Your browser is old and dusty. Try Google Chrome!

Details for slr0650

ORF slr0650
Accession NP_442302.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -328 -342 13.2743 0.181
NP_441061.1_2 Reverse -265 -279 3.8345 0.159
NP_441061.1_2 Forward -272 -258 1.96621 0.179
NP_440795.1_7 Forward -272 -265 14.6904 0.0123
NP_440795.1_7 Reverse -265 -272 14.6904 0.0123
NP_442100.1_1 Forward -103 -84 8.16414 0.24
NP_441418.1_6 Forward -273 -254 -19.3717 0.0876
NP_442291.1_5 Reverse -263 -279 3.20513 0.114
NP_440897.1_6 Forward -273 -254 12.0933 0.0705
NP_441453.1_1 Reverse -257 -275 5.62325 0.246
NP_441453.1_4 Reverse -264 -272 16.539 0.00633
NP_441453.1_4 Forward -273 -265 16.539 0.00633
NP_442151.1_6 Reverse -264 -278 21.4357 0.0045
NP_442151.1_6 Forward -273 -259 10.816 0.114
NP_440561.1_4 Forward -275 -256 12.9187 0.231
NP_441818.1_1 Reverse -265 -276 16.0861 0.0221
NP_441818.1_1 Forward -272 -261 9.69459 0.232
NP_441818.1_9 Reverse -220 -239 -9.93197 0.291
NP_441098.1_3 Reverse -101 -120 -1.71666 0.277
NP_442655.1_10 Forward -276 -257 -19.4701 0.282
NP_442173.1_1 Forward -272 -264 15.4574 0.00633
NP_442173.1_1 Reverse -265 -273 15.4574 0.00633
NP_442752.1_4 Forward -273 -266 13.8055 0.0199
NP_442752.1_4 Reverse -264 -271 13.8055 0.0199
NP_443027.1_4 Reverse -262 -272 14.828 0.0437
NP_443027.1_4 Forward -275 -265 13.1564 0.0521
NP_441812.1_3 Forward -274 -260 9.14437 0.245
NP_442975.1_10 Reverse -260 -274 22.615 0.000219
NP_442975.1_10 Forward -277 -263 4.03056 0.249
NP_441675.1_4 Forward -52 -33 2.94938 0.286
NP_440784.1_7 Forward -272 -265 15.9687 0.0123
NP_440784.1_7 Reverse -265 -272 15.9687 0.0123
NP_440061.1_9 Reverse -262 -276 11.012 0.117
NP_440061.1_9 Reverse -247 -261 8.3571 0.177
NP_440110.1_8 Forward -275 -256 1.27776 0.211
NP_441054.1_2 Reverse -188 -207 19.3707 0.0953
NP_440878.1_9 Forward -283 -264 5.211 0.174
NP_442062.1_3 Reverse -73 -92 10.6192 0.152
NP_442062.1_3 Forward -100 -81 3.44104 0.208
NP_442062.1_3 Forward -110 -91 1.27776 0.23
NP_442062.1_8 Forward -273 -263 19.4496 0.000558
NP_442062.1_8 Reverse -264 -274 17.3846 0.00193
NP_440761.1_4 Forward -278 -259 -12.4886 0.257
NP_440304.1_4 Reverse -262 -272 10.8948 0.051
NP_440304.1_4 Forward -275 -265 9.91146 0.051
NP_440304.1_4 Forward -126 -116 2.7333 0.299
NP_442242.1_4 Forward -272 -265 14.3954 0.0124
NP_442242.1_4 Reverse -265 -272 14.3954 0.0124
NP_440044.1_8 Reverse -265 -284 12.9791 0.0381
NP_440044.1_8 Forward -272 -253 9.53756 0.0666
NP_440916.1_1 Forward -203 -189 11.2093 0.206
NP_442359.1_2 Forward -381 -362 1.76941 0.0883
