Your browser is old and dusty. Try Google Chrome!

Details for slr0678

ORF slr0678
Accession NP_440279.1
Symbol
Category biopolymer transport ExbD like protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Reverse -339 -358 -29.0082 0.215
NP_441453.1_4 Reverse -188 -196 4.73931 0.252
NP_441623.1_1 Forward -136 -118 -4.20908 0.274
NP_441630.1_8 Forward -307 -288 16.8132 0.23
NP_442623.1_1 Reverse -36 -55 -8.35868 0.172
NP_442287.1_5 Reverse -35 -45 14.828 0.218
NP_442752.1_4 Reverse -1 -8 10.5605 0.1
NP_442752.1_4 Reverse -188 -195 4.26735 0.293
NP_441812.1_3 Forward -105 -91 6.88276 0.287
NP_441675.1_4 Reverse -107 -126 2.94938 0.286
NP_442909.1_7 Forward -196 -182 10.9137 0.131
NP_440110.1_7 Forward -122 -103 13.9625 0.213
NP_440304.1_4 Forward -173 -163 5.28991 0.218
NP_441781.1_7 Reverse -188 -207 4.62101 0.186
NP_441208.1_9 Reverse -159 -173 5.80112 0.262
NP_441082.1_10 Forward -84 -71 16.6372 0.149
NP_441082.1_10 Forward -340 -327 7.6891 0.297
NP_440300.1_1 Forward -150 -131 19.6648 0.109
NP_441083.1_5 Forward -197 -187 -0.118297 0.256
NP_441434.1_3 Reverse -115 -134 -0.295539 0.229
NP_441738.1_2 Reverse -367 -374 8.1019 0.204
NP_441738.1_2 Forward -398 -391 6.52862 0.261
NP_441955.1_8 Reverse -342 -359 6.43035 0.281
NP_440209.1_1 Forward -197 -189 2.08437 0.286
NP_442570.1_3 Reverse -134 -153 5.80098 0.159
NP_441716.1_2 Forward -112 -93 -1.33384 0.287
NP_442111.1_1 Reverse -274 -293 12.0933 0.29
NP_442111.1_4 Reverse -187 -201 3.53951 0.24
NP_441130.1_10 Reverse -150 -164 8.06273 0.141
NP_441486.1_1 Reverse -185 -199 -3.34366 0.178
NP_442848.1_1 Reverse -182 -196 -2.36035 0.263
NP_442848.1_9 Reverse -333 -352 9.24257 0.182
NP_443018.1_3 Reverse -183 -190 4.26735 0.267
NP_443018.1_3 Forward -190 -183 4.16902 0.278
NP_441634.1_8 Reverse -346 -360 2.65453 0.166
NP_441634.1_8 Forward -163 -149 -4.7203 0.295
NP_440376.1_1 Reverse -142 -151 9.4395 0.0394
NP_442687.1_7 Reverse -265 -275 7.05986 0.142
NP_442687.1_7 Reverse -117 -127 3.71661 0.292
NP_441013.1_2 Reverse -177 -195 -1.45582 0.282
NP_441013.1_3 Forward -347 -328 9.24257 0.233
NP_441950.1_7 Reverse -137 -156 -9.44032 0.297
NP_441763.1_5 Forward -355 -336 -6.1954 0.274
NP_442658.1_1 Reverse -180 -190 5.97777 0.242
NP_440141.1_3 Forward -365 -346 10.4225 0.274
NP_442782.1_2 Forward -131 -117 4.42448 0.254
NP_441487.1_9 Forward -136 -117 -0.688862 0.262
NP_441127.1_1 Reverse -354 -368 10.226 0.255
NP_442836.1_10 Forward -79 -69 15.8113 0.212
NP_440984.1_7 Reverse -34 -48 5.99778 0.231
NP_441580.1_6 Reverse -340 -359 -8.65367 0.267
NP_440138.1_6 Reverse -283 -302 2.06362 0.273
