Your browser is old and dusty. Try Google Chrome!

Details for slr0692

ORF slr0692
Accession NP_440302.1
Symbol ycf45
Category hypothetical protein YCF45
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -223 -237 16.9125 0.0972
NP_441061.1_2 Reverse -307 -321 3.04785 0.168
NP_441061.1_2 Forward -231 -217 1.67122 0.183
NP_441061.1_2 Reverse -224 -238 1.17956 0.193
NP_441061.1_2 Forward -281 -267 0.88457 0.197
NP_440795.1_7 Forward -231 -224 14.6904 0.0123
NP_440795.1_7 Reverse -224 -231 14.6904 0.0123
NP_442100.1_4 Reverse -310 -329 17.2065 0.123
NP_441418.1_6 Reverse -223 -242 -11.6036 0.0538
NP_441418.1_6 Forward -210 -191 -23.305 0.194
NP_442291.1_5 Forward -233 -217 9.00665 0.0541
NP_442291.1_5 Reverse -222 -238 -1.71142 0.202
NP_440897.1_6 Reverse -267 -286 -3.14789 0.233
NP_440897.1_6 Forward -315 -296 -4.22953 0.27
NP_440897.1_9 Reverse -319 -337 11.6214 0.257
NP_441453.1_4 Reverse -223 -231 16.539 0.00633
NP_441453.1_4 Forward -232 -224 16.539 0.00633
NP_441453.1_4 Forward -210 -202 9.75419 0.0493
NP_442151.1_6 Reverse -267 -281 11.2093 0.106
NP_442151.1_6 Forward -232 -218 10.1277 0.13
NP_440561.1_4 Reverse -304 -323 13.4051 0.229
NP_441818.1_1 Forward -231 -220 15.4961 0.0264
NP_440226.1_1 Reverse -223 -242 1.67108 0.295
NP_442169.1_1 Reverse -266 -285 -1.67217 0.266
NP_441630.1_3 Reverse -215 -234 16.1257 0.0354
NP_440348.1_6 Reverse -67 -86 6.88262 0.203
NP_441519.1_4 Reverse -114 -131 24.7199 0.00662
NP_442287.1_1 Forward -244 -234 14.4342 0.266
NP_442287.1_1 Reverse -318 -328 14.0409 0.266
NP_442173.1_1 Forward -231 -223 15.4574 0.00633
NP_442173.1_1 Reverse -224 -232 15.4574 0.00633
NP_442173.1_1 Forward -156 -148 4.93597 0.241
NP_442752.1_4 Forward -232 -225 13.8055 0.0199
NP_442752.1_4 Reverse -223 -230 13.8055 0.0199
NP_443027.1_4 Forward -234 -224 11.8781 0.0872
NP_443027.1_4 Reverse -221 -231 11.0914 0.107
NP_443027.1_4 Reverse -54 -64 6.17489 0.289
NP_439997.1_4 Reverse -68 -87 22.4189 0.0241
NP_441812.1_3 Forward -271 -257 14.5526 0.124
NP_442975.1_10 Reverse -335 -349 12.782 0.0459
NP_442975.1_10 Forward -236 -222 5.21053 0.228
NP_441470.1_5 Reverse -169 -188 10.8449 0.262
NP_441225.1_4 Forward -20 -1 -11.9969 0.284
NP_440784.1_7 Forward -231 -224 15.9687 0.0123
NP_440784.1_7 Reverse -224 -231 15.9687 0.0123
NP_440061.1_9 Forward -234 -220 18.3868 0.00917
NP_440061.1_9 Reverse -221 -235 12.487 0.0964
NP_440061.1_9 Reverse -146 -160 9.34041 0.148
NP_440061.1_9 Forward -284 -270 8.16044 0.18
NP_440061.1_9 Forward -278 -264 5.01387 0.298
NP_442062.1_8 Reverse -223 -233 19.4496 0.000558
NP_442062.1_8 Forward -232 -222 17.3846 0.00193
NP_442062.1_8 Forward -157 -147 7.64985 0.0911
NP_442062.1_8 Reverse -369 -379 4.79825 0.198
NP_440839.1_4 Forward -377 -358 10.9134 0.277
NP_440304.1_4 Forward -159 -149 6.56821 0.15
NP_440304.1_4 Forward -234 -224 1.84832 0.299
NP_440304.1_4 Reverse -221 -231 1.84832 0.299
NP_442242.1_4 Forward -231 -224 14.3954 0.0124
NP_442242.1_4 Reverse -224 -231 14.3954 0.0124
NP_442602.1_3 Reverse -380 -399 -2.65548 0.261
NP_439918.1_2 Forward -327 -308 -0.787193 0.236
NP_442110.1_7 Reverse -306 -320 10.9143 0.0644
NP_442110.1_7 Forward -360 -346 2.65453 0.222
NP_442110.1_7 Reverse -267 -281 -0.492064 0.291
NP_441082.1_10 Forward -170 -157 9.65572 0.242
NP_441083.1_5 Forward -232 -222 20.3345 0.00053
NP_441083.1_5 Reverse -223 -233 11.3864 0.0159
NP_441083.1_5 Forward -276 -266 -0.314959 0.265
NP_441149.1_7 Forward -355 -336 3.44104 0.267
NP_442841.1_10 Forward -316 -297 16.6174 0.0831
NP_441738.1_2 Forward -230 -223 15.28 0.0102
NP_441738.1_2 Reverse -225 -232 15.28 0.0102
NP_441738.1_2 Forward -285 -278 6.52862 0.261
NP_440209.1_1 Reverse -223 -231 18.1123 0.00295
NP_440209.1_1 Forward -232 -224 18.1123 0.00295
NP_442889.1_1 Forward -367 -348 -15.6352 0.297
NP_442889.1_8 Forward -235 -221 5.80051 0.213
NP_440447.1_6 Reverse -201 -219 1.39578 0.266
NP_440178.1_7 Forward -233 -214 -23.2067 0.298
NP_442570.1_3 Forward -330 -311 -2.95047 0.215
NP_442570.1_3 Reverse -271 -290 -5.70374 0.248
NP_442570.1_3 Reverse -276 -295 -8.06369 0.279
NP_442570.1_3 Forward -331 -312 -9.047 0.296
NP_442570.1_3 Forward -234 -215 -9.047 0.296
NP_439953.1_2 Forward -128 -110 8.67227 0.266
NP_441716.1_1 Reverse -223 -237 7.9644 0.153
NP_441716.1_1 Reverse -113 -127 3.53951 0.261
NP_441716.1_1 Forward -210 -196 2.75286 0.294
NP_442111.1_4 Reverse -222 -236 21.9274 0.0011
NP_442111.1_4 Forward -211 -197 3.14618 0.253
NP_441163.1_1 Reverse -344 -361 9.96952 0.217
NP_440906.1_5 Forward -231 -224 15.8704 0.0124
NP_440906.1_5 Reverse -224 -231 15.8704 0.0124
NP_440747.1_10 Forward -235 -223 17.0502 0.000794
NP_440747.1_10 Reverse -220 -232 16.7552 0.0019
NP_440747.1_10 Forward -279 -267 -11.9574 0.178
NP_441130.1_10 Forward -234 -220 9.43936 0.125
NP_441130.1_10 Reverse -221 -235 7.27608 0.164
NP_442973.1_5 Forward -241 -222 10.6192 0.276
NP_441486.1_1 Forward -235 -221 -3.83532 0.183
NP_441486.1_1 Reverse -220 -234 -4.13031 0.189
NP_442634.1_4 Reverse -221 -235 -1.27871 0.149
NP_441265.1_6 Forward -264 -245 20.2548 0.0786
NP_440403.1_4 Forward -241 -222 -4.72043 0.213
NP_441695.1_8 Reverse -319 -333 10.0294 0.295
NP_441014.1_10 Reverse -222 -241 -3.14789 0.294
NP_442848.1_1 Forward -238 -224 -0.983719 0.263
NP_441012.1_4 Reverse -225 -238 8.18076 0.272
NP_441012.1_4 Forward -274 -261 6.4108 0.279
NP_441012.1_4 Forward -280 -267 6.21414 0.284
NP_443018.1_3 Forward -231 -224 14.8871 0.0123
NP_443018.1_3 Reverse -224 -231 14.8871 0.0123
NP_443018.1_3 Reverse -346 -353 10.2655 0.107
NP_441634.1_8 Reverse -221 -235 6.58777 0.114
NP_440376.1_1 Forward -232 -223 19.4693 0.000692
NP_440376.1_1 Reverse -223 -232 19.4693 0.000692
NP_440376.1_1 Reverse -369 -378 4.62128 0.154
NP_440376.1_1 Reverse -267 -276 3.34298 0.206
