Your browser is old and dusty. Try Google Chrome!

Details for slr0688

ORF slr0688
Accession NP_440297.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -172 -186 1.96621 0.179
NP_441061.1_2 Reverse -265 -279 1.27789 0.192
NP_441061.1_2 Forward -248 -234 -1.8687 0.274
NP_440557.1_1 Reverse -187 -206 3.24438 0.211
NP_440557.1_1 Reverse -130 -149 0.884433 0.265
NP_440795.1_7 Forward -345 -338 12.2322 0.0614
NP_440795.1_7 Forward -233 -226 6.43063 0.265
NP_441418.1_6 Forward -249 -230 -21.4367 0.149
NP_441418.1_6 Forward -285 -266 -29.1065 0.216
NP_441418.1_6 Forward -189 -170 -30.6798 0.291
NP_440897.1_6 Forward -156 -137 -1.57461 0.193
NP_440897.1_6 Forward -31 -12 -3.93454 0.259
NP_441453.1_4 Forward -346 -338 6.90259 0.121
NP_441453.1_4 Reverse -337 -345 5.82095 0.126
NP_441453.1_4 Reverse -361 -369 4.64098 0.257
NP_442151.1_6 Forward -186 -172 9.14437 0.157
NP_442151.1_6 Forward -346 -332 5.70279 0.266
NP_440561.1_1 Forward -333 -314 11.5033 0.249
NP_441818.1_9 Forward -330 -311 6.68596 0.139
NP_441818.1_9 Forward -282 -263 -0.885524 0.196
NP_441818.1_9 Forward -189 -170 -5.31042 0.253
NP_441818.1_9 Reverse -150 -169 -7.57203 0.272
NP_441818.1_9 Reverse -144 -163 -8.65367 0.279
NP_440226.1_1 Reverse -337 -356 5.80098 0.145
NP_440226.1_1 Forward -346 -327 3.34271 0.229
NP_442623.1_3 Reverse -29 -48 -2.36049 0.127
NP_442655.1_2 Reverse -209 -228 8.45592 0.134
NP_442655.1_10 Forward -279 -260 -12.8819 0.266
NP_442173.1_1 Reverse -338 -346 6.01761 0.2
NP_442752.1_4 Reverse -240 -247 5.44732 0.202
NP_442752.1_4 Reverse -361 -368 4.26735 0.293
NP_441745.1_3 Forward -288 -269 16.6165 0.211
NP_441812.1_3 Forward -38 -24 7.27608 0.282
NP_442975.1_10 Forward -374 -360 7.17714 0.142
NP_442975.1_10 Forward -350 -336 1.67063 0.293
NP_441225.1_4 Reverse -305 -324 -12.0953 0.284
NP_440784.1_7 Forward -345 -338 6.23397 0.241
NP_440784.1_7 Reverse -338 -345 6.23397 0.241
NP_440110.1_8 Reverse -223 -242 -2.95047 0.284
NP_441054.1_2 Reverse -342 -361 14.0608 0.172
NP_441054.1_3 Forward -200 -182 15.9395 0.237
NP_441054.1_4 Reverse -351 -369 9.95058 0.0619
NP_439979.1_2 Reverse -177 -196 9.24257 0.238
NP_439979.1_2 Forward -249 -230 5.99764 0.292
NP_439979.1_7 Reverse -182 -199 14.1985 0.267
NP_442062.1_8 Reverse -240 -250 6.17489 0.136
NP_440304.1_4 Reverse -238 -248 7.35486 0.118
NP_442242.1_4 Reverse -338 -345 11.8388 0.0776
NP_442242.1_4 Reverse -362 -369 9.87221 0.2
NP_440044.1_8 Reverse -73 -92 -0.885524 0.231
NP_441925.1_4 Reverse -257 -276 -14.6526 0.263
NP_440856.1_7 Forward -282 -263 -3.73712 0.202
NP_440856.1_7 Forward -249 -230 -3.73712 0.202
NP_440856.1_7 Reverse -264 -283 -9.63698 0.294
NP_441083.1_5 Forward -346 -336 0.766681 0.218
NP_441083.1_5 Reverse -337 -347 0.275027 0.237
NP_439957.1_6 Forward -278 -259 11.3075 0.178
NP_441738.1_2 Forward -247 -240 10.2652 0.101
NP_441558.1_5 Forward -348 -329 7.7676 0.17
NP_440209.1_1 Forward -346 -338 8.27922 0.0687
NP_440209.1_1 Reverse -337 -345 5.42762 0.105
NP_440209.1_1 Reverse -361 -369 5.13263 0.17
NP_442889.1_8 Forward -349 -335 9.83206 0.0943
NP_440447.1_5 Forward -240 -230 11.7798 0.291
NP_441713.1_1 Reverse -355 -374 -6.09707 0.117
NP_442570.1_3 Reverse -248 -267 -9.53865 0.299
NP_442570.1_3 Reverse -295 -314 -9.63698 0.3
NP_441716.1_1 Reverse -225 -239 3.24451 0.272
NP_441327.1_1 Reverse -46 -65 12.4788 0.184
NP_442111.1_4 Reverse -336 -350 11.111 0.0515
NP_440343.1_3 Reverse -257 -275 5.42659 0.257
NP_440906.1_5 Reverse -338 -345 12.0355 0.0724
NP_440906.1_5 Reverse -362 -369 8.20058 0.19
NP_440906.1_5 Forward -345 -338 6.0373 0.262
NP_441209.1_8 Reverse -40 -58 14.012 0.12
NP_442801.1_3 Reverse -340 -353 19.9896 0.0917
NP_440747.1_1 Reverse -226 -244 6.70565 0.258
NP_440747.1_10 Reverse -334 -346 -4.58258 0.109
NP_440747.1_10 Forward -349 -337 -12.2524 0.254
NP_440747.1_10 Forward -252 -240 -12.3507 0.27
NP_441014.1_8 Forward -42 -23 -9.44032 0.295