NP_440138.1_6 Reverse -328 -347 1.08032 0.289
NP_442002.1_9 Reverse -117 -124 12.2322 0.185
NP_441646.1_1 Reverse -136 -155 0.0977854 0.254
NP_441000.1_6 Forward -192 -178 -3.147 0.221
NP_441000.1_6 Reverse -151 -165 -5.50694 0.279
NP_440147.1_4 Reverse -160 -173 6.60746 0.0881
NP_441041.1_4 Reverse -300 -319 -5.11376 0.148
NP_440099.1_1 Forward -63 -44 3.83357 0.256
NP_441547.1_2 Forward -264 -246 4.9357 0.236
NP_442004.1_6 Forward -197 -183 6.98109 0.169
NP_439966.1_7 Forward -146 -136 8.53436 0.135
NP_439966.1_7 Reverse -363 -373 4.60114 0.265
NP_441554.1_4 Reverse -4 -18 14.5978 0.241
NP_440260.1_8 Forward -306 -288 6.50899 0.154
NP_441514.1_1 Forward -383 -373 14.1541 0.28
NP_442049.1_6 Forward -344 -325 14.5524 0.151
NP_442049.1_6 Forward -382 -363 3.24438 0.276
NP_440498.1_7 Reverse -11 -25 18.2892 0.193
NP_441644.1_6 Reverse -162 -172 3.71617 0.267
NP_443049.1_6 Reverse -187 -197 13.3 0.191
NP_442215.1_2 Reverse -324 -340 -0.629782 0.17
NP_442215.1_2 Forward -299 -283 -5.34967 0.249
NP_440253.1_2 Reverse -365 -383 -3.22577 0.287
NP_442554.1_8 Forward -170 -160 3.51995 0.222
NP_442381.1_8 Reverse -354 -373 -11.0136 0.262
NP_442381.1_8 Reverse -179 -198 -14.5535 0.283
NP_442250.1_5 Reverse -62 -73 19.626 0.108
NP_440279.1_1 Forward -275 -256 29.4004 0.000402
NP_440279.1_2 Forward -302 -283 28.6138 0.00077
NP_440279.1_3 Forward -335 -316 25.7622 0.00809
NP_440279.1_4 Forward -205 -186 29.4987 0.00022
NP_440279.1_5 Forward -227 -208 24.4839 0.0148
NP_440279.1_7 Forward -365 -346 27.1388 0.00293
NP_440279.1_8 Forward -179 -160 15.6341 0.242
NP_440279.1_9 Forward -251 -232 23.1304 0.0204
NP_440379.1_5 Reverse -126 -145 -1.27885 0.189
NP_440464.1_10 Forward -196 -186 11.5758 0.298
NP_441468.1_1 Reverse -183 -190 4.36568 0.237
NP_439939.1_4 Forward -286 -267 2.3594 0.199
NP_441826.1_2 Reverse -333 -347 -2.06536 0.264
NP_442808.1_1 Forward -153 -143 0.962914 0.299
NP_442775.1_6 Forward -353 -334 13.0775 0.277
NP_440558.1_2 Reverse -312 -331 -4.72043 0.248
NP_440558.1_2 Reverse -241 -260 -4.91709 0.249
NP_441878.1_6 Forward -172 -162 -7.39479 0.222
NP_441878.1_6 Forward -254 -244 -7.68978 0.255
NP_441520.1_9 Reverse -275 -294 12.4875 0.161
NP_441590.1_4 Reverse -328 -347 3.63691 0.29
NP_441574.1_1 Forward -309 -290 -3.83545 0.245
NP_441467.1_5 Reverse -11 -21 18.6629 0.188
NP_442347.1_2 Reverse -96 -105 4.22796 0.284
NP_442645.1_2 Forward -173 -154 -9.44032 0.141
NP_442965.1_2 Reverse -8 -27 -5.80207 0.255
NP_441037.1_4 Forward -255 -245 12.288 0.109
NP_442317.1_6 Reverse -157 -176 5.40766 0.24
NP_441633.1_3 Forward -163 -150 -6.86388 0.277