NP_440376.1_1 Reverse -201 -210 2.65466 0.216
NP_440376.1_1 Reverse -233 -242 1.86802 0.238
NP_441857.1_6 Forward -329 -319 17.188 0.16
NP_441588.1_4 Forward -230 -220 6.46988 0.193
NP_442730.1_8 Reverse -310 -329 2.9486 0.276
NP_442687.1_7 Forward -233 -223 15.8113 0.0125
NP_442687.1_7 Reverse -222 -232 8.92815 0.0994
NP_442687.1_7 Forward -211 -201 4.10993 0.266
NP_442191.1_4 Forward -241 -227 10.6053 0.294
NP_442485.1_3 Reverse -268 -287 -5.99873 0.297
NP_441846.1_10 Forward -328 -309 -23.2067 0.279
NP_442958.1_3 Reverse -212 -231 9.0459 0.142
NP_441013.1_2 Forward -237 -219 -4.20908 0.298
NP_441422.1_7 Reverse -221 -238 -2.3211 0.21
NP_441422.1_7 Forward -234 -217 -3.50107 0.235
NP_441763.1_10 Forward -389 -370 6.29183 0.269
NP_442658.1_1 Forward -234 -224 17.0891 0.00615
NP_442658.1_1 Forward -323 -313 9.22267 0.165
NP_442658.1_1 Reverse -221 -231 7.94438 0.199
NP_442198.1_3 Forward -63 -44 2.94938 0.297
NP_442198.1_3 Reverse -26 -45 2.3594 0.299
NP_442782.1_2 Forward -321 -307 15.5359 0.173
NP_442782.1_2 Reverse -223 -237 0.786239 0.284
NP_442782.1_2 Reverse -7 -21 0.491246 0.289
NP_440656.1_2 Forward -100 -81 1.27776 0.258
NP_441414.1_9 Forward -232 -213 13.6675 0.0137
NP_441414.1_9 Reverse -223 -242 -5.01543 0.166
NP_441487.1_6 Reverse -193 -212 6.58763 0.216
NP_439959.1_5 Forward -212 -193 15.6341 0.189
NP_442321.1_4 Forward -369 -350 -8.26035 0.289
NP_441958.1_5 Forward -233 -223 12.2714 0.00183
NP_441958.1_5 Reverse -222 -232 12.2714 0.00183
NP_441958.1_5 Forward -158 -148 -0.41329 0.205
NP_441958.1_5 Reverse -200 -210 -1.29827 0.236
NP_442836.1_5 Forward -163 -144 2.94938 0.248
NP_442836.1_10 Forward -329 -319 17.0896 0.185
NP_440203.1_5 Forward -285 -275 8.63269 0.29
NP_440203.1_5 Reverse -116 -126 8.53436 0.294
NP_439905.1_1 Forward -231 -218 18.4072 0.0274
NP_439905.1_2 Reverse -307 -321 9.43936 0.233
NP_440984.1_7 Reverse -218 -232 21.0424 0.00311
NP_439990.1_5 Reverse -218 -231 10.1474 0.128
NP_442911.1_2 Forward -242 -223 7.66927 0.024
NP_442911.1_2 Reverse -213 -232 -6.1954 0.178
NP_442911.1_2 Reverse -257 -276 -10.6203 0.284
NP_440153.1_5 Reverse -224 -238 9.43936 0.125
NP_440153.1_5 Forward -231 -217 3.14618 0.219
NP_442064.1_4 Reverse -302 -321 6.39016 0.251
NP_443055.1_3 Forward -241 -222 17.616 0.051
NP_443055.1_6 Forward -378 -360 6.21323 0.172
NP_443055.1_6 Forward -218 -200 4.63995 0.181
NP_443055.1_6 Forward -232 -214 -0.571569 0.263
NP_440993.1_4 Forward -288 -271 18.7217 0.137
NP_441099.1_5 Reverse -213 -232 -3.54046 0.136
NP_441099.1_5 Forward -242 -223 -9.24366 0.216
NP_442002.1_9 Forward -158 -151 13.0188 0.185
NP_442002.1_9 Forward -233 -226 10.7572 0.185
NP_441294.1_7 Forward -236 -222 9.4426 0.244
NP_441646.1_1 Forward -239 -220 5.99764 0.175
NP_442438.1_10 Forward -237 -223 2.94952 0.168
NP_442431.1_10 Reverse -267 -285 0.412472 0.275
NP_441000.1_6 Reverse -222 -236 -2.45868 0.216
NP_441000.1_6 Forward -233 -219 -3.93365 0.225
NP_441000.1_6 Forward -158 -144 -5.31028 0.273
NP_440147.1_4 Forward -234 -221 17.6205 0.00602
NP_440147.1_4 Reverse -221 -234 15.0639 0.0197
NP_440147.1_4 Reverse -146 -159 7.98409 0.0579
NP_441125.1_6 Reverse -132 -145 13.0973 0.244
NP_441175.1_7 Forward -232 -213 11.2092 0.15
NP_441295.1_4 Reverse -218 -237 -2.36049 0.29
NP_441550.1_8 Reverse -221 -231 15.1225 0.0132
NP_441550.1_8 Forward -234 -224 8.82935 0.112
NP_441916.1_7 Reverse -223 -233 18.4663 0.00144
NP_441916.1_7 Forward -232 -222 10.3048 0.0261
NP_440206.1_4 Forward -292 -273 0.293673 0.289
NP_441041.1_4 Reverse -267 -286 8.55425 0.0331
NP_441041.1_4 Reverse -223 -242 -8.85033 0.208
NP_441041.1_4 Reverse -273 -292 -12.4886 0.266
NP_441041.1_7 Forward -235 -223 14.6087 0.0342
NP_441041.1_7 Forward -160 -148 6.05711 0.226
NP_442396.1_5 Reverse -219 -232 11.819 0.0913
NP_440569.1_7 Reverse -183 -202 12.9791 0.236
NP_441547.1_2 Forward -359 -341 14.1788 0.0948
NP_441725.1_4 Forward -237 -223 13.372 0.0693
NP_441725.1_5 Forward -231 -221 2.04498 0.115
NP_441725.1_5 Reverse -224 -234 2.04498 0.115
NP_441725.1_5 Reverse -279 -289 -0.0199663 0.223
NP_441725.1_5 Reverse -149 -159 -0.511621 0.26
NP_441725.1_5 Forward -209 -199 -0.609952 0.265
NP_439966.1_7 Forward -234 -224 17.9741 0.00631
NP_439966.1_7 Reverse -221 -231 15.3192 0.0152
NP_439966.1_9 Forward -234 -225 0.884706 0.253
NP_440202.1_8 Reverse -193 -212 10.0008 0.297
NP_442941.1_3 Forward -231 -221 19.2529 0.00262
NP_442941.1_3 Reverse -224 -234 10.7964 0.0116
NP_440289.1_2 Forward -235 -222 11.1307 0.0212
NP_440289.1_2 Reverse -220 -233 -3.61896 0.267
NP_440983.1_9 Forward -241 -222 7.17762 0.255
NP_440983.1_9 Reverse -360 -379 1.0811 0.292
NP_440260.1_8 Forward -364 -346 -4.60241 0.273
NP_441678.1_9 Reverse -351 -370 -1.86883 0.257
NP_442281.1_1 Forward -237 -223 20.0584 0.00217
NP_442281.1_1 Reverse -218 -232 7.17714 0.106
NP_442281.1_1 Reverse -51 -65 4.42388 0.195
NP_442281.1_1 Forward -281 -267 3.04726 0.246
NP_442281.1_1 Forward -292 -278 2.5556 0.263
NP_442256.1_2 Forward -234 -216 -8.24065 0.218
NP_442256.1_2 Reverse -221 -239 -9.12563 0.249
NP_440437.1_1 Forward -238 -219 -2.95047 0.23
NP_440647.1_9 Forward -234 -216 7.29564 0.219
NP_442500.1_9 Forward -392 -373 17.6007 0.202
NP_441644.1_6 Forward -232 -222 17.3841 0.00127
NP_441644.1_6 Reverse -223 -233 10.1076 0.0628
NP_441644.1_6 Forward -276 -266 5.78111 0.176
NP_441644.1_6 Forward -210 -200 4.40448 0.239
NP_441644.1_6 Forward -315 -305 3.61784 0.272
NP_441644.1_6 Reverse -267 -277 3.42118 0.282
NP_442215.1_2 Reverse -316 -332 1.92682 0.125
NP_442215.1_2 Reverse -153 -169 -1.3181 0.183
NP_442215.1_2 Forward -234 -218 -3.97304 0.225
NP_442215.1_2 Reverse -304 -320 -7.41462 0.294
NP_442177.1_5 Reverse -264 -278 8.75105 0.276
NP_442029.1_6 Forward -327 -308 7.07928 0.23