NP_441208.1_9 Forward -276 -262 11.5043 0.15
NP_441594.1_6 Reverse -255 -274 2.75272 0.244
NP_442110.1_7 Reverse -264 -278 17.5025 0.0233
NP_442110.1_7 Forward -273 -259 11.701 0.0593
NP_442259.1_3 Reverse -187 -206 13.1758 0.176
NP_442726.1_7 Reverse -250 -268 1.88744 0.229
NP_441083.1_5 Reverse -264 -274 20.3345 0.00053
NP_441083.1_5 Forward -273 -263 11.3864 0.0159
NP_442827.1_8 Forward -281 -262 3.83357 0.143
NP_442841.1_3 Reverse -108 -127 15.8299 0.109
NP_441434.1_7 Reverse -266 -280 4.32615 0.225
NP_440109.1_7 Reverse -101 -120 18.584 0.135
NP_441738.1_2 Forward -271 -264 15.28 0.0102
NP_441738.1_2 Reverse -266 -273 15.28 0.0102
NP_441558.1_5 Reverse -262 -281 4.81767 0.269
NP_440209.1_1 Reverse -264 -272 18.1123 0.00295
NP_440209.1_1 Forward -273 -265 18.1123 0.00295
NP_442136.1_1 Reverse -91 -110 6.19431 0.3
NP_442889.1_8 Reverse -261 -275 13.4703 0.0588
NP_442889.1_10 Forward -93 -74 12.35 0.207
NP_440447.1_6 Forward -363 -345 3.55906 0.191
NP_441770.1_10 Reverse -352 -371 8.94757 0.269
NP_440178.1_7 Reverse -263 -282 -14.3569 0.153
NP_441716.1_1 Reverse -264 -278 3.8345 0.259
NP_441716.1_2 Reverse -88 -107 11.3948 0.214
NP_441716.1_2 Reverse -87 -106 0.00601367 0.266
NP_441327.1_1 Forward -106 -87 4.11727 0.274
NP_442111.1_4 Forward -274 -260 10.7177 0.0518
NP_440906.1_5 Forward -272 -265 15.8704 0.0124
NP_440906.1_5 Reverse -265 -272 15.8704 0.0124
NP_440438.2_8 Forward -110 -91 6.88262 0.168
NP_440747.1_10 Forward -276 -264 7.51213 0.00286
NP_440747.1_10 Reverse -261 -273 -2.02597 0.0196
NP_441130.1_10 Reverse -262 -276 19.4691 0.0108
NP_441130.1_10 Forward -275 -261 8.16106 0.14
NP_441486.1_1 Reverse -261 -275 13.1759 0.00897
NP_441486.1_1 Forward -276 -262 11.406 0.0164
NP_442145.1_4 Forward -91 -72 15.135 0.0898
NP_442145.1_4 Forward -101 -82 9.59652 0.175
NP_442145.1_4 Reverse -81 -100 6.15881 0.225
NP_442145.1_4 Forward -111 -92 3.10306 0.299
NP_442330.1_4 Reverse -326 -345 16.0196 0.233
NP_442634.1_4 Forward -275 -261 -3.63866 0.161
NP_440403.1_4 Forward -282 -263 -1.96717 0.174
NP_440403.1_10 Reverse -255 -274 7.7676 0.205
NP_440842.1_4 Forward -100 -81 1.90601 0.238
NP_440842.1_4 Forward -110 -91 1.8096 0.238
NP_441014.1_10 Forward -274 -255 3.73524 0.206
NP_442848.1_1 Forward -279 -265 15.8309 0.0143
NP_442848.1_1 Reverse -258 -272 -2.55701 0.263
NP_443018.1_3 Forward -272 -265 14.8871 0.0123
NP_443018.1_3 Reverse -265 -272 14.8871 0.0123
NP_441316.1_7 Reverse -262 -277 -3.26502 0.273
NP_441634.1_8 Forward -275 -261 5.21113 0.114
NP_441634.1_8 Reverse -262 -276 2.45787 0.167
NP_440376.1_1 Forward -273 -264 19.4693 0.000692