NP_441014.1_8 Reverse -173 -192 -9.73531 0.299
NP_441012.1_4 Reverse -266 -279 9.36073 0.272
NP_443018.1_3 Reverse -172 -179 8.20058 0.153
NP_443018.1_3 Forward -42 -35 7.6106 0.156
NP_443018.1_3 Reverse -338 -345 5.84064 0.174
NP_443018.1_3 Forward -345 -338 5.54565 0.187
NP_440376.1_1 Reverse -337 -346 7.76787 0.0688
NP_440376.1_1 Reverse -240 -249 3.7363 0.195
NP_440376.1_1 Forward -346 -337 -0.0986038 0.285
NP_443065.1_1 Reverse -154 -173 17.699 0.266
NP_442687.1_7 Reverse -360 -370 10.2065 0.0994
NP_442687.1_7 Reverse -263 -273 7.64985 0.127
NP_442687.1_7 Forward -174 -164 4.69992 0.238
NP_442191.1_4 Forward -327 -313 11.0901 0.271
NP_442485.1_3 Forward -318 -299 3.34271 0.201
NP_442530.1_2 Forward -82 -72 10.7964 0.292
NP_441029.1_8 Reverse -267 -286 14.3549 0.242
NP_442658.1_1 Forward -251 -241 9.12434 0.167
NP_442658.1_1 Forward -348 -338 4.89613 0.292
NP_442198.1_7 Forward -36 -17 20.1564 0.055
NP_440656.1_8 Forward -146 -127 -9.53865 0.288
NP_441414.1_9 Forward -346 -327 -1.7705 0.105
NP_441414.1_9 Reverse -34 -53 -7.96535 0.227
NP_441256.1_1 Reverse -177 -196 6.19431 0.115
NP_441256.1_1 Reverse -273 -292 -5.40875 0.233
NP_441256.1_1 Reverse -264 -283 -5.40875 0.233
NP_441958.1_5 Forward -347 -337 2.24165 0.0502
NP_441127.1_1 Forward -267 -253 10.3243 0.251
NP_440318.1_1 Forward -49 -30 6.39097 0.218
NP_442486.1_6 Reverse -264 -283 -6.58872 0.296
NP_440203.1_5 Reverse -174 -184 9.12434 0.271
NP_440203.1_5 Forward -246 -236 8.82935 0.283
NP_439905.1_1 Reverse -172 -185 8.67241 0.232
NP_439905.1_1 Forward -42 -29 7.78743 0.244
NP_440153.1_8 Reverse -264 -277 -1.94734 0.23
NP_443055.1_6 Reverse -256 -274 -2.14486 0.29
NP_442236.1_3 Reverse -216 -235 6.4893 0.284
NP_442853.1_5 Reverse -311 -330 6.39016 0.287
NP_441099.1_5 Forward -244 -225 -6.68705 0.165
NP_441099.1_5 Reverse -327 -346 -8.26035 0.191
NP_441294.1_7 Reverse -167 -181 10.4985 0.185
NP_441646.1_1 Forward -256 -237 -0.197208 0.259
NP_442431.1_10 Forward -192 -174 9.95058 0.121
NP_442431.1_10 Forward -279 -261 6.01734 0.195
NP_442431.1_10 Forward -318 -300 4.05072 0.211
NP_442431.1_10 Reverse -144 -162 4.05072 0.211
NP_442431.1_10 Reverse -237 -255 3.85406 0.213
NP_442431.1_10 Forward -285 -267 2.37909 0.238
NP_442431.1_10 Forward -276 -258 0.510803 0.273
NP_441000.1_5 Forward -365 -346 10.815 0.214
NP_440147.1_4 Forward -372 -359 7.6891 0.064
NP_440147.1_4 Forward -348 -335 -0.570702 0.291
NP_440147.1_4 Reverse -335 -348 -0.767364 0.299
NP_441550.1_8 Forward -348 -338 6.17443 0.214
NP_441916.1_7 Reverse -337 -347 7.64985 0.0626
NP_441916.1_7 Reverse -361 -371 4.0116 0.193
NP_440465.1_7 Reverse -265 -283 16.6363 0.177
NP_441041.1_4 Forward -346 -327 -0.885524 0.0986
NP_441041.1_4 Forward -195 -176 -7.76869 0.192
NP_441041.1_4 Reverse -144 -163 -13.3736 0.285
NP_441041.1_7 Forward -252 -240 6.93171 0.185
NP_441547.1_2 Reverse -61 -79 3.65739 0.279
NP_442004.1_6 Reverse -361 -375 2.85119 0.255
NP_440703.1_9 Forward -228 -215 5.42692 0.293
NP_441725.1_4 Forward -351 -337 11.012 0.0977
NP_439966.1_7 Forward -251 -241 12.2709 0.0464
NP_439966.1_7 Forward -348 -338 4.69947 0.263
NP_439966.1_9 Reverse -359 -368 1.1797 0.253
NP_442941.1_3 Reverse -338 -348 9.51814 0.0306
NP_442941.1_3 Reverse -67 -77 2.83163 0.14
NP_441514.1_1 Reverse -325 -335 15.109 0.274
NP_441514.1_6 Forward -119 -112 12.8221 0.252
NP_442281.1_1 Forward -254 -240 5.70218 0.15
NP_441334.1_7 Forward -251 -232 -20.8467 0.281
NP_442012.1_1 Reverse -355 -374 2.3594 0.202
NP_441556.1_4 Forward -153 -134 9.61947 0.297
NP_440375.1_8 Forward -179 -160 5.80098 0.174
NP_441644.1_6 Forward -43 -33 8.73102 0.0944
NP_441644.1_6 Reverse -337 -347 7.15773 0.133
NP_441644.1_6 Forward -189 -179 6.66608 0.152
NP_441644.1_6 Forward -346 -336 4.20782 0.245
NP_441644.1_6 Reverse -171 -181 3.32285 0.288
NP_442215.1_2 Reverse -223 -239 -6.7263 0.278
NP_440929.1_9 Reverse -92 -106 12.4876 0.298