NP_442029.1_6 Reverse -218 -237 6.78429 0.233
NP_440253.1_2 Reverse -223 -241 3.46073 0.116
NP_440929.1_8 Forward -232 -223 19.2726 0.000701
NP_440929.1_8 Reverse -223 -232 19.2726 0.000701
NP_442933.1_10 Forward -232 -223 17.601 0.00325
NP_442933.1_10 Reverse -223 -232 17.601 0.00325
NP_441751.2_8 Forward -231 -217 5.30946 0.0448
NP_441751.2_8 Reverse -224 -238 -1.67204 0.13
NP_442554.1_8 Forward -231 -221 16.2046 0.0065
NP_442554.1_8 Reverse -224 -234 14.1397 0.0144
NP_442554.1_8 Reverse -268 -278 3.02829 0.245
NP_442075.1_10 Reverse -273 -292 11.3075 0.282
NP_441762.1_7 Reverse -222 -234 2.98891 0.0676
NP_441762.1_7 Forward -233 -221 2.39892 0.0676
NP_441762.1_7 Reverse -147 -159 -5.95921 0.258
NP_442142.1_4 Forward -235 -222 15.1616 0.0289
NP_442142.1_4 Forward -273 -260 10.5401 0.0712
NP_442142.1_4 Reverse -220 -233 6.80355 0.154
NP_442142.1_8 Forward -281 -262 22.0247 0.0763
NP_442292.1_1 Forward -231 -222 18.486 0.00229
NP_442292.1_1 Reverse -224 -233 9.63616 0.0183
NP_442476.1_6 Forward -231 -217 11.8976 0.0525
NP_442476.1_6 Reverse -224 -238 7.57108 0.112
NP_443009.1_5 Reverse -222 -233 18.3477 0.00265
NP_443009.1_5 Forward -158 -147 14.1195 0.024
NP_443009.1_5 Forward -288 -277 3.69644 0.282
NP_441715.1_4 Reverse -224 -234 18.8596 0.00741
NP_441715.1_4 Forward -231 -221 17.3846 0.0106
NP_440183.1_9 Forward -280 -261 -15.8318 0.273
NP_441198.1_8 Forward -159 -149 11.9041 0.174
NP_441468.1_1 Forward -231 -224 15.8704 0.0124
NP_441468.1_1 Reverse -224 -231 15.8704 0.0124
NP_441020.2_6 Reverse -221 -238 7.70866 0.222
NP_441015.1_10 Reverse -262 -281 4.22769 0.127
NP_441015.1_10 Forward -320 -301 -7.96535 0.272
NP_441673.1_1 Forward -232 -223 20.8459 0.000698
NP_441673.1_1 Reverse -223 -232 20.8459 0.000698
NP_441673.1_1 Forward -315 -306 -7.76842 0.168
NP_441673.1_1 Reverse -306 -315 -8.06341 0.254
NP_441673.1_1 Reverse -267 -276 -8.06341 0.254
NP_441731.1_5 Reverse -271 -288 15.0835 0.181
NP_441826.1_2 Forward -238 -224 9.5377 0.0587
NP_441826.1_2 Forward -276 -262 1.96621 0.137
NP_441826.1_2 Reverse -217 -231 -1.47537 0.248
NP_441826.1_2 Forward -282 -268 -3.83532 0.288
NP_441826.1_2 Forward -293 -279 -4.32697 0.295
NP_441330.1_1 Reverse -218 -237 -3.3438 0.0791
NP_441764.1_4 Forward -37 -20 9.50423 0.284
NP_441764.1_8 Reverse -132 -142 11.3107 0.284
NP_442868.1_6 Reverse -221 -231 19.2529 0.00563
NP_442868.1_6 Forward -234 -224 10.3048 0.038
NP_442868.1_6 Forward -159 -149 4.0116 0.188
NP_441612.1_2 Forward -232 -222 8.54929 0.21
NP_442808.1_1 Forward -233 -223 18.4657 0.00201
NP_442808.1_1 Reverse -222 -232 8.63269 0.0481
NP_442808.1_1 Forward -211 -201 5.19112 0.168
NP_442808.1_1 Forward -243 -233 3.8145 0.222
NP_442808.1_1 Reverse -318 -328 1.25791 0.289
NP_440145.1_3 Forward -242 -223 1.27776 0.129
NP_442542.1_2 Forward -234 -221 15.6539 0.0793
NP_442050.1_1 Forward -322 -303 11.3075 0.233
NP_442050.1_5 Reverse -221 -231 14.3359 0.0206
NP_442050.1_5 Forward -234 -224 6.96107 0.27
NP_442747.1_1 Reverse -262 -281 -16.5201 0.236
NP_441114.1_3 Reverse -314 -323 7.86621 0.231
NP_441114.1_3 Forward -281 -272 7.86621 0.231
NP_440558.1_2 Forward -285 -266 -2.95047 0.232
NP_440558.1_2 Forward -297 -278 -5.80207 0.264
NP_442789.1_4 Reverse -250 -269 -5.01543 0.265
NP_441878.1_6 Forward -233 -223 10.4031 0.0176
NP_441878.1_6 Reverse -222 -232 10.4031 0.0176
NP_441878.1_6 Reverse -200 -210 2.24165 0.0462
NP_441878.1_6 Forward -211 -201 1.25834 0.108
NP_441878.1_6 Reverse -305 -315 -0.806614 0.18
NP_441878.1_6 Forward -316 -306 -6.8048 0.196
NP_441878.1_6 Forward -322 -312 -7.0998 0.204
NP_441878.1_6 Reverse -266 -276 -7.19813 0.21
NP_441878.1_6 Forward -158 -148 -7.68978 0.255
NP_441036.1_8 Forward -233 -223 17.7779 0.000554
NP_441036.1_8 Reverse -222 -232 8.33817 0.174
NP_441036.1_8 Reverse -147 -157 6.96153 0.213
NP_441557.1_4 Reverse -80 -94 11.3077 0.291
NP_441557.1_5 Forward -232 -223 19.9609 0.000699
NP_441557.1_5 Reverse -223 -232 19.9609 0.000699
NP_441557.1_5 Forward -157 -148 -0.983583 0.272
NP_441445.1_1 Reverse -258 -277 2.26107 0.238
NP_441445.1_1 Reverse -192 -211 1.47442 0.255
NP_441445.1_8 Forward -169 -150 -11.8986 0.277
NP_441590.1_4 Reverse -320 -339 17.5998 0.131
NP_441590.1_4 Reverse -308 -327 2.06362 0.297
NP_442066.2_9 Reverse -219 -232 20.0788 0.00699
NP_442066.2_9 Forward -69 -56 13.294 0.154
NP_442066.2_9 Forward -161 -148 7.6891 0.212
NP_441458.1_10 Forward -241 -222 5.01433 0.224
NP_442183.1_1 Reverse -223 -237 10.3243 0.0857
NP_442183.1_9 Reverse -264 -274 9.41981 0.296
NP_441116.1_3 Forward -336 -317 7.66927 0.221
NP_441574.1_1 Reverse -261 -280 -3.93378 0.246
NP_441549.1_9 Reverse -263 -281 -7.65067 0.209
NP_442347.1_2 Forward -231 -222 12.4878 0.056
NP_442347.1_2 Reverse -224 -233 11.1111 0.056
NP_442347.1_2 Reverse -114 -123 8.1612 0.108
NP_442645.1_2 Reverse -215 -234 -5.21209 0.0658
NP_442645.1_2 Forward -240 -221 -22.8133 0.296
NP_442965.1_2 Reverse -346 -365 1.27776 0.185
NP_441037.1_4 Forward -159 -149 7.31769 0.237
NP_441037.1_4 Forward -234 -224 6.92787 0.237
NP_442594.1_8 Reverse -95 -114 2.26107 0.295
NP_442594.1_9 Reverse -237 -256 9.14342 0.228
NP_442508.1_8 Forward -336 -319 8.7903 0.297
NP_441633.1_3 Reverse -221 -234 10.8357 0.0286
NP_441633.1_3 Forward -234 -221 5.72248 0.0481
NP_441633.1_3 Reverse -146 -159 4.93583 0.0644
NP_440136.1_2 Forward -231 -224 15.9687 0.0123
NP_440136.1_2 Reverse -224 -231 15.9687 0.0123
NP_440136.1_2 Reverse -149 -156 3.97235 0.288
NP_442590.1_10 Reverse -261 -280 18.584 0.113
NP_442590.1_10 Reverse -217 -236 4.32602 0.276
NP_442998.1_10 Forward -230 -223 15.5754 0.0102
NP_442998.1_10 Reverse -225 -232 15.5754 0.0102
NP_440899.1_5 Reverse -199 -218 3.53937 0.263
NP_440899.1_8 Forward -91 -72 -8.26035 0.254
NP_440299.1_1 Forward -236 -223 18.1116 0.00453