NP_440376.1_1 Reverse -264 -273 19.4693 0.000692
NP_441857.1_5 Forward -280 -262 8.08229 0.185
NP_441002.1_5 Reverse -79 -98 8.75091 0.298
NP_441588.1_4 Reverse -266 -276 8.63316 0.14
NP_441588.1_4 Forward -271 -261 6.96153 0.178
NP_442687.1_7 Reverse -263 -273 15.8113 0.0125
NP_442687.1_7 Forward -274 -264 8.92815 0.0994
NP_441077.1_2 Reverse -92 -111 4.91741 0.224
NP_441077.1_2 Reverse -26 -45 2.05265 0.28
NP_441077.1_2 Reverse -37 -56 0.238307 0.299
NP_441077.1_6 Forward -96 -80 10.6108 0.16
NP_441077.1_6 Reverse -77 -93 9.83957 0.164
NP_441077.1_6 Reverse -97 -113 3.95875 0.261
NP_442485.1_3 Reverse -253 -272 2.65439 0.209
NP_441422.1_7 Reverse -262 -279 -0.551145 0.168
NP_440360.1_9 Reverse -81 -100 8.25926 0.243
NP_440360.1_10 Reverse -215 -229 1.86788 0.282
NP_442658.1_1 Reverse -262 -272 15.9091 0.00966
NP_442658.1_1 Forward -275 -265 9.616 0.147
NP_440141.1_3 Reverse -249 -268 2.94938 0.274
NP_440656.1_8 Reverse -253 -272 -0.885524 0.166
NP_441414.1_9 Reverse -264 -283 -8.35868 0.234
NP_440184.1_1 Forward -109 -90 15.7004 0.0864
NP_440184.1_1 Reverse -94 -113 7.94844 0.155
NP_440184.1_7 Forward -114 -95 19.4303 0.116
NP_440184.1_7 Reverse -35 -54 16.5656 0.182
NP_440720.1_1 Forward -284 -265 4.22769 0.26
NP_442937.1_5 Forward -278 -259 7.96426 0.237
NP_441958.1_5 Forward -274 -264 12.2714 0.00183
NP_441958.1_5 Reverse -263 -273 12.2714 0.00183
NP_441127.1_1 Reverse -58 -72 9.73436 0.268
NP_442605.1_4 Reverse -187 -206 8.75091 0.291
NP_442836.1_5 Forward -279 -260 14.8474 0.0588
NP_443001.1_7 Forward -272 -253 1.96607 0.279
NP_440984.1_7 Forward -278 -264 10.3243 0.126
NP_439990.1_5 Forward -278 -265 11.7207 0.128
NP_442690.1_1 Reverse -84 -103 17.699 0.0179
NP_442690.1_1 Forward -89 -70 -8.65367 0.189
NP_442690.1_1 Forward -106 -87 -12.8819 0.25
NP_442911.1_1 Forward -110 -97 15.627 0.271
NP_441580.1_6 Reverse -253 -272 10.4225 0.0559
NP_441580.1_6 Reverse -355 -374 -6.98204 0.235
NP_440153.1_5 Reverse -265 -279 11.3077 0.0763
NP_440153.1_5 Forward -272 -258 1.67122 0.245
NP_440993.1_2 Reverse -259 -275 9.39998 0.12
NP_440993.1_2 Forward -278 -262 4.68009 0.249
NP_440602.1_8 Forward -273 -259 9.5377 0.298
NP_441348.1_3 Forward -278 -259 6.39097 0.281
NP_441099.1_5 Reverse -254 -273 -11.7019 0.288
NP_442002.1_9 Reverse -263 -270 10.7572 0.185
NP_441712.1_1 Reverse -96 -115 13.2896 0.251
NP_441712.1_1 Reverse -106 -125 12.8065 0.251
NP_441294.1_7 Reverse -260 -274 15.9698 0.0176
NP_442438.1_10 Reverse -259 -273 16.5192 0.0212
NP_442438.1_10 Forward -278 -264 15.7325 0.0253
NP_442431.1_7 Reverse -287 -306 12.5858 0.175