NP_442933.1_10 Reverse -361 -370 4.32629 0.257
NP_442554.1_8 Reverse -338 -348 8.1415 0.0785
NP_442554.1_9 Reverse -143 -162 15.0757 0.227
NP_441762.1_7 Forward -371 -359 -5.27089 0.195
NP_441762.1_7 Forward -347 -335 -7.23751 0.286
NP_442142.1_4 Reverse -273 -286 8.77016 0.108
NP_442142.1_4 Forward -153 -140 7.88518 0.127
NP_442142.1_4 Reverse -177 -190 6.50855 0.163
NP_442142.1_4 Reverse -334 -347 5.0336 0.204
NP_442142.1_4 Reverse -264 -277 4.44361 0.222
NP_442142.1_4 Forward -46 -33 2.57534 0.286
NP_442292.1_1 Reverse -338 -347 7.76787 0.0615
NP_442292.1_1 Forward -345 -336 -0.000272808 0.239
NP_439989.1_7 Forward -193 -176 17.4434 0.282
NP_441711.1_4 Reverse -231 -250 3.83436 0.232
NP_443009.1_5 Reverse -239 -250 5.07306 0.218
NP_443009.1_5 Forward -371 -360 3.69644 0.282
NP_442301.1_2 Forward -166 -147 4.22689 0.281
NP_442408.2_1 Forward -249 -230 0.196116 0.202
NP_441715.1_4 Reverse -338 -348 7.35486 0.108
NP_440357.1_3 Reverse -262 -281 3.93269 0.242
NP_441448.1_1 Reverse -265 -284 4.12936 0.279
NP_441448.1_1 Forward -284 -265 3.6377 0.292
NP_440158.1_8 Reverse -133 -152 12.7825 0.222
NP_441198.1_8 Reverse -238 -248 12.5877 0.12
NP_440379.1_5 Forward -322 -303 4.42435 0.136
NP_440379.1_5 Forward -204 -185 -2.36049 0.198
NP_440464.1_10 Forward -74 -64 12.1487 0.253
NP_441468.1_1 Reverse -338 -345 6.43063 0.175
NP_441468.1_1 Forward -345 -338 6.0373 0.223
NP_441020.2_6 Reverse -238 -255 9.28195 0.176
NP_441015.1_10 Forward -185 -166 2.65439 0.149
NP_441015.1_10 Forward -191 -172 -2.16383 0.178
NP_441015.1_10 Forward -278 -259 -10.0303 0.282
NP_441673.1_1 Forward -346 -337 1.27803 0.155
NP_441673.1_1 Reverse -337 -346 1.27803 0.155
NP_442757.1_7 Forward -193 -174 12.5858 0.221
NP_441172.1_1 Reverse -171 -189 12.6055 0.0404
NP_442811.1_2 Forward -287 -268 8.65258 0.138
NP_442490.1_9 Reverse -219 -238 -4.13045 0.258
NP_442868.1_6 Forward -251 -241 3.81494 0.192
NP_442868.1_6 Forward -348 -338 0.766681 0.209
NP_442868.1_6 Reverse -335 -345 -0.216628 0.273
NP_442677.1_7 Reverse -311 -321 17.2863 0.27
NP_441612.1_2 Reverse -66 -76 9.22698 0.21
NP_442227.1_2 Reverse -263 -282 6.19431 0.201
NP_442227.1_2 Reverse -266 -285 0.196116 0.252
NP_442227.1_2 Forward -250 -231 -0.0988766 0.253
NP_442227.1_2 Forward -251 -232 -3.3438 0.29
NP_442427.1_8 Forward -355 -336 7.86593 0.203
NP_442808.1_1 Reverse -336 -346 7.45273 0.0783
NP_442808.1_1 Forward -250 -240 6.76441 0.0982
NP_442808.1_1 Forward -251 -241 1.15957 0.292
NP_442775.1_1 Forward -251 -232 13.5691 0.274
NP_442692.1_1 Forward -41 -22 -4.6221 0.274
NP_442050.1_5 Forward -348 -338 11.8776 0.0802
NP_440558.1_2 Forward -231 -212 -3.24547 0.234
NP_440558.1_2 Reverse -300 -319 -6.98204 0.284
NP_442789.1_4 Reverse -196 -215 -3.73712 0.252
NP_442789.1_5 Forward -191 -172 8.94757 0.21
NP_441878.1_6 Reverse -336 -346 -7.59145 0.245
NP_441534.1_5 Reverse -38 -57 9.73422 0.18
NP_441557.1_5 Forward -346 -337 0.983037 0.0911
NP_441557.1_5 Reverse -337 -346 0.688044 0.128
NP_441557.1_5 Reverse -361 -370 -0.885252 0.26
NP_441445.1_1 Forward -285 -266 1.47442 0.255
NP_441445.1_1 Forward -189 -170 -0.197208 0.286
NP_441590.1_3 Forward -205 -186 10.7175 0.205
NP_441433.1_8 Forward -32 -13 -3.73712 0.283
NP_441739.1_2 Reverse -108 -124 12.7425 0.132
NP_442830.1_5 Forward -251 -237 12.487 0.168
NP_441407.1_7 Forward -239 -221 11.5239 0.264
NP_440356.1_10 Reverse -260 -278 11.2289 0.253
NP_441459.1_3 Reverse -261 -280 11.8134 0.283
NP_441574.1_1 Reverse -213 -232 -3.14714 0.236
NP_442347.1_2 Forward -74 -65 5.80125 0.219
NP_441037.1_4 Reverse -359 -369 5.95329 0.289
NP_442594.1_8 Forward -192 -173 2.55606 0.295
NP_441633.1_3 Forward -251 -238 -2.53732 0.177
NP_440136.1_2 Reverse -241 -248 11.1505 0.0519
NP_440136.1_2 Reverse -338 -345 6.52896 0.116
NP_440136.1_2 Forward -345 -338 6.13563 0.193
NP_442998.1_2 Reverse -265 -284 8.06178 0.224
NP_442998.1_5 Reverse -40 -50 11.1898 0.191