NP_440299.1_1 Reverse -219 -232 10.9334 0.0529
NP_440299.1_1 Forward -280 -267 7.98351 0.1
NP_440299.1_1 Reverse -302 -315 4.73861 0.201
NP_440299.1_1 Forward -352 -339 2.772 0.274
NP_441799.1_1 Reverse -219 -233 16.1252 0.0153
NP_441799.1_1 Forward -236 -222 5.30886 0.214
NP_440977.1_1 Reverse -96 -115 -1.7705 0.117
NP_440977.1_5 Reverse -77 -90 17.4232 0.141
NP_441007.1_10 Reverse -218 -231 8.57408 0.112
NP_442201.1_10 Reverse -212 -231 2.0644 0.107
NP_442201.1_10 Forward -243 -224 -13.5702 0.274
NP_440256.1_1 Reverse -220 -239 2.3594 0.0652
NP_440087.1_1 Reverse -214 -233 -9.53865 0.297
NP_441362.1_4 Reverse -79 -97 15.2604 0.0856
NP_441559.1_8 Forward -237 -223 12.291 0.0574
NP_441559.1_8 Reverse -228 -242 11.406 0.0574
NP_441559.1_8 Forward -365 -351 -2.85201 0.195
NP_441559.1_8 Reverse -308 -322 -4.22864 0.219
NP_441559.1_8 Reverse -307 -321 -5.70361 0.27
NP_440915.1_6 Forward -236 -222 12.4876 0.0208
NP_440915.1_6 Reverse -219 -233 0.687908 0.155
NP_440915.1_6 Reverse -197 -211 0.196253 0.173
NP_442866.1_1 Reverse -273 -292 -8.752 0.282
NP_442866.1_4 Reverse -274 -293 4.71934 0.249
NP_440748.1_5 Forward -207 -188 2.3594 0.223
NP_441464.1_10 Reverse -9 -23 8.45605 0.281
NP_441939.1_3 Forward -231 -212 9.73422 0.134
NP_441199.1_6 Reverse -144 -163 2.16274 0.198
NP_442993.1_1 Reverse -306 -322 -2.49807 0.115
NP_442993.1_1 Forward -378 -362 -10.8562 0.229
NP_442993.1_1 Forward -348 -332 -11.0529 0.233
NP_442386.1_9 Forward -233 -224 15.7322 0.0144
NP_442386.1_9 Reverse -222 -231 13.8639 0.0289
NP_442386.1_9 Reverse -147 -156 11.4057 0.0942
NP_440570.1_5 Forward -364 -345 1.67108 0.236
NP_441340.1_5 Forward -231 -224 15.6737 0.0124
NP_441340.1_5 Reverse -224 -231 15.6737 0.0124
NP_441340.1_9 Reverse -133 -143 7.29115 0.289
NP_442240.1_2 Reverse -224 -243 -2.16383 0.0621
NP_442240.1_2 Forward -231 -212 -10.1286 0.137
NP_440211.1_4 Reverse -83 -93 16.008 0.215
NP_440586.1_8 Forward -231 -224 13.2151 0.026
NP_440586.1_8 Reverse -224 -231 13.2151 0.026
NP_440586.1_8 Forward -269 -262 10.7568 0.128
NP_440586.1_8 Reverse -346 -353 9.08521 0.178
NP_442251.1_6 Forward -231 -224 15.2804 0.0124
NP_442251.1_6 Reverse -224 -231 15.2804 0.0124
NP_442959.1_4 Forward -80 -61 4.916 0.267
NP_441262.1_3 Reverse -223 -230 14.7888 0.0223
NP_441262.1_3 Forward -232 -225 14.7888 0.0223
NP_440027.1_3 Forward -242 -224 17.7179 0.0812
NP_440027.1_8 Forward -235 -216 7.86512 0.254
NP_443051.1_1 Reverse -222 -231 10.4228 0.00754
NP_443051.1_1 Forward -233 -224 10.4228 0.00754
NP_439984.1_3 Reverse -216 -230 20.2551 0.0437
NP_439937.1_9 Reverse -308 -325 -14.8098 0.287
NP_440408.1_7 Reverse -273 -292 7.37428 0.29
NP_440408.1_7 Forward -334 -315 6.98095 0.295
NP_440439.1_1 Forward -235 -222 10.2457 0.0372
NP_440439.1_1 Reverse -220 -233 1.88757 0.139
NP_440439.1_1 Forward -221 -208 -2.144 0.298
NP_440372.1_2 Forward -231 -224 16.3621 0.0124
NP_440372.1_2 Reverse -224 -231 16.3621 0.0124
NP_440372.1_3 Reverse -19 -33 15.3858 0.165
NP_440316.1_10 Reverse -200 -210 8.1415 0.24
NP_440316.1_10 Forward -322 -312 7.25653 0.251
NP_441572.1_7 Reverse -217 -236 -2.16383 0.192
NP_441572.1_7 Forward -293 -274 -2.85214 0.203
NP_440267.1_2 Forward -21 -7 8.45543 0.162
NP_442887.1_5 Forward -350 -331 -13.5702 0.293
NP_442384.1_10 Forward -232 -219 19.2922 0.00338
NP_442384.1_10 Reverse -223 -236 19.1938 0.00338
NP_442384.1_10 Forward -242 -229 2.2809 0.23
NP_442384.1_10 Reverse -113 -126 0.215946 0.297
NP_442114.1_4 Reverse -223 -234 9.20345 0.17
NP_441877.1_7 Forward -237 -218 4.71854 0.218
NP_441018.1_7 Reverse -219 -238 16.6174 0.082
NP_441018.1_7 Reverse -263 -282 10.6192 0.201
NP_442790.1_4 Forward -241 -222 -5.80207 0.144
NP_442790.1_4 Reverse -214 -233 -8.16202 0.164
NP_442262.1_10 Forward -231 -224 14.1988 0.0123
NP_442262.1_10 Reverse -224 -231 14.1988 0.0123
NP_442262.1_10 Reverse -346 -353 9.18389 0.211
NP_441689.1_5 Reverse -221 -231 5.78111 0.197
NP_441689.1_5 Reverse -54 -64 5.38779 0.265
NP_440344.1_10 Forward -239 -222 -6.451 0.113
NP_440344.1_10 Reverse -141 -158 -11.3676 0.212
NP_440282.1_10 Forward -292 -273 -6.98204 0.251
NP_440531.1_6 Reverse -215 -234 8.65258 0.0844
NP_440531.1_6 Forward -240 -221 -4.72043 0.286
NP_441965.1_10 Reverse -220 -236 9.10498 0.123
NP_441965.1_10 Forward -235 -219 2.91013 0.28
NP_441640.1_8 Reverse -340 -359 -3.73712 0.259
NP_441898.1_1 Reverse -1 -20 12.9791 0.299
NP_442693.1_7 Forward -329 -310 15.0441 0.202
NP_440297.1_9 Forward -209 -199 0.766681 0.282
NP_440297.1_9 Forward -231 -221 -0.118297 0.282
NP_440297.1_9 Reverse -224 -234 -0.118297 0.282
NP_440350.1_5 Forward -369 -350 -1.47551 0.204
NP_441592.1_4 Reverse -312 -331 -0.295539 0.243
NP_441592.1_4 Reverse -306 -325 -2.16383 0.261
NP_441896.1_5 Forward -165 -158 15.3787 0.268
NP_442129.1_6 Reverse -77 -96 14.1404 0.246
NP_440999.1_9 Forward -236 -222 19.9608 0.0114
NP_440999.1_9 Forward -382 -368 -3.44199 0.293
NP_440888.1_2 Forward -232 -218 16.8135 0.00536
NP_440888.1_2 Reverse -223 -237 14.2569 0.0193
NP_440888.1_2 Reverse -113 -127 10.717 0.0861
NP_440888.1_2 Forward -276 -262 9.93039 0.11
NP_440888.1_2 Reverse -369 -383 8.94708 0.142
NP_440600.1_4 Reverse -215 -233 -3.12744 0.218
NP_440600.1_4 Forward -240 -222 -6.1757 0.285
NP_440491.1_1 Forward -235 -216 8.47633 0.241
NP_442033.1_10 Reverse -221 -240 -7.76869 0.186
NP_442033.1_10 Forward -244 -225 -14.5535 0.299
NP_440575.1_8 Reverse -335 -354 1.47442 0.173
NP_441543.1_2 Reverse -224 -233 18.486 0.00236
NP_441543.1_2 Forward -231 -222 16.9127 0.00359
NP_441543.1_2 Forward -269 -260 5.70292 0.181
NP_442845.1_2 Reverse -267 -281 16.2242 0.0636
NP_442845.1_2 Reverse -217 -231 9.73436 0.168
NP_441918.1_7 Forward -355 -336 0.491109 0.292
NP_441918.1_7 Reverse -222 -241 -1.08219 0.297
NP_441469.1_8 Forward -233 -224 16.126 0.00797