NP_441000.1_6 Forward -274 -260 -3.44199 0.221
NP_441000.1_6 Reverse -263 -277 -4.91696 0.254
NP_440147.1_4 Reverse -262 -275 12.8023 0.0326
NP_440147.1_4 Forward -275 -262 0.805932 0.244
NP_440147.1_4 Forward -365 -352 0.0192843 0.268
NP_441550.1_8 Forward -275 -265 16.7941 0.00906
NP_441550.1_8 Reverse -262 -272 6.0761 0.214
NP_441916.1_7 Forward -273 -263 18.4663 0.00144
NP_441916.1_7 Reverse -264 -274 10.3048 0.0261
NP_440345.1_3 Reverse -87 -101 14.2399 0.215
NP_441041.1_4 Forward -273 -254 -0.39387 0.0954
NP_441041.1_7 Forward -276 -264 12.4708 0.0611
NP_441041.1_7 Reverse -261 -273 10.916 0.0864
NP_440569.1_10 Reverse -33 -52 7.20922 0.231
NP_441725.1_5 Forward -272 -262 11.2881 0.0247
NP_441725.1_5 Reverse -265 -275 9.02648 0.0553
NP_439966.1_7 Reverse -262 -272 18.4657 0.00473
NP_439966.1_7 Forward -275 -265 14.8275 0.0177
NP_439966.1_9 Reverse -262 -271 0.983037 0.253
NP_439966.1_9 Forward -275 -266 0.884706 0.253
NP_442941.1_3 Forward -272 -262 11.4848 0.0116
NP_442941.1_3 Reverse -265 -275 10.9931 0.0116
NP_440289.1_2 Reverse -261 -274 21.3571 0.00262
NP_440289.1_2 Forward -276 -263 4.93583 0.0636
NP_440260.1_7 Reverse -189 -208 -5.9004 0.279
NP_440260.1_8 Forward -289 -271 -7.45401 0.295
NP_442281.1_1 Reverse -259 -273 19.6651 0.00247
NP_442281.1_1 Forward -278 -264 14.8469 0.0155
NP_441334.1_7 Forward -275 -256 -21.3384 0.296
NP_441079.1_7 Forward -96 -77 -4.81951 0.254
NP_440437.1_1 Reverse -258 -277 8.94757 0.0533
NP_442500.1_2 Reverse -227 -246 7.27595 0.283
NP_442500.1_8 Reverse -96 -110 9.79275 0.275
NP_442012.1_1 Forward -293 -274 2.65439 0.196
NP_441457.1_7 Forward -275 -256 6.98095 0.17
NP_442982.1_5 Forward -283 -264 -2.75381 0.289
NP_443030.1_4 Reverse -257 -276 -3.83545 0.251
NP_442068.1_4 Forward -67 -48 3.83357 0.299
NP_441644.1_6 Reverse -264 -274 17.3841 0.00127
NP_441644.1_6 Forward -273 -263 10.1076 0.0628
NP_441071.1_2 Reverse -41 -60 24.9707 0.00804
NP_441071.1_2 Reverse -40 -59 17.5223 0.231
NP_442215.1_2 Forward -275 -259 14.4149 0.0205
NP_442215.1_2 Reverse -262 -278 8.22001 0.0666
NP_442029.1_1 Reverse -220 -239 -14.8485 0.272
NP_442029.1_6 Forward -278 -259 4.71934 0.265
NP_440253.1_2 Forward -273 -255 14.1788 0.0208
NP_440253.1_2 Reverse -264 -282 5.32902 0.0936
NP_440929.1_8 Forward -273 -264 19.2726 0.000701
NP_440929.1_8 Reverse -264 -273 19.2726 0.000701
NP_442933.1_10 Forward -273 -264 17.601 0.00325
NP_442933.1_10 Reverse -264 -273 17.601 0.00325
NP_440382.1_2 Reverse -107 -126 15.3382 0.114
NP_441751.2_8 Reverse -265 -279 -4.52363 0.174
NP_442926.1_5 Forward -368 -349 13.0855 0.171