NP_442998.1_10 Forward -368 -361 13.5105 0.0225
NP_442998.1_10 Reverse -339 -346 12.5271 0.0457
NP_442998.1_10 Reverse -74 -81 4.16902 0.259
NP_441799.1_1 Reverse -167 -181 4.32555 0.255
NP_441799.1_1 Reverse -333 -347 3.93223 0.274
NP_441799.1_4 Reverse -172 -191 5.30933 0.0864
NP_441007.1_10 Forward -278 -265 7.00078 0.152
NP_441007.1_10 Forward -185 -172 0.412608 0.23
NP_441449.1_8 Forward -203 -184 13.0173 0.298
NP_440256.1_1 Reverse -334 -353 -0.885524 0.0979
NP_440256.1_1 Forward -84 -65 -10.0303 0.293
NP_441559.1_8 Forward -254 -240 -4.03198 0.215
NP_441559.1_8 Forward -37 -23 -7.76856 0.299
NP_441270.1_5 Reverse -137 -156 14.6533 0.211
NP_441179.1_9 Reverse -274 -284 16.6958 0.236
NP_441296.1_9 Forward -249 -236 9.5568 0.277
NP_442452.1_3 Forward -134 -115 0.294447 0.298
NP_442866.1_1 Reverse -124 -143 -4.52377 0.228
NP_440748.1_1 Forward -269 -250 15.2408 0.255
NP_440748.1_5 Reverse -183 -202 -1.18052 0.267
NP_440306.1_8 Forward -57 -38 13.8633 0.104
NP_441939.1_3 Reverse -338 -357 7.7676 0.19
NP_441494.1_6 Reverse -235 -248 9.2624 0.227
NP_442386.1_9 Forward -250 -241 11.209 0.0993
NP_442386.1_9 Reverse -336 -345 6.39082 0.219
NP_441750.1_4 Reverse -264 -283 3.34271 0.233
NP_441340.1_5 Reverse -338 -345 13.2155 0.0437
NP_441340.1_5 Forward -345 -338 6.13563 0.175
NP_442484.1_2 Reverse -326 -345 -1.67217 0.295
NP_440168.1_9 Reverse -211 -230 -5.70374 0.296
NP_442240.1_1 Forward -323 -304 5.60352 0.264
NP_440586.1_8 Reverse -172 -179 9.08521 0.178
NP_441262.1_3 Reverse -361 -368 5.25066 0.215
NP_440027.1_3 Reverse -171 -189 7.09821 0.214
NP_440027.1_3 Reverse -303 -321 4.34495 0.262
NP_440027.1_3 Forward -43 -25 4.04996 0.262
NP_440027.1_8 Reverse -334 -353 12.4867 0.205
NP_443051.1_1 Forward -347 -338 9.73449 0.0265
NP_443051.1_1 Reverse -239 -248 -0.000272808 0.245
NP_439996.1_6 Forward -190 -171 13.0637 0.169
NP_439996.1_6 Forward -286 -267 8.98225 0.242
NP_439937.1_9 Forward -371 -354 -16.8747 0.289
NP_440439.1_1 Reverse -237 -250 2.77255 0.128
NP_440439.1_1 Reverse -358 -371 0.215946 0.199
NP_442239.1_8 Reverse -143 -162 10.3242 0.245
NP_440372.1_2 Reverse -338 -345 6.62729 0.151
NP_440372.1_2 Forward -345 -338 6.52896 0.188
NP_440316.1_10 Forward -347 -337 12.8614 0.214
NP_440316.1_10 Reverse -33 -43 7.84651 0.245
NP_442663.1_1 Forward -87 -68 1.86696 0.244
NP_439977.1_10 Forward -180 -161 15.5357 0.218
NP_440267.1_2 Forward -54 -40 4.62054 0.3
NP_441018.1_3 Reverse -139 -158 20.4514 0.183
NP_441018.1_7 Reverse -215 -234 6.39097 0.289
NP_442262.1_10 Reverse -338 -345 10.4622 0.145
NP_442262.1_10 Reverse -172 -179 9.38056 0.202
NP_442262.1_10 Forward -42 -35 8.8889 0.219
NP_440163.1_10 Forward -192 -182 13.4514 0.125
NP_440163.1_10 Forward -288 -278 10.7964 0.193
NP_440282.1_10 Reverse -266 -285 -7.27704 0.251
NP_440531.1_6 Reverse -232 -251 -3.54046 0.268
NP_440189.1_2 Forward -378 -359 -0.983855 0.294
NP_440189.1_10 Reverse -215 -234 2.94938 0.289
NP_441965.1_7 Reverse -172 -191 11.6017 0.285
NP_442693.1_6 Forward -250 -231 4.916 0.278
NP_440297.1_4 Forward -329 -310 18.3873 0.0538
NP_440297.1_8 Forward -235 -217 21.652 0.0498
NP_442187.1_3 Forward -190 -180 13.5497 0.245
NP_440894.1_10 Reverse -169 -188 3.73603 0.266
NP_440999.1_9 Reverse -176 -190 -1.77037 0.249
NP_440999.1_9 Reverse -315 -329 -2.95034 0.281
NP_440999.1_9 Forward -253 -239 -3.34366 0.291
NP_440888.1_2 Forward -43 -29 11.4053 0.0681
NP_440888.1_2 Reverse -225 -239 10.6187 0.0893
NP_440052.1_8 Forward -284 -265 17.404 0.0498
NP_442033.1_10 Forward -251 -232 -6.49039 0.186
NP_442818.1_1 Forward -228 -209 6.58682 0.0796
NP_441543.1_2 Reverse -338 -347 12.8811 0.0311
NP_441543.1_2 Forward -369 -360 7.17789 0.131
NP_441543.1_2 Forward -345 -336 5.80125 0.174
NP_442845.1_2 Forward -186 -172 9.5377 0.174
NP_441304.1_10 Forward -119 -110 13.0777 0.255
NP_441469.1_8 Forward -250 -241 12.6844 0.0995
NP_442315.1_1 Forward -281 -263 19.0954 0.0539