NP_441469.1_8 Reverse -222 -231 6.48957 0.227
NP_443064.1_6 Forward -232 -222 12.5669 0.0796
NP_443064.1_6 Forward -122 -112 9.07643 0.247
NP_442337.1_8 Forward -171 -152 1.86774 0.228
NP_442578.1_7 Forward -231 -224 14.5921 0.026
NP_442578.1_7 Reverse -224 -231 14.5921 0.026
NP_440710.1_1 Forward -240 -222 -3.71743 0.208
NP_440710.1_1 Reverse -215 -233 -7.84733 0.245
NP_440071.1_6 Reverse -268 -282 14.0957 0.25
NP_440220.1_4 Forward -367 -348 0.785326 0.243
NP_440220.1_4 Forward -88 -69 -2.45958 0.271
NP_441462.1_2 Forward -232 -222 11.5831 0.00406
NP_441462.1_2 Reverse -223 -233 11.5831 0.00406
NP_441462.1_2 Reverse -306 -316 -0.609952 0.24
NP_441462.1_2 Reverse -201 -211 -1.19994 0.291
NP_441621.1_7 Reverse -221 -235 -3.34366 0.188
NP_443062.1_1 Reverse -223 -241 9.81352 0.127
NP_443062.1_1 Forward -232 -214 3.76806 0.285
NP_443062.1_6 Reverse -259 -278 0.982764 0.283
NP_440936.1_2 Forward -108 -89 12.5858 0.26
NP_442204.1_1 Forward -236 -225 11.5634 0.0565
NP_442204.1_6 Reverse -258 -277 6.39097 0.255
NP_441560.1_10 Forward -240 -221 8.35759 0.251
NP_441351.1_8 Reverse -343 -362 10.1275 0.159
NP_442487.1_5 Forward -243 -224 3.73524 0.27
NP_442780.1_3 Reverse -21 -40 13.6072 0.154
NP_440516.1_2 Forward -238 -220 10.1472 0.0944
NP_440516.1_2 Forward -248 -230 2.67408 0.166
NP_440516.1_8 Forward -232 -223 16.9127 0.00442
NP_440516.1_8 Reverse -223 -232 16.9127 0.00442
NP_442080.1_7 Reverse -287 -306 -0.295539 0.26
NP_442428.1_5 Forward -231 -224 15.8704 0.0124
NP_442428.1_5 Reverse -224 -231 15.8704 0.0124
NP_442859.1_2 Reverse -224 -243 5.80098 0.201
NP_440618.1_1 Reverse -345 -364 -2.16383 0.182
NP_442120.1_10 Reverse -273 -292 -16.2252 0.297
NP_441867.1_2 Forward -330 -311 -12.7836 0.27
NP_440673.1_3 Forward -230 -223 12.4288 0.0426
NP_440673.1_3 Reverse -225 -232 12.4288 0.0426
NP_441052.1_2 Forward -232 -222 19.9412 0.00106
NP_441052.1_2 Reverse -223 -233 10.5014 0.0285
NP_441052.1_2 Reverse -345 -355 1.25834 0.249
NP_442219.1_8 Reverse -341 -360 6.71761 0.291
NP_442219.1_9 Forward -231 -222 17.7976 0.00718
NP_442219.1_9 Reverse -224 -233 8.35786 0.0681
NP_442219.1_9 Reverse -114 -123 1.76968 0.298
NP_440592.1_8 Reverse -54 -73 11.7992 0.253
NP_440436.1_4 Reverse -224 -233 18.1905 0.00233
NP_440436.1_4 Forward -231 -222 17.2072 0.00233
NP_440436.1_4 Forward -156 -147 10.7174 0.0743
NP_441884.1_8 Reverse -222 -241 -6.29373 0.219
NP_441884.1_9 Forward -235 -216 -24.5833 0.288
NP_442864.1_10 Forward -227 -208 19.6656 0.155
NP_440314.1_9 Forward -250 -231 5.40766 0.0717
NP_440314.1_9 Reverse -149 -168 -7.86702 0.243
NP_440314.1_9 Forward -231 -212 -9.14533 0.26
NP_441719.1_4 Forward -231 -224 16.3621 0.0124
NP_441719.1_4 Reverse -224 -231 16.3621 0.0124
NP_441733.1_10 Reverse -220 -233 7.09911 0.156
NP_441733.1_10 Forward -160 -147 6.80412 0.171
NP_441004.1_1 Forward -327 -308 19.2723 0.0121
NP_441004.1_1 Reverse -217 -236 5.89931 0.103
NP_441004.1_2 Forward -332 -313 4.42435 0.195
NP_441004.1_5 Forward -325 -311 10.0294 0.248
NP_442813.1_2 Forward -381 -362 1.17943 0.263
NP_442813.1_4 Reverse -373 -392 -3.04881 0.288
NP_442813.1_4 Forward -366 -347 -6.68705 0.299
NP_440129.1_10 Forward -239 -225 4.42448 0.185
NP_441115.1_4 Forward -233 -215 9.94979 0.194
NP_442694.1_9 Forward -91 -72 11.8975 0.207
NP_442206.1_10 Reverse -223 -238 9.61633 0.155
NP_442854.1_6 Reverse -223 -242 5.89931 0.238
NP_440094.1_2 Reverse -340 -359 -3.83545 0.294
NP_443054.1_2 Reverse -221 -235 1.17956 0.251
NP_443054.1_2 Forward -159 -145 -0.197071 0.288
NP_441851.1_10 Forward -233 -223 16.008 0.00552
NP_441851.1_10 Reverse -222 -232 15.8113 0.00552
NP_441851.1_10 Forward -158 -148 15.123 0.0113
NP_441851.1_10 Forward -124 -114 4.60159 0.259
NP_441851.1_10 Forward -66 -56 4.20827 0.282
NP_441195.1_1 Reverse -325 -344 -2.26216 0.237
NP_442011.1_1 Forward -233 -214 -1.18052 0.268
NP_442515.1_1 Forward -233 -219 11.6026 0.0393
NP_442515.1_1 Forward -277 -263 -1.77037 0.263
NP_442515.1_1 Reverse -222 -236 -4.52363 0.298
NP_441396.1_5 Reverse -262 -271 8.35786 0.224
NP_442709.1_3 Reverse -216 -235 15.3391 0.0613
NP_441046.1_2 Reverse -256 -275 5.99764 0.221
NP_440940.1_7 Forward -242 -224 13.588 0.0817
NP_441349.1_10 Reverse -296 -315 -0.295539 0.0936
NP_441349.1_10 Reverse -213 -232 -5.70374 0.21
NP_441349.1_10 Forward -242 -223 -6.49039 0.23
NP_440432.1_9 Forward -231 -216 -3.75668 0.19
NP_440432.1_9 Reverse -224 -239 -4.54333 0.211
NP_442843.1_1 Reverse -224 -243 -5.60541 0.244
NP_442843.1_1 Reverse -202 -221 -9.34199 0.265
NP_439960.1_8 Forward -232 -213 8.94757 0.287
NP_441477.1_10 Reverse -216 -234 5.42735 0.193
NP_440431.1_3 Reverse -244 -263 -5.70374 0.185
NP_440431.1_3 Reverse -338 -357 -11.5053 0.286
NP_442450.1_5 Forward -289 -279 5.78156 0.227
NP_440588.1_2 Reverse -214 -233 -0.983855 0.155
NP_440588.1_2 Reverse -303 -322 -6.29373 0.276
NP_440483.1_1 Forward -170 -151 0.982764 0.187
NP_440483.1_1 Forward -334 -315 -7.4737 0.265
NP_441570.1_1 Reverse -223 -241 -7.25734 0.0879
NP_440078.1_10 Reverse -223 -242 5.89931 0.224
NP_440078.1_10 Reverse -267 -286 5.60432 0.224
NP_441078.1_4 Forward -232 -223 19.6659 0.0007
NP_441078.1_4 Reverse -223 -232 19.6659 0.0007
NP_441078.1_4 Reverse -201 -210 6.09625 0.0863
NP_441078.1_4 Forward -315 -306 -1.47524 0.266
NP_441078.1_4 Reverse -267 -276 -1.77023 0.266
NP_441078.1_4 Forward -210 -201 -2.06522 0.295
NP_441078.1_4 Forward -157 -148 -2.06522 0.295
NP_442729.1_8 Reverse -219 -232 10.639 0.125
NP_441663.1_8 Forward -238 -219 6.29264 0.126
NP_442348.1_2 Forward -362 -353 11.7994 0.225
NP_440526.1_3 Forward -231 -220 1.04151 0.267
NP_441432.1_8 Reverse -222 -231 16.8143 0.00595
NP_441432.1_8 Forward -233 -224 8.25953 0.0755
NP_441432.1_8 Forward -123 -114 5.01461 0.191
NP_442320.1_8 Forward -238 -224 -3.24533 0.113
