1 Reverse -376 -395 3.506 0.233
NP_441993.1_1 Forward -46 -27 1.26449 0.282
NP_440467.1_3 Reverse -371 -390 11.6469 0.268
NP_440114.1_10 Forward -40 -26 13.1759 0.0632
NP_441853.1_5 Forward -134 -115 4.12936 0.279
NP_442323.1_7 Forward -45 -26 6.39016 0.194
NP_440725.1_4 Reverse -216 -235 1.17943 0.229
NP_440293.1_3 Forward -154 -135 0.58944 0.216
NP_440293.1_9 Forward -390 -376 17.1423 0.135
NP_440293.1_10 Reverse -245 -264 3.24438 0.219
NP_439988.1_3 Reverse -33 -47 5.1128 0.289
NP_442743.1_1 Reverse -103 -122 10.4217 0.241
NP_439910.1_2 Reverse -23 -40 -3.20608 0.0362
NP_440457.1_1 Forward -44 -32 7.61046 0.101
NP_440457.1_1 Forward -165 -153 3.38223 0.196
NP_440798.1_6 Forward -39 -26 2.77255 0.16
NP_442297.1_4 Forward -44 -25 11.6543 0.294
NP_441984.1_1 Forward -391 -373 5.72234 0.288
NP_441984.1_3 Forward -57 -39 8.96727 0.217
NP_441984.1_3 Forward -267 -249 5.91901 0.276
NP_441984.1_3 Reverse -27 -45 5.32902 0.287
NP_441332.1_6 Reverse -3 -13 10.9691 0.278
NP_440473.1_1 Reverse -378 -397 12.2215 0.247
NP_442509.1_9 Reverse -31 -41 8.14104 0.192
NP_442509.1_9 Forward -40 -30 8.04271 0.192
NP_442509.1_9 Forward -172 -162 7.55106 0.214
NP_442514.1_5 Reverse -219 -238 -8.6544 0.288
NP_440554.1_4 Reverse -32 -42 8.92815 0.0646
NP_440554.1_4 Forward -39 -29 8.82982 0.0646
NP_440554.1_4 Reverse -248 -258 4.20827 0.198
NP_441885.1_5 Reverse -31 -41 20.9245 0.000538
NP_441885.1_5 Forward -40 -30 11.3864 0.00668
NP_441885.1_5 Reverse -376 -386 2.24165 0.0822
NP_440478.1_4 Reverse -27 -46 16.3224 0.133
NP_440478.1_9 Forward -268 -249 8.06259 0.275
NP_440478.1_10 Reverse -29 -43 8.06273 0.257
NP_440649.2_8 Forward -139 -125 16.5192 0.232
NP_442341.1_5 Forward -267 -248 10.6192 0.297
NP_442341.1_7 Reverse -375 -389 8.35772 0.0881
NP_442341.1_9 Reverse -29 -43 11.5037 0.125
NP_441173.1_9 Reverse -109 -117 11.3271 0.226
NP_442395.2_4 Reverse -30 -49 2.85027 0.214
NP_443000.1_7 Forward -42 -32 19.9412 0.00223
NP_443000.1_7 Reverse -29 -39 10.6981 0.0345
NP_442513.1_5 Forward -61 -42 7.27514 0.282
NP_441842.1_10 Forward -236 -222 6.58777 0.283
NP_440275.1_3 Forward -42 -32 15.123 0.0182
NP_440275.1_3 Reverse -29 -39 9.02648 0.0563
NP_440275.1_3 Reverse -224 -234 4.40493 0.196
NP_443060.1_5 Forward -48 -29 4.42355 0.298
NP_441359.1_5 Reverse -379 -398 6.09597 0.188
NP_439962.1_4 Forward -264 -245 -3.83545 0.259
NP_439962.1_4 Reverse -42 -61 -6.1954 0.281
NP_439962.1_4 Reverse -245 -264 -6.58872 0.283
NP_439962.1_4 Reverse -243 -262 -6.58872 0.283
NP_440175.1_7 Forward -156 -138 9.75348 0.276
NP_441105.1_3 Forward -396 -377 5.89931 0.0643
NP_441105.1_3 Forward -51 -32 5.30933 0.069
NP_441105.1_3 Reverse -215 -234 -8.45701 0.272
NP_441105.1_3 Reverse -236 -255 -8.85033 0.279
NP_442373.1_2 Forward -400 -381 -6.49039 0.227
NP_440216.1_1 Reverse -31 -45 9.2427 0.00589
NP_440216.1_1 Forward -40 -26 5.21113 0.0217
NP_440172.1_1 Forward -40 -30 17.5813 0.00421
NP_440172.1_1 Reverse -31 -41 15.0247 0.00945
NP_440172.1_1 Forward -385 -375 4.0116 0.208
NP_440172.1_1 Forward -391 -381 1.84832 0.294
NP_442015.1_10 Forward -44 -31 21.1604 0.00329
NP_442015.1_10 Forward -150 -137 7.78743 0.0782
NP_441226.1_7 Forward -39 -32 14.4934 0.0123
NP_441226.1_7 Reverse -32 -39 14.4934 0.0123
NP_441226.1_7 Reverse -138 -145 8.29857 0.205
NP_441757.1_3 Forward -41 -22 -1.67217 0.25
NP_441111.1_7 Forward -39 -31 18.7023 0.00294
NP_441111.1_7 Reverse -32 -40 18.7023 0.00294
NP_441111.1_7 Forward -384 -376 -0.570565 0.233
NP_441111.1_7 Reverse -377 -385 -0.570565 0.233
NP_442379.1_10 Forward -392 -375 6.43035 0.115
NP_442379.1_10 Forward -47 -30 0.235503 0.223
NP_440244.1_9 Forward -106 -93 16.6372 0.15
NP_441766.1_2 Forward -40 -31 17.5026 0.00297
NP_441766.1_2 Reverse -31 -40 17.5026 0.00297
NP_442417.1_5 Reverse -247 -261 16.4209 0.0412
NP_442417.1_5 Reverse -31 -45 7.37441 0.19
NP_442417.1_8 Forward -63 -44 17.5024 0.237
NP_440416.1_9 Forward -47 -28 -16.6185 0.218
NP_440416.1_9 Forward -153 -134 -19.3717 0.274
NP_443052.1_9 Reverse -378 -397 5.89931 0.138
NP_443052.1_9 Reverse -120 -139 -4.13045 0.254
NP_443052.1_9 Reverse -381 -400 -4.81876 0.261
NP_443052.1_9 Forward -199 -180 -6.78538 0.289
NP_440591.1_9 Forward -47 -29 5.72234 0.237
NP_442154.1_1 Forward -393 -375 -12.5672 0.217
NP_442154.1_1 Forward -61 -43 -15.6155 0.222
NP_442154.1_1 Forward -378 -360 -17.8771 0.272
NP_442154.1_1 Forward -54 -36 -17.8771 0.272
NP_442154.1_6 Forward -392 -373 3.53937 0.234
NP_442564.1_10 Reverse -153 -167 12.6843 0.244
NP_442564.1_10 Reverse -51 -65 10.6193 0.285
NP_440261.1_5 Reverse -32 -45 6.80412 0.0316
NP_440261.1_5 Forward -39 -26 -12.3704 0.284
NP_440988.1_10 Forward -237 -223 8.67452 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTGCAGGAGGCAGTGGCGCTGGCCCTAGTTTTGCTGGTTGTGACGCAGTGCAAACCCACATGACTAATTCCCGCCTGACAGATCCAGAAATCTTAGAAAGTCGTTTCCCGGTGTTGTTGGAACAATTCGCCATTCGGCCCCACAGCGGTGGCGCAGGTAAATTTCCCGGTGGCAACGGCATTGTGCGCCAGTTTAAGTTCCTTCAACCTCTATCAGTAGCTATTTTGGCTAATCGGCGGCGGGTGGCACCCTTTGGGTTGGCCGGGGGAGAAGCAGGAGCCGTGGGGGAAAATTGGTTACTGCGTCGTTCTGGGGATAAGGTACGGTTAGATAGTTGCGCCCAGGTGGATGTGGCCCCTGGCGATCGCCTAATAATTAAAACACCGGGGGGCGGAGGTT