NP_442315.1_1 Reverse -211 -229 4.14905 0.28
NP_443064.1_6 Reverse -249 -259 8.59164 0.278
NP_442578.1_7 Reverse -338 -345 11.3472 0.102
NP_441462.1_2 Reverse -337 -347 0.668351 0.135
NP_441462.1_2 Reverse -361 -371 0.0783647 0.168
NP_441462.1_2 Forward -346 -336 -0.511621 0.236
NP_440668.1_4 Forward -95 -76 14.3558 0.0807
NP_441601.1_2 Reverse -165 -184 -3.24547 0.28
NP_440519.1_6 Forward -48 -34 22.714 0.0102
NP_440519.1_6 Reverse -166 -180 10.4227 0.29
NP_440519.1_8 Forward -189 -173 2.02515 0.269
NP_442204.1_1 Reverse -30 -41 1.04198 0.281
NP_440255.1_5 Forward -124 -110 16.6272 0.225
NP_442780.1_3 Reverse -42 -61 6.15881 0.269
NP_442537.1_3 Reverse -81 -100 14.4541 0.239
NP_440516.1_8 Forward -346 -337 9.14451 0.0354
NP_440516.1_8 Reverse -34 -43 -0.491928 0.262
NP_440516.1_8 Reverse -240 -249 -0.590259 0.283
NP_442428.1_5 Reverse -338 -345 6.52896 0.109
NP_442428.1_5 Forward -345 -338 6.0373 0.212
NP_441032.1_5 Reverse -171 -190 10.8159 0.245
NP_441443.1_10 Reverse -305 -323 8.3765 0.193
NP_440673.1_2 Forward -317 -298 9.12141 0.257
NP_440673.1_3 Forward -41 -34 8.98723 0.203
NP_440673.1_7 Reverse -229 -248 4.62101 0.185
NP_441052.1_2 Forward -346 -336 6.96153 0.0836
NP_441052.1_2 Reverse -225 -235 3.22496 0.182
NP_441052.1_2 Reverse -276 -286 2.33998 0.209
NP_441052.1_2 Reverse -337 -347 1.455 0.244
NP_441052.1_2 Forward -249 -239 -0.314959 0.273
NP_442219.1_9 Forward -345 -336 8.55452 0.0681
NP_440436.1_4 Forward -369 -360 5.30919 0.209
NP_441884.1_8 Forward -250 -231 -9.63698 0.268
NP_441884.1_9 Forward -252 -233 -22.8133 0.284
NP_442864.1_2 Forward -155 -136 11.7008 0.251
NP_441719.1_4 Reverse -338 -345 6.62729 0.151
NP_441719.1_4 Forward -345 -338 6.52896 0.188
NP_441719.1_6 Forward -45 -26 4.91521 0.296
NP_441004.1_1 Forward -282 -263 -12.2919 0.245
NP_441004.1_1 Forward -93 -74 -15.2418 0.273
NP_441004.1_1 Forward -318 -299 -17.7001 0.294
NP_441004.1_2 Forward -323 -304 5.50599 0.193
NP_441004.1_2 Forward -275 -256 -3.73712 0.283
NP_441004.1_3 Forward -273 -254 16.8141 0.0487
NP_441004.1_3 Reverse -210 -229 2.45773 0.266
NP_441004.1_5 Forward -331 -317 8.45605 0.274
NP_442139.1_7 Forward -281 -262 13.8641 0.167
NP_440296.1_6 Reverse -47 -65 16.9996 0.282
NP_441115.1_2 Forward -396 -377 6.88182 0.283
NP_442694.1_4 Reverse -78 -87 15.241 0.164
NP_442206.1_1 Reverse -264 -283 -14.4552 0.27
NP_443054.1_2 Reverse -302 -316 0.491246 0.262
NP_442001.1_8 Forward -113 -94 16.5191 0.148
NP_442622.1_8 Forward -249 -231 -18.8604 0.285
NP_441273.1_5 Reverse -248 -266 13.6864 0.299
NP_442515.1_1 Forward -174 -160 2.5562 0.133
NP_442515.1_1 Reverse -336 -350 1.76955 0.149
NP_442515.1_1 Forward -232 -218 1.17956 0.168
NP_442515.1_1 Forward -145 -131 -4.32697 0.298
NP_441396.1_5 Forward -239 -230 15.1427 0.205
NP_440593.1_3 Reverse -109 -128 -4.13045 0.245
NP_441409.1_6 Reverse -331 -350 -14.1602 0.252
NP_441409.1_8 Forward -225 -206 10.4871 0.22
NP_442314.1_3 Reverse -30 -44 13.8643 0.277
NP_440432.1_9 Reverse -338 -353 -5.32998 0.245
NP_442843.1_1 Reverse -232 -251 -3.83545 0.23
NP_440474.1_8 Reverse -299 -313 6.19383 0.23
NP_440431.1_3 Forward -371 -352 -10.3253 0.275
NP_441031.1_8 Reverse -181 -200 5.30933 0.177
NP_443047.1_7 Reverse -257 -276 9.93088 0.188
NP_441570.1_1 Forward -249 -231 -9.32229 0.134
NP_441570.1_1 Reverse -240 -258 -17.7788 0.291
NP_440078.1_10 Reverse -225 -244 3.53937 0.262
NP_441078.1_4 Forward -346 -337 8.35786 0.0338
NP_441078.1_4 Reverse -337 -346 7.27622 0.0764
NP_441078.1_4 Forward -370 -361 -1.37691 0.254
NP_441078.1_4 Forward -249 -240 -1.96689 0.282
NP_442729.1_5 Forward -190 -180 15.3197 0.199
NP_442729.1_5 Forward -286 -276 7.94484 0.254
NP_442388.1_4 Forward -220 -201 12.88 0.23
NP_440539.1_9 Forward -97 -78 -0.4922 0.286
NP_442443.1_1 Forward -320 -301 16.7157 0.0541
NP_441094.1_3 Reverse -31 -48 14.2968 0.117
NP_441432.1_8 Forward -347 -338 15.536 0.00916