NP_442320.1_8 Reverse -217 -231 -4.52363 0.171
NP_442344.1_7 Reverse -313 -332 -1.86883 0.148
NP_441732.1_2 Forward -236 -220 -6.52964 0.0495
NP_441732.1_2 Forward -280 -264 -17.5427 0.27
NP_440629.1_4 Forward -86 -67 17.109 0.134
NP_440760.1_1 Forward -232 -213 5.50599 0.0121
NP_440760.1_1 Reverse -223 -242 -20.8467 0.225
NP_440760.1_1 Reverse -201 -220 -21.83 0.245
NP_442797.1_7 Reverse -311 -329 1.49411 0.258
NP_440461.1_8 Reverse -360 -379 18.6823 0.172
NP_441057.1_3 Forward -337 -318 -12.2919 0.255
NP_442353.1_4 Forward -238 -219 6.78348 0.17
NP_440913.1_1 Reverse -221 -239 7.00065 0.218
NP_441072.1_2 Reverse -274 -293 5.40766 0.296
NP_440713.1_4 Reverse -269 -288 2.3594 0.264
NP_442489.1_7 Forward -232 -223 20.1576 0.000695
NP_442489.1_7 Reverse -223 -232 20.1576 0.000695
NP_442489.1_7 Forward -315 -306 -0.983583 0.178
NP_442489.1_7 Reverse -267 -276 -1.27858 0.185
NP_442489.1_7 Reverse -369 -378 -1.6719 0.235
NP_442489.1_7 Reverse -201 -210 -1.6719 0.235
NP_442489.1_7 Forward -157 -148 -2.06522 0.288
NP_440559.1_1 Forward -231 -222 17.4043 0.00658
NP_440559.1_1 Reverse -224 -233 8.75118 0.0586
NP_440559.1_1 Reverse -149 -158 4.32629 0.288
NP_441659.2_8 Forward -232 -222 18.1713 0.00133
NP_441659.2_8 Reverse -223 -233 11.9764 0.0147
NP_441659.2_8 Forward -276 -266 10.0098 0.0247
NP_441659.2_8 Reverse -306 -316 6.37155 0.0774
NP_441659.2_8 Forward -210 -200 4.40493 0.136
NP_442913.1_9 Reverse -217 -236 9.24257 0.23
NP_442849.1_1 Forward -324 -310 9.2427 0.257
NP_439956.1_7 Reverse -261 -280 4.12936 0.257
NP_439956.1_7 Forward -228 -209 3.44104 0.257
NP_441807.1_5 Reverse -212 -231 14.1591 0.117
NP_442776.1_1 Reverse -155 -174 5.50599 0.241
NP_442346.1_5 Reverse -222 -232 16.6963 0.00248
NP_442346.1_5 Forward -233 -223 9.02648 0.118
NP_442346.1_5 Reverse -200 -210 4.3066 0.291
NP_440545.1_3 Reverse -269 -286 -2.41943 0.184
NP_440545.1_3 Reverse -219 -236 -3.8944 0.214
NP_440545.1_3 Forward -214 -197 -4.09106 0.218
NP_440025.1_3 Reverse -70 -84 13.9992 0.235
NP_441629.1_3 Forward -283 -264 -1.57461 0.264
NP_440486.1_6 Forward -328 -309 10.8159 0.216
NP_440459.1_2 Forward -234 -217 13.7068 0.126
NP_440459.1_2 Reverse -265 -282 10.3636 0.2
NP_440459.1_8 Reverse -151 -169 9.55725 0.258
NP_441943.1_3 Forward -42 -23 24.2068 0.0119
NP_442603.1_7 Forward -232 -218 17.8952 0.0187
NP_442603.1_7 Forward -276 -262 7.96378 0.191
NP_442603.1_7 Reverse -223 -237 7.3738 0.208
NP_441888.1_7 Forward -237 -223 23.1074 0.00562
NP_441833.1_4 Forward -231 -224 15.9687 0.0124
NP_441833.1_4 Reverse -224 -231 15.9687 0.0124
NP_441895.1_2 Reverse -345 -364 -17.7001 0.234
NP_442162.1_9 Forward -231 -224 16.2637 0.0124
NP_442162.1_9 Reverse -224 -231 16.2637 0.0124
NP_440671.1_2 Forward -229 -215 14.9459 0.223
NP_440671.1_4 Forward -238 -224 11.2093 0.138
NP_440671.1_4 Forward -321 -307 6.48943 0.245
NP_442404.1_9 Reverse -116 -130 9.6354 0.265
NP_442140.1_3 Reverse -224 -234 14.238 0.0486
NP_442140.1_3 Forward -231 -221 10.3048 0.0902
NP_440875.1_9 Reverse -225 -235 17.327 0.0126
NP_441813.1_5 Forward -234 -224 19.4496 0.00647
NP_441813.1_5 Reverse -221 -231 18.1713 0.00743
NP_440594.1_8 Reverse -149 -162 7.59019 0.272
NP_441227.1_6 Forward -327 -308 11.0125 0.293
NP_441259.1_7 Forward -320 -302 20.8653 0.149
NP_440590.1_4 Forward -231 -218 9.75405 0.0335
NP_440590.1_4 Reverse -224 -237 6.4108 0.0575
NP_440567.1_1 Forward -231 -217 4.42448 0.121
NP_442497.1_10 Forward -231 -222 10.4228 0.0087
NP_442497.1_10 Reverse -224 -233 10.4228 0.0087
NP_442497.1_10 Reverse -149 -158 0.393051 0.175
NP_440821.1_4 Forward -234 -224 10.2065 0.0163
NP_440821.1_4 Reverse -221 -231 9.41981 0.0286
NP_440821.1_4 Forward -159 -149 -0.118297 0.229
NP_441239.1_9 Forward -234 -222 14.1986 0.0288
NP_441239.1_9 Reverse -146 -158 8.59377 0.128
NP_441239.1_9 Reverse -221 -233 7.80712 0.148
NP_441239.1_9 Forward -212 -200 4.66053 0.248
NP_442639.1_5 Reverse -216 -235 16.4207 0.158
NP_441892.1_1 Forward -241 -224 -3.79607 0.249
NP_440665.1_1 Reverse -255 -274 -14.0619 0.261
NP_440604.1_2 Reverse -279 -298 19.8623 0.127
NP_442044.1_1 Forward -127 -108 -14.6519 0.294
NP_441874.1_1 Forward -135 -121 9.14437 0.277
NP_441617.1_6 Reverse -233 -252 -6.29373 0.28
NP_442052.1_8 Forward -323 -313 15.0247 0.253
NP_440546.1_4 Reverse -223 -233 11.8882 0.0679
NP_440546.1_4 Forward -232 -222 10.046 0.109
NP_440546.1_4 Reverse -201 -211 10.046 0.109
NP_440546.1_4 Reverse -11 -21 8.97947 0.16
NP_441509.1_2 Forward -174 -156 10.0489 0.245
NP_440462.1_6 Forward -234 -224 17.2863 0.00752
NP_440462.1_6 Reverse -221 -231 9.61647 0.0429
NP_440868.1_4 Forward -236 -224 10.5604 0.0364
NP_440868.1_4 Reverse -219 -231 9.97041 0.0405
NP_441582.1_5 Forward -124 -105 3.53858 0.266
NP_442402.1_4 Forward -101 -82 -4.42619 0.225
NP_442402.1_4 Forward -366 -347 -7.3761 0.274
NP_442402.1_4 Forward -336 -317 -9.9327 0.295
NP_442402.1_6 Reverse -81 -90 12.9794 0.289
NP_441848.1_4 Reverse -127 -143 12.1343 0.211
NP_441848.1_4 Reverse -344 -360 7.1687 0.295
NP_439948.1_2 Reverse -170 -188 14.2303 0.259
NP_441084.1_6 Reverse -322 -336 13.5133 0.128
NP_441084.1_6 Reverse -159 -173 9.8289 0.263
NP_440696.1_3 Reverse -223 -241 2.37909 0.216
NP_440696.1_3 Reverse -274 -292 0.510803 0.229
NP_442039.1_4 Forward -231 -224 15.1821 0.0124
NP_442039.1_4 Reverse -224 -231 15.1821 0.0124
NP_442039.1_4 Forward -156 -149 10.8555 0.109
NP_442039.1_4 Forward -64 -57 7.02061 0.269
NP_442039.1_7 Forward -352 -342 12.7631 0.221
NP_441811.1_8 Forward -163 -149 16.6175 0.113
NP_441811.1_8 Reverse -107 -121 6.88276 0.259
NP_442679.1_3 Reverse -128 -146 11.7205 0.0394
NP_442380.1_10 Reverse -263 -281 16.5388 0.16
NP_441926.1_3 Forward -232 -216 5.07341 0.174
NP_441926.1_3 Forward -378 -362 4.68009 0.182