NP_442998.1_5 Reverse -36 -46 11.2881 0.189
NP_442998.1_10 Forward -195 -188 13.5105 0.0225
NP_440299.1_1 Reverse -240 -253 5.32859 0.18
NP_440299.1_1 Reverse -184 -197 4.73861 0.201
NP_440299.1_1 Forward -195 -182 2.96866 0.265
NP_440299.1_1 Forward -301 -288 2.18201 0.294
NP_440256.1_1 Forward -294 -275 -4.13045 0.147
NP_441559.1_8 Reverse -157 -171 -5.80194 0.27
NP_441704.1_8 Reverse -177 -196 8.84842 0.202
NP_442866.1_1 Reverse -124 -143 -8.752 0.282
NP_441464.1_10 Reverse -133 -147 10.1277 0.262
NP_441113.1_3 Reverse -264 -278 14.3553 0.28
NP_440306.1_8 Forward -104 -85 -2.26292 0.25
NP_442993.1_1 Reverse -312 -328 -9.97122 0.201
NP_440677.1_1 Forward -357 -338 6.78429 0.253
NP_442386.1_9 Forward -192 -183 12.2907 0.0676
NP_442386.1_9 Reverse -181 -190 5.11253 0.266
NP_440570.1_5 Reverse -133 -152 -1.47551 0.273
NP_441340.1_5 Forward -190 -183 4.07068 0.239
NP_442484.1_2 Reverse -301 -320 -1.86883 0.3
NP_440327.1_6 Forward -347 -328 8.94757 0.214
NP_440586.1_8 Forward -190 -183 7.70858 0.227
NP_441262.1_3 Reverse -188 -195 5.25066 0.215
NP_441262.1_5 Reverse -211 -230 8.25926 0.214
NP_440027.1_3 Reverse -326 -344 2.87 0.284
NP_439937.1_8 Reverse -138 -157 -3.73712 0.271
NP_439937.1_9 Reverse -243 -260 0.0381458 0.107
NP_440408.1_7 Forward -366 -347 8.25926 0.282
NP_441803.1_2 Forward -170 -151 -0.688862 0.284
NP_440139.1_1 Reverse -238 -257 0.195343 0.299
NP_442887.1_5 Reverse -148 -167 -10.227 0.264
NP_441877.1_5 Forward -101 -82 0.0977854 0.276
NP_441877.1_7 Reverse -343 -362 5.11187 0.218
NP_442790.1_4 Forward -167 -148 -10.9153 0.219
NP_442262.1_10 Reverse -189 -196 9.18389 0.211
NP_440163.1_10 Forward -312 -302 11.6814 0.169
NP_440163.1_10 Forward -294 -284 9.12481 0.247
NP_440344.1_6 Reverse -249 -263 16.6175 0.271
NP_442065.1_7 Reverse -179 -197 2.47742 0.215
NP_440350.1_5 Forward -56 -37 -4.22878 0.273
NP_442280.1_10 Forward -307 -289 6.42843 0.275
NP_440888.1_2 Reverse -162 -176 9.83206 0.113
NP_440888.1_2 Forward -321 -307 9.04542 0.139
NP_442225.1_7 Reverse -56 -75 17.0099 0.232
NP_441543.1_2 Forward -196 -187 5.50626 0.197
NP_440982.1_1 Forward -151 -132 5.01354 0.294
NP_441548.1_2 Forward -258 -239 18.9773 0.116
NP_443064.1_3 Reverse -325 -344 9.0459 0.179
NP_442578.1_7 Reverse -189 -196 11.4455 0.0898
NP_441462.1_2 Reverse -188 -198 -1.19994 0.291
NP_443062.1_1 Forward -191 -173 4.84065 0.247
NP_440544.1_5 Forward -19 -12 14.5681 0.264
NP_442487.1_5 Forward -172 -153 3.14526 0.289
NP_440516.1_8 Reverse -188 -197 0.786375 0.133
NP_441785.1_1 Forward -297 -283 14.1927 0.166
NP_442428.1_5 Reverse -183 -190 4.66067 0.244