NP_441432.1_8 Reverse -33 -42 12.2911 0.0444
NP_441432.1_9 Reverse -53 -66 10.6345 0.245
NP_443024.1_3 Forward -267 -257 10.7964 0.289
NP_442320.1_8 Forward -352 -338 -2.26202 0.0871
NP_441732.1_2 Forward -374 -358 -7.70961 0.0885
NP_440497.1_2 Forward -281 -262 8.75091 0.208
NP_440497.1_2 Forward -248 -229 7.57094 0.23
NP_440629.1_4 Forward -339 -320 10.0292 0.241
NP_440760.1_1 Forward -346 -327 -23.4033 0.297
NP_440578.1_10 Reverse -127 -146 8.55425 0.289
NP_441057.1_4 Forward -190 -172 8.37728 0.147
NP_442353.1_4 Reverse -28 -47 -1.08295 0.298
NP_442727.1_1 Reverse -185 -199 10.816 0.297
NP_442751.1_2 Reverse -266 -285 4.12856 0.261
NP_440713.1_4 Forward -244 -225 14.6508 0.0861
NP_440713.1_4 Reverse -182 -201 2.94938 0.254
NP_442489.1_2 Reverse -326 -345 7.57094 0.172
NP_442489.1_7 Reverse -337 -346 1.08137 0.109
NP_442489.1_7 Forward -346 -337 0.589713 0.17
NP_442489.1_7 Reverse -240 -249 -1.86856 0.259
NP_441659.2_8 Reverse -337 -347 1.65166 0.233
NP_441659.2_8 Reverse -171 -181 1.16001 0.248
NP_441659.2_8 Reverse -264 -274 0.275027 0.27
NP_441800.1_7 Reverse -172 -190 8.37728 0.113
NP_441800.1_7 Reverse -259 -277 -0.374176 0.226
NP_442346.1_2 Reverse -160 -179 5.30933 0.281
NP_442346.1_5 Reverse -297 -307 4.50326 0.286
NP_442346.1_5 Forward -82 -72 4.20827 0.296
NP_440545.1_3 Forward -374 -357 -5.95935 0.265
NP_440025.1_3 Reverse -6 -20 16.9036 0.11
NP_440486.1_6 Forward -94 -75 7.7676 0.26
NP_441126.1_8 Reverse -237 -250 6.1158 0.291
NP_440250.1_4 Reverse -284 -303 2.35861 0.288
NP_440010.1_4 Forward -289 -270 11.7983 0.157
NP_440010.1_4 Reverse -263 -282 6.29183 0.199
NP_440010.1_4 Forward -283 -264 2.35861 0.225
NP_440010.1_4 Reverse -269 -288 -0.787962 0.262
NP_440010.1_4 Forward -160 -141 -3.14789 0.294
NP_440010.1_10 Forward -288 -269 10.9142 0.209
NP_442603.1_7 Reverse -225 -239 8.55376 0.171
NP_442603.1_9 Forward -241 -223 8.67227 0.214
NP_441888.1_7 Forward -254 -240 1.27789 0.258
NP_441050.1_5 Reverse -357 -375 -2.73412 0.284
NP_440170.1_3 Forward -197 -178 5.11266 0.281
NP_441833.1_4 Reverse -338 -345 6.23397 0.163
NP_441833.1_4 Forward -345 -338 6.13563 0.198
NP_441895.1_10 Forward -289 -270 -27.8282 0.299
NP_442162.1_9 Reverse -338 -345 6.62729 0.142
NP_442162.1_9 Forward -345 -338 6.43063 0.208
NP_442199.1_5 Forward -354 -335 -1.37718 0.18
NP_442140.1_3 Forward -345 -335 4.3066 0.248
NP_442021.1_3 Reverse -219 -238 -0.4922 0.251
NP_441813.1_5 Forward -348 -338 8.33817 0.047
NP_441813.1_5 Forward -251 -241 -0.118297 0.234
NP_441813.1_7 Reverse -264 -278 11.7003 0.215
NP_442028.1_1 Reverse -129 -142 11.6163 0.251
NP_440590.1_4 Forward -369 -356 1.59258 0.118
NP_440590.1_4 Forward -42 -29 -5.97891 0.296
NP_442497.1_10 Reverse -338 -347 7.86621 0.0695
NP_440821.1_4 Reverse -359 -369 -0.806614 0.296
NP_442568.1_8 Forward -65 -51 8.75105 0.28
NP_441892.1_1 Reverse -231 -248 0.137172 0.173
NP_440665.1_1 Reverse -225 -244 6.78429 0.107
NP_440665.1_1 Reverse -180 -199 -2.45882 0.177
NP_440665.1_1 Forward -201 -182 -7.4737 0.224
NP_442044.1_1 Forward -375 -356 -14.3569 0.289
NP_442193.1_1 Forward -285 -267 7.98396 0.277
NP_440740.1_2 Reverse -196 -215 25.3688 0.00598
NP_442216.1_4 Reverse -110 -118 8.1805 0.255
NP_440212.1_5 Forward -48 -29 13.3725 0.273
NP_440546.1_4 Reverse -361 -371 10.3369 0.109
NP_440546.1_4 Reverse -337 -347 8.00989 0.209
NP_440546.1_4 Forward -346 -336 8.00989 0.209
NP_440546.1_6 Forward -380 -361 9.3409 0.247
NP_440462.1_4 Forward -283 -269 5.70279 0.29
NP_440462.1_6 Forward -348 -338 8.92815 0.0537
NP_440462.1_6 Reverse -238 -248 7.84651 0.0699
NP_440868.1_4 Forward -184 -172 5.15219 0.104
NP_440868.1_4 Reverse -357 -369 2.20226 0.161
NP_440868.1_4 Reverse -333 -345 -0.256015 0.255
NP_440868.1_4 Forward -253 -241 -0.944332 0.284
NP_441474.1_1 Reverse -266 -285 12.0933 0.18
NP_440812.1_4 Forward -94 -75 13.9592 0.25
NP_442402.1_4 Forward -57 -38 -9.14605 0.285
