Your browser is old and dusty. Try Google Chrome!

Details for slr0652

ORF slr0652
Accession NP_442856.1
Symbol hisA
Category Aromatic amino acid family
Definition phosphorybosilformimino-5-amino- phosphorybosil-4-imidazolecarboxamideisomerase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440897.1_6 Reverse -357 -376 -3.83621 0.257
NP_441818.1_9 Forward -294 -275 -8.06369 0.274
NP_441818.1_9 Forward -369 -350 -8.85033 0.283
NP_440226.1_1 Forward -270 -251 1.67108 0.295
NP_442655.1_10 Forward -303 -284 -19.9617 0.296
NP_443002.1_5 Reverse -280 -298 10.5398 0.256
NP_441054.1_6 Forward -368 -349 12.5858 0.281
NP_439979.1_9 Forward -293 -275 10.0489 0.227
NP_441859.1_3 Forward -295 -276 7.4718 0.157
NP_439918.1_2 Forward -306 -287 9.53756 0.136
NP_439918.1_2 Forward -300 -281 -3.14714 0.251
NP_441619.1_8 Forward -300 -286 13.6669 0.114
NP_441208.1_9 Forward -273 -259 6.3911 0.246
NP_441082.1_10 Reverse -377 -390 9.75405 0.242
NP_441149.1_9 Reverse -278 -297 1.17865 0.221
NP_441434.1_1 Reverse -42 -56 8.70139 0.254
NP_441713.1_1 Reverse -255 -274 -16.1268 0.277
NP_442706.1_5 Reverse -173 -192 17.2842 0.197
NP_441624.1_7 Reverse -291 -305 6.3911 0.286
NP_440343.1_3 Reverse -275 -293 16.1446 0.0832
NP_442634.1_4 Reverse -259 -273 -3.147 0.161
NP_441695.1_8 Reverse -291 -305 14.1593 0.22
NP_442848.1_5 Reverse -111 -129 -2.14413 0.278
NP_441857.1_6 Forward -301 -291 13.4514 0.282
NP_442296.1_5 Reverse -287 -306 2.65439 0.26
NP_442782.1_2 Forward -305 -291 0.196253 0.293
NP_442205.1_9 Forward -276 -260 13.5299 0.0479
NP_439959.1_9 Forward -149 -131 17.3254 0.204
NP_441958.1_5 Reverse -260 -270 0.471689 0.143
NP_440153.1_8 Reverse -285 -298 -2.83231 0.266
NP_443055.1_2 Reverse -274 -293 17.7974 0.112
NP_441099.1_5 Reverse -104 -123 -8.752 0.203
NP_442002.1_1 Forward -303 -285 -9.0273 0.272
NP_442002.1_9 Forward -36 -29 9.08556 0.289
NP_440147.1_4 Reverse -259 -272 11.4257 0.0326
NP_441041.1_4 Forward -300 -281 -5.9004 0.16
NP_441041.1_4 Forward -221 -202 -13.7669 0.295
NP_440703.1_9 Reverse -358 -371 5.42692 0.293
NP_440703.1_9 Forward -391 -378 4.73861 0.293
NP_442941.1_3 Forward -269 -259 -0.118297 0.249
NP_440177.1_1 Reverse -350 -368 4.6407 0.272
NP_001035871.2_7 Forward -303 -293 17.3846 0.107
NP_442012.1_1 Forward -133 -114 -0.000545616 0.249
NP_442049.1_4 Forward -299 -280 -2.0655 0.256
NP_441457.1_7 Reverse -259 -278 -0.000545616 0.288
NP_442068.1_10 Forward -192 -173 16.5191 0.165