CDS

ATGGCCATCGAGATTGAACGTAAATTCCTGGTTAAAGATGACCGCTGGCGGGATTTAGCCCAGGGTTATTTGTACCGTCAAGGTTACATTGCGACCAAGGATTTAACCACGGTTCGAGTCCGTACCATTGGCAATCGGGCCTATCTCACTATTAAGGGTAAAAATACCGGCATGGCCCGTTTGGAATTTGAGTATGAAATTCCCGCAGTGGATGCTAATCAAATTTTGACTGAACTTTGTTCACCGCCCCTGATTGAAAAATATCGTTATTGCCTCGATTACCAAGGAAAAACCTGGGAAGTGGACGAATTTTTGGGGGATAACCAGGGTCTAATTTTGGCGGAAGTAGAATTATCCCAAGCTGACGAAAAAATAAGTTTACCCCCCTGGATTGGGAAAGAAGTCACGGATGATGCTCGCTATTACAACGTCAATTTGACTCAACATCCCTACAAAAATTGGTGA

Protein

MAIEIERKFLVKDDRWRDLAQGYLYRQGYIATKDLTTVRVRTIGNRAYLTIKGKNTGMARLEFEYEIPAVDANQILTELCSPPLIEKYRYCLDYQGKTWEVDEFLGDNQGLILAEVELSQADEKISLPPWIGKEVTDDARYYNVNLTQHPYKNW