NP_441267.1_9 Reverse -208 -227 23.6963 0.0451
NP_442120.1_10 Forward -327 -308 -10.6203 0.261
NP_441052.1_2 Forward -197 -187 7.45319 0.0712
NP_441052.1_2 Reverse -288 -298 0.865012 0.256
NP_442219.1_8 Forward -307 -288 18.7001 0.0447
NP_442219.1_9 Reverse -183 -192 5.70292 0.135
NP_440436.1_4 Forward -290 -281 6.48915 0.157
NP_440436.1_4 Forward -190 -181 4.52254 0.256
NP_441884.1_9 Forward -324 -305 -22.3217 0.277
NP_441719.1_4 Reverse -189 -196 3.77569 0.285
NP_441004.1_1 Forward -86 -67 -13.7669 0.261
NP_441004.1_1 Reverse -137 -156 -16.8151 0.287
NP_442813.1_4 Forward -271 -252 -1.08219 0.236
NP_440296.1_10 Forward -174 -155 -14.0619 0.269
NP_441851.1_10 Forward -330 -320 4.69992 0.254
NP_441542.1_4 Reverse -114 -128 4.22782 0.264
NP_442843.1_1 Forward -135 -116 -10.7186 0.28
NP_440431.1_3 Reverse -299 -318 -11.4069 0.286
NP_440431.1_4 Reverse -268 -287 -9.40638 0.284
NP_442450.1_5 Forward -199 -189 5.97822 0.209
NP_440040.1_7 Reverse -368 -385 13.7061 0.293
NP_440943.1_5 Forward -299 -285 11.3077 0.273
NP_442006.1_2 Forward -224 -207 -17.6607 0.279
NP_442006.1_2 Forward -144 -127 -19.1357 0.299
NP_440483.1_1 Reverse -130 -149 -8.16202 0.282
NP_441078.1_4 Forward -197 -188 -1.57357 0.266
NP_441078.1_4 Forward -171 -162 -1.57357 0.266
NP_442443.1_1 Reverse -136 -155 -2.55715 0.258
NP_440526.1_3 Reverse -245 -256 8.12131 0.126
NP_441432.1_8 Forward -172 -163 5.3096 0.17
NP_441432.1_9 Forward -62 -49 10.0527 0.256
NP_441732.1_2 Reverse -158 -174 -16.8544 0.207
NP_441732.1_2 Reverse -184 -200 -17.5427 0.27
NP_440760.1_1 Reverse -188 -207 -23.305 0.293
NP_442274.1_3 Reverse -125 -144 10.5209 0.297
NP_440199.1_10 Reverse -285 -295 13.8447 0.0988
NP_441805.1_1 Reverse -262 -281 -5.60541 0.286
NP_442489.1_7 Forward -171 -162 -1.57357 0.213
NP_442489.1_7 Reverse -162 -171 -2.06522 0.288
NP_440779.1_5 Forward -191 -174 -15.0058 0.3
NP_442346.1_5 Forward -254 -244 11.5831 0.0634
NP_442346.1_5 Reverse -287 -297 7.45319 0.169
NP_440486.1_7 Forward -351 -333 19.882 0.12
NP_441653.1_2 Reverse -271 -290 3.72288 0.264
NP_440671.1_4 Forward -315 -301 12.0943 0.117
NP_442199.1_5 Forward -179 -160 -1.37718 0.18
NP_442021.1_3 Forward -372 -353 -7.27704 0.268
NP_441813.1_5 Reverse -180 -190 -0.609952 0.261
NP_440590.1_4 Forward -196 -183 0.0192843 0.173
NP_441239.1_9 Forward -173 -161 8.39711 0.134
NP_442691.1_5 Reverse -334 -352 18.7715 0.158
NP_441892.1_1 Reverse -179 -196 8.39697 0.0804
NP_442044.1_9 Forward -67 -48 4.03102 0.231
NP_441017.1_6 Reverse -329 -343 14.5519 0.144
NP_441617.1_6 Forward -113 -94 -6.1954 0.28