NP_442402.1_10 Forward -49 -39 11.3859 0.257
NP_441084.1_6 Forward -348 -334 10.0228 0.255
NP_442039.1_4 Reverse -338 -345 12.1338 0.063
NP_442039.1_7 Forward -271 -261 7.05986 0.283
NP_441811.1_8 Forward -186 -172 7.76774 0.241
NP_442679.1_1 Forward -33 -14 -4.81876 0.286
NP_442380.1_10 Forward -190 -172 14.5721 0.177
NP_442837.1_3 Reverse -338 -345 6.0373 0.25
NP_442837.1_3 Forward -345 -338 5.93897 0.265
NP_442053.1_1 Forward -346 -337 7.76787 0.0895
NP_442053.1_1 Reverse -337 -346 6.48957 0.13
NP_442053.1_1 Reverse -240 -249 4.42462 0.249
NP_440505.1_3 Reverse -238 -248 11.5831 0.0735
NP_440505.1_3 Reverse -359 -369 11.3864 0.0778
NP_440505.1_3 Forward -348 -338 7.84651 0.147
NP_440505.1_3 Reverse -32 -42 6.07655 0.197
NP_440914.1_1 Forward -249 -239 11.2501 0.103
NP_440914.1_1 Reverse -34 -44 9.00547 0.186
NP_440914.1_1 Forward -346 -336 6.85846 0.263
NP_440914.1_1 Forward -227 -217 6.46809 0.279
NP_441011.1_8 Reverse -338 -347 6.98123 0.18
NP_442533.1_1 Forward -282 -263 -5.50708 0.155
NP_442533.1_3 Forward -76 -58 17.4772 0.186
NP_442232.1_9 Reverse -35 -54 15.0432 0.224
NP_442322.1_4 Forward -252 -235 -2.91177 0.237
NP_441482.1_7 Forward -352 -338 -5.11362 0.172
NP_441028.1_6 Forward -48 -38 7.35439 0.229
NP_440116.1_4 Reverse -211 -230 12.4875 0.251
NP_440007.1_4 Forward -357 -338 21.0423 0.0466
NP_440007.1_9 Reverse -209 -223 2.16287 0.281
NP_441059.1_5 Forward -100 -81 8.06259 0.296
NP_441972.1_5 Forward -248 -229 -9.53865 0.288
NP_441972.1_5 Forward -260 -241 -10.1286 0.299
NP_441106.1_1 Forward -347 -338 8.65285 0.0522
NP_441106.1_1 Forward -371 -362 4.42462 0.226
NP_439903.1_6 Forward -52 -33 0.490334 0.261
NP_439903.1_6 Reverse -328 -347 -0.886293 0.287
NP_442588.1_1 Forward -192 -173 10.2259 0.208
NP_440444.1_6 Reverse -41 -54 16.5389 0.233
NP_441286.1_1 Reverse -140 -152 -2.71429 0.145
NP_441930.1_3 Forward -65 -46 2.67657 0.295
NP_440886.1_7 Reverse -263 -273 12.5659 0.0805
NP_440886.1_7 Forward -250 -240 12.5659 0.0805
NP_440886.1_7 Forward -347 -337 6.17443 0.141
NP_440828.1_4 Reverse -170 -189 -0.787962 0.19
NP_442614.1_2 Forward -346 -332 5.99778 0.295
NP_442614.1_2 Reverse -34 -48 5.80112 0.297
NP_442401.1_2 Reverse -360 -379 10.9134 0.171
NP_439899.1_2 Forward -308 -289 10.4225 0.183
NP_440907.2_8 Forward -248 -238 8.63269 0.117
NP_440907.2_8 Forward -369 -359 4.89613 0.235
NP_442264.1_2 Reverse -131 -148 7.11867 0.247
NP_441021.1_1 Forward -42 -23 -4.91709 0.172
NP_441021.1_1 Reverse -265 -284 -11.9969 0.279
NP_440841.1_4 Reverse -335 -354 3.93269 0.0964
NP_441463.1_2 Reverse -48 -66 0.466766 0.269
NP_441463.1_3 Forward -259 -240 -9.34199 0.278
NP_441463.1_6 Forward -293 -279 7.96207 0.25
NP_441626.1_2 Reverse -338 -345 14.2971 0.0271
NP_441626.1_2 Forward -345 -338 5.93897 0.231
NP_442794.1_1 Reverse -116 -128 5.05386 0.236
NP_442794.1_1 Reverse -188 -200 2.20226 0.299
NP_442615.1_1 Forward -355 -337 -3.71743 0.168
NP_440855.1_1 Forward -201 -182 11.3075 0.12
NP_441431.1_2 Reverse -358 -372 7.27547 0.244
NP_441174.1_4 Reverse -38 -48 9.81313 0.289
NP_440814.1_4 Reverse -328 -347 -12.0953 0.229
NP_440814.1_8 Forward -234 -215 1.47442 0.269
NP_442805.1_5 Forward -52 -33 -6.98278 0.297
NP_440114.1_10 Reverse -72 -86 11.701 0.106
NP_440114.1_10 Reverse -337 -351 7.66941 0.229
NP_440287.1_6 Reverse -328 -347 2.75272 0.228
NP_440293.1_9 Forward -239 -225 9.21831 0.286
NP_441237.1_9 Forward -345 -335 12.4681 0.12
NP_442743.1_5 Reverse -181 -200 3.04771 0.279
NP_441531.1_6 Reverse -228 -241 10.4424 0.254
NP_441531.1_6 Reverse -183 -196 10.049 0.254
NP_441133.1_1 Reverse -150 -169 15.5357 0.2
NP_439910.1_2 Reverse -329 -346 -14.1208 0.183
NP_440457.1_1 Forward -188 -176 1.21895 0.244
NP_442940.1_2 Reverse -303 -322 8.55425 0.167
NP_441332.1_6 Forward -250 -240 11.3563 0.261
NP_442509.1_9 Forward -258 -248 9.22267 0.192
NP_440524.1_3 Reverse -177 -196 8.94757 0.28
NP_442936.1_10 Reverse -42 -56 17.2073 0.216