NP_440929.1_8 Reverse -109 -118 2.16301 0.262
NP_442933.1_10 Forward -270 -261 4.22796 0.267
NP_442313.1_6 Reverse -242 -261 4.12936 0.267
NP_442142.1_4 Reverse -354 -367 11.3267 0.0586
NP_443009.1_5 Reverse -260 -271 4.48308 0.244
NP_443009.1_5 Forward -271 -260 4.08976 0.263
NP_441715.1_4 Forward -269 -259 4.99491 0.24
NP_441198.1_4 Forward -342 -323 11.0125 0.241
NP_440464.1_10 Forward -41 -31 12.9127 0.176
NP_441015.1_10 Forward -371 -352 -7.57203 0.269
NP_441244.1_8 Forward -363 -344 4.71934 0.143
NP_441612.1_2 Forward -250 -240 8.83972 0.21
NP_442808.1_1 Reverse -290 -300 10.8943 0.0481
NP_440031.1_10 Forward -305 -286 1.96607 0.264
NP_442050.1_2 Reverse -188 -207 8.25844 0.248
NP_440558.1_2 Forward -273 -254 -7.4737 0.294
NP_442593.1_1 Forward -112 -93 14.8474 0.285
NP_441557.1_5 Reverse -261 -270 -0.786921 0.239
NP_442066.2_4 Forward -127 -108 9.24257 0.0742
NP_440101.1_10 Forward -300 -281 15.2408 0.126
NP_442183.1_9 Forward -297 -287 14.7297 0.206
NP_441574.1_1 Forward -294 -275 3.53937 0.142
NP_442444.1_6 Forward -278 -260 17.4668 0.143
NP_442347.1_2 Reverse -27 -36 3.34298 0.284
NP_442738.1_4 Reverse -109 -128 9.63589 0.247
NP_441633.1_3 Reverse -259 -272 -7.06055 0.288
NP_441799.1_1 Reverse -257 -271 8.55376 0.112
NP_441007.1_10 Forward -123 -110 -0.37404 0.277
NP_442007.1_6 Forward -141 -122 5.40766 0.212
NP_441559.1_8 Reverse -256 -270 -6.88358 0.281
NP_441464.1_2 Reverse -350 -360 14.533 0.263
NP_440695.1_6 Reverse -183 -197 10.4114 0.265
NP_441494.1_6 Forward -275 -262 9.75405 0.227
NP_441750.1_1 Forward -288 -269 9.43923 0.0978
NP_440027.1_8 Reverse -288 -307 4.71854 0.287
NP_443051.1_1 Reverse -260 -269 0.0980582 0.226
NP_440451.1_10 Reverse -286 -305 9.24175 0.264
NP_439937.1_9 Reverse -280 -297 -9.49991 0.192
NP_440371.1_10 Forward -40 -21 16.4207 0.179
NP_440398.1_2 Forward -101 -82 9.53756 0.172
NP_442488.1_9 Reverse -275 -294 11.8975 0.206
NP_440364.1_10 Forward -180 -161 14.7491 0.273
NP_442244.1_3 Reverse -29 -48 3.04771 0.292
NP_440838.1_5 Reverse -112 -131 11.1109 0.271
NP_441592.1_4 Reverse -157 -176 -1.7705 0.259
NP_440999.1_9 Reverse -281 -295 1.47456 0.164
NP_440888.1_2 Forward -270 -256 9.24208 0.134
NP_441543.1_3 Reverse -289 -303 6.29216 0.286
NP_442315.1_1 Forward -206 -188 3.26407 0.292
NP_441462.1_2 Reverse -261 -271 -0.216628 0.192
NP_441560.1_8 Reverse -11 -30 12.3892 0.255
NP_440544.1_5 Reverse -243 -250 14.5681 0.264
NP_442872.1_1 Reverse -325 -344 -10.7186 0.241