NP_442138.1_9 Reverse -14 -33 13.6666 0.202
NP_440546.1_4 Forward -253 -243 8.6886 0.176
NP_441509.1_2 Forward -399 -381 10.3439 0.245
NP_440868.1_4 Forward -201 -189 -1.04266 0.291
NP_440401.1_9 Forward -147 -140 12.6251 0.287
NP_441249.1_8 Reverse -130 -149 2.0644 0.284
NP_442402.1_2 Forward -322 -308 15.1419 0.263
NP_442402.1_6 Reverse -307 -316 14.4544 0.241
NP_442402.1_10 Forward -318 -308 11.9759 0.23
NP_441848.1_4 Reverse -97 -113 10.7019 0.245
NP_442358.1_4 Reverse -378 -397 8.55425 0.269
NP_442923.1_4 Reverse -143 -162 2.65439 0.156
NP_441811.1_8 Forward -73 -59 6.88276 0.259
NP_440160.1_2 Reverse -320 -339 -1.27885 0.235
NP_442053.1_1 Forward -197 -188 4.32629 0.254
NP_442360.1_5 Reverse -217 -227 13.353 0.279
NP_441102.1_1 Forward -308 -289 10.4225 0.152
NP_441252.1_6 Reverse -115 -122 11.9372 0.25
NP_441252.1_6 Forward -331 -324 11.6422 0.288
NP_442532.1_4 Reverse -109 -127 7.96493 0.289
NP_441011.1_8 Forward -190 -181 5.01461 0.289
NP_442533.1_6 Reverse -149 -158 2.458 0.255
NP_442533.1_6 Forward -10 -1 2.16301 0.27
NP_442322.1_4 Forward -153 -136 -0.453507 0.219
NP_439944.1_9 Reverse -183 -193 5.09324 0.277
NP_442269.1_10 Forward -347 -328 2.0644 0.28
NP_440816.1_4 Forward -157 -138 18.289 0.226
NP_441028.1_6 Forward -20 -10 4.7978 0.277
NP_441028.1_6 Forward -149 -139 4.10949 0.278
NP_441527.1_4 Reverse -267 -286 -6.7326 0.224
NP_439965.1_7 Forward -61 -42 12.5584 0.287
NP_443045.1_9 Forward -152 -134 9.16315 0.239
NP_442890.1_9 Reverse -180 -199 12.5858 0.254
NP_441106.1_1 Reverse -181 -190 4.62128 0.213
NP_440429.1_2 Forward -365 -346 7.37428 0.289
NP_441286.1_1 Reverse -187 -199 -4.68091 0.168
NP_441930.1_2 Forward -172 -162 11.3864 0.294
NP_440886.1_7 Forward -145 -135 3.32285 0.287
NP_442614.1_2 Reverse -1 -15 7.57108 0.271
NP_442614.1_2 Reverse -36 -50 5.89945 0.296
NP_442401.1_2 Reverse -287 -306 12.3883 0.159
NP_442213.1_6 Forward -44 -25 5.99764 0.265
NP_442842.1_4 Forward -347 -328 2.65439 0.265
NP_441626.1_2 Reverse -189 -196 4.66067 0.267
NP_441205.1_5 Forward -112 -93 23.7947 0.0132
NP_442615.1_1 Forward -180 -162 -5.09406 0.204
NP_442615.1_1 Reverse -235 -253 -6.37237 0.244
NP_440387.1_1 Reverse -188 -204 3.89344 0.0503
NP_440855.1_1 Forward -147 -128 2.45773 0.205
NP_441431.1_3 Reverse -129 -148 8.84924 0.236
NP_442224.1_1 Forward -323 -304 -0.885524 0.233
NP_440467.1_3 Forward -196 -177 11.3539 0.278
NP_440287.1_7 Reverse -27 -46 16.7157 0.292
NP_441237.1_9 Forward -196 -186 10.1081 0.248
NP_442743.1_1 Reverse -317 -336 11.0117 0.241
NP_442867.1_8 Reverse -128 -147 4.916 0.277
NP_441981.1_3 Reverse -12 -26 15.38 0.268