NP_442554.1_8 Reverse -265 -275 18.0729 0.00543
NP_442554.1_8 Forward -272 -262 13.8447 0.0145
NP_442863.1_5 Forward -269 -250 15.3391 0.244
NP_441762.1_7 Reverse -263 -275 11.8387 0.0142
NP_441762.1_7 Forward -274 -262 2.89058 0.0676
NP_442142.1_4 Reverse -261 -274 15.85 0.0264
NP_442142.1_4 Forward -276 -263 14.7683 0.0302
NP_442292.1_1 Reverse -265 -274 18.486 0.00229
NP_442292.1_1 Forward -272 -263 9.63616 0.0183
NP_442292.1_5 Forward -277 -258 9.24257 0.138
NP_440045.1_3 Forward -145 -128 10.7562 0.142
NP_442476.1_6 Reverse -265 -279 3.24451 0.161
NP_443009.1_2 Forward -242 -223 0.0977854 0.216
NP_443009.1_5 Forward -274 -263 18.3477 0.00265
NP_441715.1_4 Forward -272 -262 16.303 0.0117
NP_441715.1_4 Reverse -265 -275 7.84651 0.107
NP_440279.1_2 Reverse -238 -257 6.78429 0.246
NP_440158.1_1 Forward -98 -79 20.8646 0.017
NP_441198.1_5 Reverse -266 -279 16.8333 0.206
NP_440379.1_5 Reverse -255 -274 -7.27704 0.242
NP_441758.1_10 Reverse -80 -99 2.9486 0.189
NP_441758.1_10 Forward -103 -84 1.27698 0.194
NP_441468.1_1 Forward -272 -265 15.8704 0.0124
NP_441468.1_1 Reverse -265 -272 15.8704 0.0124
NP_441020.2_6 Forward -275 -258 7.80699 0.218
NP_441020.2_6 Reverse -262 -279 5.64371 0.293
NP_441015.1_10 Forward -278 -259 -2.45882 0.178
NP_441673.1_1 Forward -273 -264 20.8459 0.000698
NP_441673.1_1 Reverse -264 -273 20.8459 0.000698
NP_441096.1_5 Forward -72 -54 17.0296 0.297
NP_441876.1_9 Reverse -218 -228 11.8776 0.269
NP_441826.1_2 Forward -279 -265 23.5007 0.00229
NP_441826.1_2 Reverse -258 -272 13.6676 0.0214
NP_441764.1_1 Reverse -83 -102 23.3039 0.0138
NP_441764.1_4 Reverse -91 -108 13.8968 0.154
NP_441764.1_4 Forward -102 -85 12.7509 0.181
NP_441764.1_4 Reverse -81 -98 11.5095 0.22
NP_442868.1_6 Forward -275 -265 17.4829 0.012
NP_442868.1_6 Reverse -262 -272 0.963343 0.205
NP_442719.1_2 Forward -75 -57 -9.02799 0.259
NP_441612.1_2 Reverse -264 -274 8.54929 0.21
NP_442361.1_3 Reverse -258 -271 9.75405 0.272
NP_442808.1_1 Reverse -263 -273 18.4657 0.00201
NP_442808.1_1 Forward -274 -264 8.63269 0.0481
NP_442775.1_6 Forward -278 -259 19.5673 0.226
NP_440145.1_3 Forward -283 -264 6.4893 0.0511
NP_442542.1_2 Forward -275 -262 4.54251 0.3
NP_442542.1_9 Reverse -257 -271 11.1104 0.111
NP_442050.1_5 Forward -275 -265 15.6142 0.01
NP_442050.1_5 Reverse -262 -272 9.12434 0.193
NP_440558.1_2 Reverse -255 -274 -6.58872 0.277
NP_442789.1_4 Forward -275 -256 -2.45882 0.237
NP_441518.1_3 Reverse -254 -273 -13.5702 0.264
NP_441878.1_6 Forward -274 -264 10.4031 0.0176
NP_441878.1_6 Reverse -263 -273 10.4031 0.0176