NP_442428.1_5 Forward -269 -262 3.67736 0.298
NP_440673.1_3 Forward -268 -261 7.51227 0.252
NP_440673.1_3 Reverse -28 -35 7.51227 0.252
NP_441052.1_2 Reverse -357 -367 1.55333 0.238
NP_442219.1_8 Forward -52 -33 8.26374 0.251
NP_441884.1_9 Reverse -345 -364 -14.0619 0.138
NP_441004.1_1 Forward -348 -329 -10.4236 0.219
NP_441004.1_1 Forward -300 -281 -15.7335 0.277
NP_441004.1_1 Forward -288 -269 -16.0285 0.281
NP_441231.1_4 Forward -284 -265 18.1033 0.243
NP_442366.1_3 Reverse -25 -43 -3.42244 0.247
NP_442854.1_4 Reverse -291 -310 19.0748 0.0632
NP_442856.1_6 Forward -395 -377 18.1112 0.173
NP_442856.1_8 Forward -130 -112 19.587 0.12
NP_441396.1_5 Forward -122 -113 8.35786 0.224
NP_441683.1_5 Reverse -256 -275 12.6841 0.165
NP_441982.1_6 Reverse -178 -187 13.8222 0.274
NP_441046.1_2 Forward -305 -286 -0.885524 0.287
NP_440940.1_1 Forward -369 -350 11.0125 0.155
NP_440474.1_8 Reverse -262 -276 6.19383 0.23
NP_441124.1_5 Reverse -38 -48 15.5864 0.188
NP_440954.1_1 Forward -294 -275 -6.49039 0.289
NP_442006.1_2 Forward -366 -349 -15.6941 0.228
NP_442006.1_2 Forward -282 -265 -18.939 0.296
NP_441570.1_1 Forward -270 -252 -17.7788 0.291
NP_442729.1_5 Forward -367 -357 7.84651 0.261
NP_442443.1_1 Forward -290 -271 -4.6221 0.275
NP_441432.1_8 Reverse -260 -269 14.7494 0.0218
NP_440290.1_1 Reverse -38 -47 17.3727 0.21
NP_442003.1_4 Forward -269 -250 13.0775 0.257
NP_442815.1_2 Forward -293 -275 6.31233 0.212
NP_440760.1_1 Reverse -285 -304 -22.8133 0.271
NP_442274.1_8 Reverse -272 -290 16.3375 0.223
NP_441057.1_4 Forward -295 -277 -2.53746 0.274
NP_442353.1_4 Forward -41 -22 0.981987 0.259
NP_442400.1_1 Reverse -23 -42 1.27776 0.226
NP_440713.1_4 Reverse -251 -270 0.884433 0.3
NP_442489.1_7 Forward -270 -261 -1.96689 0.28
NP_441830.1_2 Forward -268 -249 -4.22878 0.275
NP_442079.1_7 Forward -293 -274 2.65439 0.225
NP_441659.2_8 Reverse -285 -295 1.25834 0.245
NP_441022.1_1 Reverse -182 -191 12.6973 0.232
NP_442346.1_2 Forward -305 -286 9.53756 0.216
NP_442346.1_5 Reverse -260 -270 9.7148 0.118
NP_440545.1_5 Forward -299 -282 4.16874 0.26
NP_440025.1_4 Reverse -107 -126 11.7992 0.234
NP_440831.1_3 Forward -291 -272 6.19299 0.275
NP_441923.1_6 Forward -365 -351 8.55439 0.278
NP_440459.1_2 Forward -303 -286 9.57695 0.224
NP_441112.1_6 Reverse -32 -51 -2.26216 0.296
NP_441973.1_1 Reverse -248 -263 -7.98491 0.293
NP_440590.1_4 Forward -300 -287 0.707601 0.144
NP_440590.1_4 Reverse -27 -40 -5.09393 0.274