NP_440054.1_9 Forward -340 -321 12.9783 0.205
NP_440554.1_4 Forward -190 -180 6.17489 0.126
NP_441885.1_5 Forward -197 -187 -0.0199663 0.186
NP_442341.1_7 Forward -198 -184 4.71948 0.181
NP_441173.1_9 Forward -245 -237 11.7204 0.226
NP_440507.2_3 Forward -200 -181 8.25844 0.257
NP_441561.1_8 Reverse -62 -81 17.8927 0.282
NP_441307.1_1 Reverse -296 -315 12.6841 0.227
NP_441207.1_7 Reverse -89 -103 10.514 0.262
NP_439962.1_4 Reverse -340 -359 -2.55715 0.231
NP_439962.1_4 Reverse -127 -146 -5.21209 0.278
NP_442591.1_7 Reverse -343 -362 8.84924 0.195
NP_440149.1_8 Forward -197 -178 -7.86702 0.294
NP_442373.1_2 Reverse -336 -355 -8.752 0.253
NP_440216.1_9 Reverse -85 -94 10.3245 0.286
NP_440172.1_1 Reverse -162 -172 3.02829 0.251
NP_440172.1_1 Forward -171 -161 1.84832 0.294
NP_441226.1_7 Forward -190 -183 11.2485 0.0971
NP_441766.1_9 Reverse -128 -147 7.57094 0.144
NP_442417.1_5 Reverse -300 -314 6.6861 0.211
NP_440416.1_9 Reverse -325 -344 -19.6667 0.276
NP_440072.1_5 Reverse -135 -153 11.2289 0.234
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCAATCCCTTAGTTCCATCCAAATTAGCGATTTGGGTACAGCTTCCACCGCTGGAGTCACCCTTGGTATTGGGGAAGCACTGATTTCCACAGCGGCCGGTTTGATCATAGCCATTGTTAGTTTGGCCTTTTACCGTGTGTTTCAGGGGCTATGGTTCAACCAAATGCGAGTCTTCCGTAAAGTAGGCAGTGAACTAGAGGTGCTCTATCGCCAACGCTGGTTTGAAGAGGAAATGGCCTACGATGACGGCCTAACCCCCAGCCCGGAAGCGGAAAGTTTGCCCCAATAGTTTTGCTGGAATCAACTTTTCCAGGCTTGTTAGGATTGGGGAGGTTGATTGAGCCTATTTTTAGGCATCTTCCCCAGGATTGAGTCCGGTTTTTTCTCCTTCCCATCACC

CDS

ATGGCATCTTCCCCTAAAGCCCCCAAGTCCCACCGTAAATTCCAGTCCATTTACCATCCCACCCGTCCCCTGTCCCTCTGGCAGGATAACCAACATGACCAGGGGGAAGTGCGCATTGAGATTATTCCCCTGATTGACGTTGTTTTCTGTATTCTGACCTTTTTTATCCTGGGGGCGGTGGGGCTATCCCGACAACAAGCCATTAGTTTAGATTTACCCCGAGCTAGCACTGGGGCTCCCCAAATGCGGGAAATGTTTATGGTGAGCCTGGACGATCTGGGGCAACTTTATGTGGAAAAACAGCCGGTAAGCCAGGAGCAGATGGTTAGTGCCCTGCAAAATTATCACCAATACAATCCCAGCGGTTTGATTGTGCTCCATGCTTCCCGCAATGCCAGTTATAACGATGTGGTGCAATTACTGGATACTCTGCGAACCGTGGGCGGCGATCGGGTGGCTTTAGCGACTTTACCCGGCGATGGCCAAACTCCCTCGGGCATGAACCCCAATAGCTTTAATAATCCTAATTTGGGATTACCGGGCATGACTCCGGGCAACGCATTCCCCAATGGTGCCAATCCGGGAATGTCCAATTTTAATAACTCGAATCCTGGGGGTTCCGGTGCGGGCGTCCCTAATTTTAGTAACACTCCCTTACCAGGTATGCCCGATGCCAATGGCAATGTGTCTCCCAATCCTGGTATGAATCCTGGTTTTCCCGGTGGAGGCGCCATGAGCCCTGACCCCAACTCCCAATCGCCCAATTTACCTGGGATGGGTAACACCGTGCCCAGTGCCCCCCAACAGTAA

Protein

MASSPKAPKSHRKFQSIYHPTRPLSLWQDNQHDQGEVRIEIIPLIDVVFCILTFFILGAVGLSRQQAISLDLPRASTGAPQMREMFMVSLDDLGQLYVEKQPVSQEQMVSALQNYHQYNPSGLIVLHASRNASYNDVVQLLDTLRTVGGDRVALATLPGDGQTPSGMNPNSFNNPNLGLPGMTPGNAFPNGANPGMSNFNNSNPGGSGAGVPNFSNTPLPGMPDANGNVSPNPGMNPGFPGGGAMSPDPNSQSPNLPGMGNTVPSAPQQ