NP_441878.1_6 Reverse -353 -363 -7.19813 0.21
NP_441036.1_8 Reverse -263 -273 17.7779 0.000554
NP_441036.1_8 Forward -274 -264 8.33817 0.174
NP_441557.1_5 Forward -273 -264 19.9609 0.000699
NP_441557.1_5 Reverse -264 -273 19.9609 0.000699
NP_442066.2_4 Forward -273 -254 -1.08219 0.182
NP_442066.2_4 Reverse -264 -283 -6.68705 0.254
NP_442066.2_9 Forward -277 -264 8.08242 0.193
NP_441433.1_8 Forward -65 -46 -1.47551 0.258
NP_440084.1_8 Forward -92 -78 11.1842 0.251
NP_440084.1_8 Forward -93 -79 9.84729 0.271
NP_441308.1_8 Reverse -262 -272 10.1081 0.22
NP_440101.1_5 Reverse -257 -276 3.14605 0.206
NP_442183.1_1 Forward -273 -259 11.996 0.0648
NP_442183.1_1 Reverse -264 -278 8.55439 0.113
NP_440086.1_4 Reverse -88 -102 17.1032 0.244
NP_441819.1_5 Reverse -85 -104 17.4269 0.157
NP_441819.1_5 Reverse -84 -103 13.6072 0.206
NP_442347.1_2 Reverse -265 -274 12.4878 0.056
NP_442347.1_2 Forward -272 -263 11.1111 0.056
NP_442347.1_2 Forward -336 -327 6.8829 0.145
NP_442645.1_2 Reverse -346 -365 -13.8652 0.165
NP_442645.1_2 Forward -281 -262 -21.0434 0.29
NP_442965.1_2 Reverse -52 -71 -7.57203 0.273
NP_441037.1_4 Forward -275 -265 9.55921 0.21
NP_441037.1_4 Reverse -262 -272 7.02532 0.237
NP_442508.1_8 Reverse -315 -332 9.38028 0.292
NP_440151.1_5 Reverse -187 -206 3.14605 0.289
NP_441633.1_3 Reverse -262 -275 6.01747 0.0481
NP_441633.1_3 Forward -275 -262 1.29759 0.109
NP_440136.1_2 Forward -272 -265 15.9687 0.0123
NP_440136.1_2 Reverse -265 -272 15.9687 0.0123
NP_442590.1_10 Forward -279 -260 5.30933 0.264
NP_441728.2_4 Forward -103 -84 13.7982 0.241
NP_442998.1_5 Reverse -193 -203 14.533 0.149
NP_442998.1_10 Forward -271 -264 15.5754 0.0102
NP_442998.1_10 Reverse -266 -273 15.5754 0.0102
NP_440899.1_2 Reverse -253 -272 5.2102 0.295
NP_440899.1_8 Reverse -245 -264 -4.03212 0.231
NP_440299.1_1 Forward -277 -264 13.5883 0.0298
NP_440299.1_1 Reverse -260 -273 11.9167 0.0427
NP_441799.1_1 Forward -277 -263 6.29216 0.176
NP_441007.1_10 Forward -278 -265 10.4424 0.0656
NP_442334.1_1 Forward -270 -251 -5.01543 0.265
NP_442201.1_10 Forward -374 -355 -14.9469 0.295
NP_440256.1_1 Forward -276 -257 18.584 0.0045
NP_440256.1_1 Reverse -261 -280 -7.76869 0.245
NP_441362.1_2 Forward -105 -86 6.13106 0.243
NP_440709.1_1 Forward -102 -83 13.2733 0.045
NP_441559.1_8 Forward -71 -57 -3.54032 0.205
NP_441559.1_8 Forward -342 -328 -5.9986 0.271
NP_441559.1_8 Reverse -259 -273 -6.29359 0.276
NP_441559.1_8 Reverse -285 -299 -6.49025 0.279
NP_440525.1_1 Reverse -81 -100 10.9142 0.224
NP_442302.1_1 Forward -379 -360 24.3855 0.00775
NP_442302.1_2 Forward -355 -336 27.5321 0.00158