NP_440554.1_4 Reverse -338 -348 8.23984 0.0804
NP_442862.1_3 Reverse -136 -153 4.46374 0.29
NP_442737.1_5 Forward -286 -267 11.6185 0.284
NP_441885.1_5 Forward -346 -336 10.5014 0.00946
NP_442341.1_9 Forward -348 -334 11.7987 0.118
NP_441173.1_9 Reverse -83 -91 11.0321 0.228
NP_443000.1_7 Forward -348 -338 10.5014 0.0345
NP_440507.2_3 Forward -243 -224 7.27514 0.283
NP_443059.1_10 Forward -167 -148 1.08032 0.245
NP_441842.1_1 Forward -368 -355 17.7182 0.0263
NP_441842.1_10 Reverse -233 -247 7.86607 0.241
NP_440275.1_3 Forward -348 -338 6.27322 0.118
NP_441902.1_3 Reverse -39 -49 11.524 0.298
NP_440679.1_2 Reverse -266 -284 21.1603 0.112
NP_440679.1_5 Forward -288 -269 6.88262 0.292
NP_440679.1_10 Forward -283 -264 -5.40875 0.161
NP_440679.1_10 Forward -289 -270 -12.9802 0.215
NP_440679.1_10 Forward -319 -300 -18.9784 0.279
NP_440679.1_10 Forward -193 -174 -20.8467 0.286
NP_442638.1_3 Forward -67 -48 10.3605 0.298
NP_441105.1_3 Forward -357 -338 3.73603 0.0873
NP_440216.1_1 Reverse -337 -351 -4.7203 0.114
NP_440216.1_9 Forward -148 -139 5.70292 0.29
NP_440172.1_1 Forward -346 -336 6.37155 0.105
NP_441226.1_7 Forward -345 -338 5.54531 0.289
NP_441111.1_7 Reverse -338 -346 8.96754 0.0463
NP_441766.1_2 Reverse -337 -346 8.55452 0.054
NP_440416.1_9 Forward -251 -232 -14.6519 0.179
NP_440416.1_9 Forward -44 -25 -15.9302 0.204
NP_440416.1_9 Forward -266 -247 -16.3235 0.212
NP_440416.1_9 Reverse -302 -321 -17.6018 0.243
NP_443052.1_9 Reverse -173 -192 -0.983855 0.219
NP_443052.1_9 Reverse -263 -282 -7.17871 0.294
NP_442552.1_7 Forward -172 -153 19.8614 0.116
NP_442154.1_1 Forward -281 -263 4.9357 0.0591
NP_442154.1_1 Forward -284 -266 -6.66736 0.141
NP_442154.1_1 Forward -188 -170 -11.7806 0.216
NP_442154.1_1 Reverse -232 -250 -16.6971 0.244
NP_442154.1_1 Reverse -148 -166 -16.7954 0.245
NP_442154.1_1 Forward -197 -179 -17.6804 0.262
NP_442154.1_1 Reverse -133 -151 -18.0738 0.276
NP_442154.1_1 Reverse -211 -229 -19.0571 0.289
NP_440261.1_5 Forward -369 -356 -5.19226 0.188
NP_440988.1_10 Forward -45 -31 8.28727 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAAACCCCATCAGTAAAAGTTGTCTGCGTAAACTATCGCCGCCAAATTTGATCAGGCTATCGCGAATAATTTGGATAATGCCGGTGCGGGTAATGCCGTAGCTTAAAATAAACATGGCCATGATGGTGACGGTGGCGGAATTGCTAAACCCCGCAATCCCCTCCGTGGGGGTGACCAAACCCAACACCATTAAAATTACAGCCACCAGAATGGCGGTGGTGTCGATGGGTAACCACTCCAACACAAACATCACCAGCGCAAAAACAATAACTGCCAGAGTGAGGGGAATTTGATAGTCTGCCAGCCAGGTTTGCAAAAAGGCCATAGTTATCCCAAAAGATGATTAAACAAATTCTTCCCCATTGCCAGCGAGTTCACAAGAGGAAATAGTCCGATAACA

CDS

ATGCGTGTCATTCTGTGTGGTTACTACGGCCAAGACAATGCTGGGGATGAAGCCCTTTTAGTCTGTTTGCTGCAAATGCTTCCTGCGACGGTGGAGCCAGTGGTGCTCTCCGCCAATCCCCAGGTCACCACAGCGAGATACGGTGTTAAAGCCCACTACAACCGAGACTGGGGCAAAATTTGGCAGCTTTTGGGTCAATGTGACGGTTTTATCTGGGGGGGAGGCAGTTTGATGCAGGATGTGACCAGCGTGGTTAGTCCCCTATACTACGGTGGTTTGATGGCGATCGCCCAGATGCGGCGTTTAAAAACCATTGCCTGGGCCCAGGGCATTGGCCCCCTTAGAAGGCCGCCGTTGCGCTGGTTTACCCAACAGGTGCTCCGGGGTTGTAGCGGCATCAGCGTACGGGATCAAGCTTCTTTGCAATTAGTTAAACAATGGGGCTTAAAGGCTTTTTTAGCGGCGGATCCGGTGTGGTCTTTAGCCGCTGAAAATGCGTCTTCTTCCCCCAGCCCTTTGCCCATGGTGGCGGTGAATTTGCGGGCCCATCCTTTGTTAACCTTGGAACGCTTGGCGGTCATTACCGAAGCCCTAAGGGATTTTCAACACCAGACCCAAACCCATGTGCGGCTCATTCCCCTACAAAAATCCCAGGATTTGGCCATTGCCGAAGCGATCGCCGTGGAATTGCCGGGGAGTCATGAAATTCTTTACCGCCCCGACCCCAGGGAATGTAAAGGTTTGTTCCGGGGGGCGGAATTCACCATTGGCATGCGGCTCCACAGTTTAATCATGGCCGCGGCGGAGGGCAGTGCCTGCTTTGCCCTTAGTTATGACCCTAAAGTTAGTCGTTTAATCGCAGAGGTGGGACTACCGGGCCGGGAATTGGCGGATTTACCCAGGGATAGCAACGAACTCAGCCAGGTTTGGCAGGGACATTTCCGGCAAAGACAACCCTCTACCGGGGTAGAGTTCTTGCAAAAATCTGCCCTTCAGCATCAAACTTTGTTGCAGAAAATTTTTGTTGACTAG

Protein

MRVILCGYYGQDNAGDEALLVCLLQMLPATVEPVVLSANPQVTTARYGVKAHYNRDWGKIWQLLGQCDGFIWGGGSLMQDVTSVVSPLYYGGLMAIAQMRRLKTIAWAQGIGPLRRPPLRWFTQQVLRGCSGISVRDQASLQLVKQWGLKAFLAADPVWSLAAENASSSPSPLPMVAVNLRAHPLLTLERLAVITEALRDFQHQTQTHVRLIPLQKSQDLAIAEAIAVELPGSHEILYRPDPRECKGLFRGAEFTIGMRLHSLIMAAAEGSACFALSYDPKVSRLIAEVGLPGRELADLPRDSNELSQVWQGHFRQRQPSTGVEFLQKSALQHQTLLQKIFVD