NP_440567.1_1 Reverse -262 -276 1.57289 0.2
NP_442643.1_1 Forward -300 -281 -11.7019 0.231
NP_442629.1_3 Forward -106 -87 2.0644 0.275
NP_442629.1_5 Forward -137 -123 15.0442 0.279
NP_442772.1_6 Forward -193 -174 16.4644 0.196
NP_440401.1_5 Reverse -279 -293 13.9626 0.277
NP_441879.1_6 Forward -297 -278 13.9625 0.202
NP_442479.1_9 Forward -192 -173 -8.35868 0.266
NP_441474.1_1 Reverse -113 -132 -0.492971 0.255
NP_441084.1_6 Reverse -294 -308 10.6046 0.234
NP_441811.1_8 Forward -276 -262 9.73436 0.225
NP_441811.1_8 Reverse -20 -34 6.19444 0.283
NP_440505.1_3 Reverse -259 -269 5.87989 0.206
NP_440207.2_8 Forward -351 -332 16.1257 0.258
NP_442533.1_1 Forward -369 -350 -13.3736 0.237
NP_442533.1_1 Forward -110 -91 -17.9951 0.299
NP_442533.1_6 Reverse -261 -270 4.0313 0.194
NP_442533.1_6 Forward -294 -285 1.76968 0.289
NP_441089.1_6 Reverse -71 -90 9.14423 0.258
NP_440263.1_2 Reverse -259 -278 17.2065 0.229
NP_442232.1_3 Forward -278 -259 -14.8485 0.288
NP_442322.1_4 Reverse -288 -305 -1.63347 0.226
NP_442322.1_4 Reverse -192 -209 -9.59824 0.295
NP_440116.1_8 Forward -293 -274 -5.21209 0.188
NP_441527.1_4 Forward -258 -239 -11.6982 0.284
NP_441972.1_3 Forward -294 -275 14.1591 0.198
NP_440480.1_10 Reverse -120 -134 17.4035 0.224
NP_441869.1_4 Reverse -65 -84 10.0292 0.208
NP_442588.1_6 Forward -213 -194 -3.24547 0.296
NP_442306.1_10 Reverse -256 -275 -21.7317 0.286
NP_440404.1_9 Forward -89 -70 12.8432 0.202
NP_442800.1_7 Reverse -21 -40 2.26107 0.296
NP_441069.1_5 Reverse -276 -294 1.29745 0.261
NP_441463.1_2 Forward -200 -182 2.67729 0.226
NP_440501.1_2 Forward -300 -281 7.7676 0.289
NP_441431.1_2 Reverse -282 -296 7.27547 0.244
NP_441993.1_1 Forward -126 -107 1.55686 0.274
NP_441993.1_1 Forward -300 -281 0.484826 0.298
NP_441174.1_4 Forward -254 -244 13.2547 0.267
NP_440814.1_8 Forward -253 -234 0.294447 0.269
NP_440492.1_4 Reverse -176 -195 16.8907 0.139
NP_441156.1_1 Forward -357 -338 10.2259 0.261
NP_441510.2_1 Reverse -272 -291 7.57094 0.209
NP_440287.1_5 Reverse -345 -364 18.0915 0.0964
NP_441272.1_7 Forward -300 -290 14.9263 0.2
NP_442103.1_1 Reverse -288 -302 12.9793 0.266
NP_440457.1_1 Reverse -208 -220 0.825626 0.25
NP_440457.1_1 Forward -294 -282 0.628964 0.25
NP_443000.1_3 Forward -366 -347 14.4312 0.228
NP_443000.1_7 Reverse -259 -269 7.74818 0.0666
NP_440560.1_5 Reverse -345 -364 10.679 0.259
NP_441397.1_8 Forward -254 -241 14.7675 0.181
NP_443010.1_10 Forward -273 -256 2.09436 0.283