NP_442837.1_3 Forward -231 -224 15.7721 0.0124
NP_442837.1_3 Reverse -224 -231 15.7721 0.0124
NP_440160.1_2 Forward -322 -303 -2.45882 0.245
NP_439994.1_4 Reverse -310 -329 11.8975 0.239
NP_439994.1_4 Reverse -221 -240 9.14423 0.291
NP_442053.1_1 Forward -232 -223 18.3876 0.0007
NP_442053.1_1 Reverse -223 -232 18.3876 0.0007
NP_440505.1_3 Reverse -221 -231 18.3679 0.00213
NP_440505.1_3 Forward -234 -224 15.9097 0.00857
NP_440505.1_3 Forward -124 -114 4.50326 0.284
NP_441252.1_6 Forward -324 -317 14.3954 0.168
NP_441203.1_1 Reverse -224 -243 -20.3551 0.297
NP_441408.2_7 Reverse -343 -362 -4.91709 0.288
NP_440914.1_1 Forward -232 -222 17.5935 0.000537
NP_440914.1_1 Forward -378 -368 8.81029 0.186
NP_440914.1_1 Reverse -223 -233 8.6151 0.186
NP_440914.1_1 Reverse -56 -66 7.73678 0.224
NP_440914.1_1 Reverse -209 -219 6.3705 0.283
NP_441011.1_8 Reverse -224 -233 16.9127 0.00602
NP_441011.1_8 Forward -231 -222 8.25953 0.144
NP_441011.1_8 Forward -156 -147 4.91628 0.296
NP_442101.1_10 Forward -226 -207 -11.9969 0.267
NP_442533.1_1 Reverse -264 -283 -5.60541 0.155
NP_442533.1_1 Forward -328 -309 -16.9135 0.277
NP_442533.1_1 Forward -327 -308 -17.4051 0.288
NP_442533.1_6 Forward -232 -223 17.2076 0.00137
NP_442533.1_6 Reverse -223 -232 17.2076 0.00137
NP_442533.1_6 Forward -315 -306 10.9145 0.0503
NP_442533.1_6 Forward -210 -201 5.40793 0.14
NP_442533.1_6 Forward -276 -267 5.21127 0.15
NP_442533.1_6 Forward -157 -148 5.21127 0.15
NP_442533.1_6 Reverse -267 -276 3.83464 0.202
NP_442533.1_6 Forward -282 -273 3.04799 0.228
NP_442541.1_10 Forward -282 -268 1.17898 0.29
NP_441482.1_7 Forward -238 -224 16.4209 0.00702
NP_441482.1_7 Reverse -217 -231 -12.2918 0.292
NP_439944.1_9 Forward -231 -221 10.5014 0.0887
NP_442664.1_3 Reverse -287 -301 10.226 0.291
NP_440115.1_6 Forward -235 -225 7.64985 0.146
NP_440115.1_6 Reverse -220 -230 6.76487 0.167
NP_440007.1_9 Forward -291 -277 4.22782 0.267
NP_440007.1_9 Forward -236 -222 1.96621 0.281
NP_442728.1_7 Reverse -155 -169 11.3077 0.289
NP_441680.1_4 Reverse -347 -366 1.17943 0.246
NP_441602.1_3 Reverse -218 -237 4.12936 0.162
NP_441602.1_3 Reverse -268 -287 -3.04881 0.241
NP_441106.1_1 Forward -233 -224 18.191 0.0028
NP_441106.1_1 Reverse -222 -231 9.63616 0.0311
NP_441106.1_1 Forward -316 -307 3.14632 0.243
NP_439903.1_6 Reverse -309 -328 4.52188 0.193
NP_442588.1_6 Forward -229 -210 -1.08219 0.268
NP_440302.1_4 Forward -321 -302 13.9625 0.283
NP_442928.1_3 Forward -225 -206 14.5459 0.208
NP_440797.1_8 Reverse -282 -301 14.3777 0.268
NP_441286.1_1 Reverse -222 -234 6.03717 0.0258
NP_441286.1_1 Forward -233 -221 3.38223 0.0467
NP_440670.1_8 Forward -232 -223 18.3876 0.000699
NP_440670.1_8 Reverse -223 -232 18.3876 0.000699
NP_441930.1_2 Reverse -200 -210 13.5497 0.24
NP_440886.1_7 Forward -233 -223 17.7774 0.0011
NP_440886.1_7 Reverse -222 -232 7.94438 0.0805
NP_440886.1_7 Forward -277 -267 5.38779 0.185
NP_440886.1_7 Forward -379 -369 4.40448 0.237
NP_440828.1_4 Forward -283 -264 -8.16275 0.296
NP_442614.1_2 Forward -312 -298 11.701 0.183
NP_442614.1_2 Forward -232 -218 8.94771 0.242
NP_442614.1_2 Forward -276 -262 8.65272 0.254
NP_441399.1_6 Reverse -313 -332 13.2733 0.185
NP_442072.1_9 Reverse -222 -240 -15.2222 0.174
NP_442072.1_9 Forward -233 -215 -20.4337 0.204
NP_440907.2_8 Reverse -224 -234 7.94438 0.117
NP_440907.2_8 Reverse -149 -159 6.96107 0.138
NP_442264.1_2 Reverse -263 -280 14.1002 0.135
NP_441021.1_1 Reverse -301 -320 -6.98204 0.181
NP_440841.1_4 Reverse -199 -218 -6.68705 0.215
NP_441463.1_3 Forward -148 -129 -7.08038 0.254
NP_441626.1_2 Forward -231 -224 15.7721 0.0124
NP_441626.1_2 Reverse -224 -231 15.7721 0.0124
NP_442365.1_7 Reverse -219 -238 -0.295539 0.177
NP_442365.1_7 Forward -236 -217 -1.27885 0.191
NP_440107.1_2 Forward -237 -218 9.63589 0.299
NP_442794.1_1 Forward -236 -224 10.4621 0.0721
NP_442794.1_1 Reverse -219 -231 7.31547 0.142
NP_442615.1_1 Forward -166 -148 -4.60241 0.19
NP_442615.1_1 Reverse -214 -232 -5.97904 0.231
NP_441962.1_4 Forward -359 -340 -10.227 0.224
NP_441962.1_4 Reverse -218 -237 -11.8003 0.245
NP_440387.1_1 Reverse -223 -239 13.9232 0.00763
NP_440387.1_1 Forward -232 -216 5.76173 0.031
NP_440387.1_1 Forward -315 -299 -5.93965 0.258
NP_440387.1_1 Forward -210 -194 -6.43131 0.285
NP_440855.1_5 Reverse -304 -323 13.9616 0.141
NP_441431.1_2 Forward -235 -221 10.5204 0.159
NP_441431.1_2 Reverse -309 -323 7.3738 0.244
NP_441836.1_2 Reverse -217 -236 4.22769 0.147
NP_441836.1_2 Reverse -261 -280 -2.85214 0.232
NP_441993.1_1 Reverse -279 -298 6.33227 0.181
NP_441993.1_1 Reverse -217 -236 4.67549 0.215
NP_441993.1_1 Reverse -223 -242 3.40855 0.235
NP_441993.1_1 Forward -321 -302 0.874656 0.29
NP_440358.1_8 Reverse -250 -269 15.4374 0.0876
NP_440114.1_10 Reverse -201 -215 11.3077 0.118
NP_440114.1_10 Forward -232 -218 6.09611 0.285
NP_440114.1_10 Reverse -148 -162 6.09611 0.285
NP_441425.1_2 Forward -107 -88 13.2234 0.247
NP_441858.1_2 Forward -310 -291 9.06337 0.293
NP_442437.1_3 Reverse -225 -244 13.7649 0.136
NP_440293.1_3 Forward -329 -310 3.04771 0.192
NP_439988.1_3 Forward -169 -155 8.65272 0.249
NP_439988.1_3 Reverse -197 -211 6.58777 0.278
NP_442743.1_1 Reverse -309 -328 11.405 0.241
NP_442930.1_1 Forward -344 -334 9.91099 0.28
NP_441133.1_1 Reverse -267 -286 17.8957 0.126
NP_439910.1_2 Reverse -140 -157 -13.0392 0.127
NP_440457.1_1 Reverse -197 -209 10.5604 0.092
NP_440457.1_1 Forward -236 -224 7.61046 0.101
NP_440457.1_1 Reverse -263 -275 -0.74767 0.273
NP_440457.1_1 Reverse -219 -231 -0.74767 0.273
NP_442680.1_5 Reverse -166 -185 0.169919 0.268
NP_441436.1_8 Reverse -266 -285 8.25926 0.283
NP_442509.1_9 Reverse -223 -233 16.2041 0.00739
NP_442509.1_9 Forward -242 -232 11.9759 0.107
NP_442509.1_9 Forward -232 -222 8.14104 0.192
NP_442936.1_10 Forward -347 -333 10.0295 0.262