NP_441122.1_1 Forward -370 -355 3.42148 0.281
NP_439962.1_4 Reverse -85 -104 0.0977854 0.197
NP_440175.1_7 Forward -381 -363 10.1438 0.267
NP_440149.1_8 Forward -111 -92 -5.21209 0.221
NP_441105.1_3 Forward -398 -379 -9.83364 0.297
NP_440216.1_1 Forward -270 -256 -12.1934 0.247
NP_440172.1_1 Reverse -261 -271 13.7464 0.0185
NP_440249.1_2 Reverse -180 -190 14.7292 0.273
NP_440198.1_10 Forward -134 -115 12.4875 0.265
NP_442379.1_10 Forward -277 -260 -3.79607 0.268
NP_439971.2_8 Forward -255 -241 19.7641 0.0708
NP_442417.1_5 Reverse -125 -139 4.52282 0.292
NP_443052.1_9 Reverse -275 -294 -1.96717 0.231
NP_440072.1_5 Forward -300 -282 -1.65248 0.259
NP_442154.1_1 Forward -293 -275 -14.3372 0.218
NP_442154.1_1 Forward -365 -347 -15.0255 0.218
NP_442154.1_1 Forward -344 -326 -15.3205 0.218
NP_442226.1_8 Forward -47 -37 14.1397 0.26
NP_442564.1_9 Reverse -261 -275 16.2482 0.219
NP_440988.1_10 Forward -217 -203 4.89883 0.249
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTCATATTGACCTAGACCCCGCAGGTTATTGGTTGGTCATGGTGGAGCGGGAAGCTGGAGTGTTGAAGGTGGAGCACTACAGTAACGATATTAATGACCAGGGTTTGGCGGTGGATCCGGAAACGGGGGAAGTGATTGCCTGTCAAGGGGGGAGAAAAAGACTACCCAGTTTGACTTTAACTGGTCGCACTGCCAAGGAGTTGTGCGTGAAGATTTTTGAGGAGTTGGAATCCTGTCCAGTGACTATGCTCAACCATGCTGCTTACTTGGGTCGGGAATTGATGCGGGCGGAATTAGCTCTAACTGGGGGCGGAGAATATATTCAGGATTAGTTAAACCGTCCTAAATAAGCAAATTTTGTCAGCGGCAATCAATAGCAACAAATCTGGAGACTGAAACC

CDS

ATGAAAATTTTACCGGCGATCGATCTGCTAGGTGGCAAGTGTGTGCGCCTCTATCAAGGGGATTATGACCAGTCCCAGGTGTACCACGAAGATCCGGTGGAAGTAGCCCGCCAGTGGCAAGCCCAGGGAGCTAGTCGTTTGCATTTAGTCGATCTTGATGGAGCTAAGGAAGGACAACCAGTTAACCTAACGGCGATCGCCAATATTGTTGAAGCCCTAACCATTCCTGTACAGGTAGGCGGAGGCTTAAGGGATAGAAACCGGGTCAAACAATTGCTGGATTTGGGGGTGGGCCGAGTTATTCTAGGTACGATCGCCGTGGAAAATCCTGACTTAGTGGGGGAATTATGTGCCGAATTTCCTGGGCAAATTGTGGTGGGTATTGATGCCCGCAATGGCAAAGTGGCCACTAGGGGGTGGTTAGAAACTTCTACGGTGGAAGCGGGGGAATTGGCCCAACGCATGGAAAAGCTAGGAGCGGCGGCCATTATCTACACTGATATTCACCGGGATGGCACAATGCAGGGGCCCAACTTAGATGCTCTGCGACAATTAGCTAGTCAGTTAACCATTCCAGTGATTGCATCGGGGGGAGTCAGCCAAGTAGAAGACCTGTTGAATCTGCTTAGCTTGGAAAGTCTGGGGGTCAATGGAGTCATCATCGGCAAAGCCCTTTACACCGGGGACATTCAGTTGGCAGAAGCAATCCGGGCAGTGGGCAATGGTCGCTGGCAAGATGTGCCGCCGTTGGACTTTCCCCGTTTGGGCTAG

Protein

MKILPAIDLLGGKCVRLYQGDYDQSQVYHEDPVEVARQWQAQGASRLHLVDLDGAKEGQPVNLTAIANIVEALTIPVQVGGGLRDRNRVKQLLDLGVGRVILGTIAVENPDLVGELCAEFPGQIVVGIDARNGKVATRGWLETSTVEAGELAQRMEKLGAAAIIYTDIHRDGTMQGPNLDALRQLASQLTIPVIASGGVSQVEDLLNLLSLESLGVNGVIIGKALYTGDIQLAEAIRAVGNGRWQDVPPLDFPRLG