NP_442936.1_10 Forward -268 -254 7.6369 0.276
NP_440734.1_9 Reverse -206 -225 10.0292 0.282
NP_440756.1_3 Reverse -12 -30 15.6538 0.163
NP_440554.1_4 Reverse -224 -234 16.4996 0.0189
NP_440554.1_4 Forward -231 -221 8.92815 0.0646
NP_441845.1_5 Reverse -339 -358 17.5292 0.159
NP_441845.1_6 Forward -169 -151 1.00246 0.274
NP_441885.1_5 Forward -232 -222 20.9245 0.000538
NP_441885.1_5 Reverse -223 -233 11.4848 0.00668
NP_441885.1_5 Reverse -267 -277 -0.511621 0.202
NP_440478.1_4 Forward -236 -217 12.9791 0.21
NP_440478.1_10 Forward -234 -220 16.4209 0.107
NP_442341.1_7 Reverse -222 -236 10.9143 0.0591
NP_442341.1_7 Forward -233 -219 6.78443 0.118
NP_442341.1_7 Forward -277 -263 4.12949 0.2
NP_442341.1_7 Reverse -147 -161 1.76955 0.281
NP_441756.1_5 Forward -236 -217 10.4225 0.117
NP_441173.1_9 Forward -394 -386 12.2121 0.21
NP_441173.1_9 Forward -90 -82 10.9338 0.242
NP_441173.1_9 Forward -393 -385 9.75379 0.284
NP_440423.1_6 Reverse -215 -234 -16.0285 0.229
NP_443000.1_7 Reverse -221 -231 19.9412 0.00223
NP_443000.1_7 Forward -234 -224 11.5831 0.0344
NP_440275.1_3 Forward -234 -224 15.418 0.0178
NP_440275.1_3 Reverse -221 -231 15.123 0.0182
NP_442932.1_10 Reverse -225 -244 6.68596 0.267
NP_441207.1_7 Reverse -135 -149 12.063 0.241
NP_442753.1_6 Forward -285 -266 9.43841 0.231
NP_442495.1_3 Forward -164 -146 10.1472 0.282
NP_440149.1_8 Reverse -223 -242 -2.75381 0.175
NP_441105.1_3 Reverse -301 -320 1.86774 0.109
NP_441105.1_3 Forward -243 -224 -0.4922 0.137
NP_441105.1_3 Reverse -212 -231 -4.6221 0.203
NP_441105.1_3 Reverse -262 -281 -6.49039 0.236
NP_440216.1_1 Forward -232 -218 8.94771 0.00589
NP_440216.1_1 Reverse -223 -237 7.57108 0.00935
NP_440216.1_9 Reverse -347 -356 15.9293 0.128
NP_440216.1_9 Reverse -346 -355 6.78456 0.289
NP_440172.1_1 Forward -232 -222 15.0247 0.00945
NP_440172.1_1 Reverse -223 -233 8.73149 0.0586
NP_440172.1_1 Forward -378 -368 3.02829 0.251
NP_442015.1_10 Forward -236 -223 21.4554 0.00329
NP_442015.1_10 Reverse -219 -232 2.67422 0.187
NP_441226.1_7 Forward -231 -224 14.4934 0.0123
NP_441226.1_7 Reverse -224 -231 14.4934 0.0123
NP_441111.1_7 Forward -231 -223 18.7023 0.00294
NP_441111.1_7 Reverse -224 -232 18.7023 0.00294
NP_441766.1_2 Forward -232 -223 17.5026 0.00297
NP_441766.1_2 Reverse -223 -232 17.5026 0.00297
NP_442417.1_5 Reverse -223 -237 18.6825 0.0203
NP_440416.1_1 Forward -378 -359 -14.3569 0.287
NP_440416.1_9 Reverse -344 -363 -6.49039 0.0901
NP_440416.1_9 Reverse -216 -235 -10.522 0.142
NP_440416.1_9 Forward -239 -220 -12.6852 0.159
NP_443052.1_9 Forward -236 -217 -4.52377 0.258
NP_442403.1_9 Reverse -110 -129 5.30933 0.211
NP_442154.1_1 Forward -203 -185 -9.61729 0.185
NP_440261.1_5 Forward -231 -218 6.90245 0.0316
NP_440261.1_5 Reverse -224 -237 -2.63565 0.0924
NP_440261.1_5 Reverse -149 -162 -3.12731 0.115
NP_440988.1_10 Forward -278 -264 9.15859 0.205
NP_440988.1_10 Reverse -265 -279 5.28608 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCAGACTTTCACCAAAATAGGCGGCAAACTCCTGTTCCCGGGCTTTTTCCATGGCGACAATTTTTTCGCTCAGGGTTTGGGCAAAGGCGGGGGCCATACTGAAACTAGCCAAGGTCAATCCCATGCCCACCGCCATCAATTTGTTCAGCAAAGATCTCGACAAACCCCGGCGATCGCCAGAAGCTGATTGGCCCATAGCCCTGCTGTGTGTGGTAGTTTTCATTTTTAGTCCCCTTGGTTTGGGGCGATTCCTGATTAAGATTTTCTTTGACTACGGTGGGAATCACTACCCTTCAACATTACTAGTTGATTTTCCCAGAAATTATGCCAATTCTGGAGATTCCTTTGTTATCTTCGTAGGTAATTAGAAAATTCTATAAACCCAGCCCTTACCATCATA

CDS

ATGTCGGAACTTAGCCTGGCCCATCAGGATTACCCCGTTGACGACCTCGAACAATTATTAAGTATTCTGCCCAAACCCATCCAAGCCATCATCGCCGAACACCCCCAGCGGCAACAGTTAGTGGAAGTAGTCATGGACCTAGGGCGCTTACCGGAAGCACGTTTTCCCGGCACTGCAGTCTATTTGGGCCATGAACCGATCGCCAAGGAGGATTTACAGTACGCCATTGACCGGGTAGGGCTATTTAGCAGTGATAACCGGGCTGGCATTGAAAGGACCCTGCACCGCATCAGTGCCATCCGCAACCGCACCAACGAAATTATCGGCTTGACCTGTCGGGTAGGCCGGGCGGTGTTCGGCACCATTAACCTCATCCAAGACCTGGTGGAAACAGGGGAATCGTTACTGCTGCTCGGGCGACCGGGGGTGGGAAAAACCACTGCCCTACGGGAAATTGCCCGGGTACTAGCGGATGATTTGCACAAACGGGTGGTGATCATCGACACTTCCAACGAAATTGCTGGGGACGGGGACATTCCCCATCCGGCGATCGGTCGGGCCCGGAGAATGCAGGTGGCTAGGCCAGAACTGCAACATCAGGTGATGATTGAGGCAGTGGAAAACCATATGCCGGAAGTGATCGTCATCGACGAAATTGGTACGGAATTGGAAGCTTTAGCTGCCCGCACCATTGCCGAACGGGGAGTGCAGTTGGTGGGCACAGCCCACGGTAACCGTCTAGAAAATTTGATTAAAAATCCCACCCTTTCCGACCTGGTGGGGGGTATCCAAGCAGTGACTCTTGGGGATGAGGAAGCCCGGCGGCGGGGTTCCCAAAAAACTGTGCTGGAAAGGAAAGCTCCCCCGACTTTTTCCATGGCGGTGGAGATGTTGGAGCGGCAAAAATGGACTATCCACAGCGATGTGGCCTTGACCATTGATAATCTGTTGCGGGGCCGGCCTCCGGTGGAACAGTTGCGGTATATGAATGAGCAAGGGGAGCTACAAATCGAAACGGTGGAAGCCCAGCCCCAGGAAAGAACGCCCCAACCCCCTCCCTATTTTTCCTTGGGTTTAGTGGACGATCGACAGTTGCGCCCAAGACCTACGGGTTTACGTTCCACTGGGCGGATGAAACCCCAAGCTCCCCTCCATGCCAACGCTGACCAAGTGCGAGATTTTGAGCGGTTACTGGAGCAGTCCTGGCAACAGTGGGAAGGAGATGATGAACCAAAGATCCGGGTGCCGGGGCCCAACGGCGAAGATTTACCGGTTTATGTTTATCCCTATGGCGTCGGGCGATCGCAGTTAGACCAGGTGATTGATATCTTGCAATTACCGGTGGCGGTTACCAAGGATGTACACCAGGCCGATGCAGTGTTAGCCCTGCGTTCCCACGTCAAGGGCAACCAAAAATTACGACAGATGGCCAAGGGCATCCAGGTGCCTATTTATGGGGTTAAATCCAACACCATTCCCCAAATTAGCCGGGCCCTGAAACGGATTTTGGGCATGGATGAACCCCACAAAGCCGAAGCGGCGGATCTACGTTTGTTCACCCGCAGTGGCAGTAACGACGAATTGGAAGCGCTGGAGGAAGCCAGGTTAGCTGTGGAGCAAATTGTCATTCCCACAGGGCAACCGGTGGAGCTGCTACCCCGATCGCCCCATGTGCGGAAAATGCAACATGAACTGGTGGAACATTACCGTTTGCAGTCGGATAGCTTTGGCGATGAACCCAACCGTCGCCTAAGGATTTATCCTGCTTAG

Protein

MSELSLAHQDYPVDDLEQLLSILPKPIQAIIAEHPQRQQLVEVVMDLGRLPEARFPGTAVYLGHEPIAKEDLQYAIDRVGLFSSDNRAGIERTLHRISAIRNRTNEIIGLTCRVGRAVFGTINLIQDLVETGESLLLLGRPGVGKTTALREIARVLADDLHKRVVIIDTSNEIAGDGDIPHPAIGRARRMQVARPELQHQVMIEAVENHMPEVIVIDEIGTELEALAARTIAERGVQLVGTAHGNRLENLIKNPTLSDLVGGIQAVTLGDEEARRRGSQKTVLERKAPPTFSMAVEMLERQKWTIHSDVALTIDNLLRGRPPVEQLRYMNEQGELQIETVEAQPQERTPQPPPYFSLGLVDDRQLRPRPTGLRSTGRMKPQAPLHANADQVRDFERLLEQSWQQWEGDDEPKIRVPGPNGEDLPVYVYPYGVGRSQLDQVIDILQLPVAVTKDVHQADAVLALRSHVKGNQKLRQMAKGIQVPIYGVKSNTIPQISRALKRILGMDEPHKAEAADLRLFTRSGSNDELEALEEARLAVEQIVIPTGQPVELLPRSPHVRKMQHELVEHYRLQSDSFGDEPNRRLRIYPA