NP_442302.1_3 Forward -313 -294 29.9904 0.0000194
NP_442302.1_4 Forward -190 -171 23.303 0.0317
NP_442302.1_8 Forward -400 -381 20.649 0.252
NP_442302.1_9 Forward -124 -105 16.4673 0.273
NP_440915.1_6 Forward -277 -263 14.0609 0.0187
NP_440915.1_6 Reverse -260 -274 6.3911 0.0826
NP_442158.1_2 Reverse -77 -96 18.0953 0.247
NP_442158.1_4 Forward -296 -286 14.4347 0.182
NP_440717.1_1 Reverse -265 -284 5.50599 0.272
NP_441704.1_8 Forward -135 -116 7.07848 0.249
NP_442069.1_3 Reverse -267 -286 19.3707 0.146
NP_440702.1_2 Reverse -113 -132 -5.9004 0.257
NP_440306.1_8 Reverse -38 -57 -0.197979 0.211
NP_440306.1_8 Forward -55 -36 -3.44288 0.282
NP_441939.1_3 Reverse -265 -284 6.4893 0.235
NP_441199.1_7 Reverse -80 -99 4.32602 0.235
NP_442993.1_1 Forward -273 -257 -7.21796 0.146
NP_442386.1_9 Reverse -263 -272 15.7322 0.0144
NP_442386.1_9 Forward -274 -265 13.8639 0.0289
NP_441340.1_5 Forward -272 -265 15.6737 0.0124
NP_441340.1_5 Reverse -265 -272 15.6737 0.0124
NP_441947.1_4 Reverse -253 -272 17.6007 0.0836
NP_442484.1_2 Reverse -145 -164 1.86774 0.226
NP_442791.1_5 Reverse -224 -243 -10.4236 0.279
NP_442240.1_2 Reverse -240 -259 -20.5517 0.295
NP_440586.1_8 Forward -272 -265 13.2151 0.026
NP_440586.1_8 Reverse -265 -272 13.2151 0.026
NP_442251.1_6 Forward -272 -265 15.2804 0.0124
NP_442251.1_6 Reverse -265 -272 15.2804 0.0124
NP_441262.1_3 Reverse -264 -271 14.7888 0.0223
NP_441262.1_3 Forward -273 -266 14.7888 0.0223
NP_443051.1_1 Reverse -263 -272 10.4228 0.00754
NP_443051.1_1 Forward -274 -265 10.4228 0.00754
NP_439937.1_9 Forward -68 -51 -13.7281 0.287
NP_440408.1_3 Forward -279 -260 -1.57384 0.238
NP_440439.1_1 Forward -276 -263 1.39592 0.156
NP_440439.1_1 Reverse -261 -274 1.19926 0.159
NP_440372.1_2 Forward -272 -265 16.3621 0.0124
NP_440372.1_2 Reverse -265 -272 16.3621 0.0124
NP_440171.1_3 Reverse -325 -344 2.94938 0.284
NP_440574.1_3 Reverse -259 -278 2.3594 0.173
NP_442511.1_5 Forward -203 -184 10.4615 0.291
NP_441803.1_2 Reverse -259 -278 16.7157 0.0334
NP_441803.1_2 Forward -278 -259 6.78429 0.149
NP_439977.1_5 Reverse -258 -277 7.07928 0.125
NP_439977.1_5 Forward -279 -260 2.45773 0.173
NP_440139.1_1 Reverse -258 -277 9.43841 0.0992
NP_441572.1_7 Reverse -258 -277 -3.04881 0.206
NP_442384.1_10 Forward -273 -260 8.37742 0.0656
NP_442384.1_10 Reverse -264 -277 3.95252 0.172
NP_441877.1_9 Reverse -81 -98 12.9202 0.127
NP_441877.1_9 Forward -55 -38 4.46374 0.284
NP_441877.1_9 Forward -56 -39 4.3654 0.284
NP_441877.1_9 Reverse -38 -55 3.67709 0.284
NP_441877.1_9 Forward -111 -94 3.18543 0.284
NP_441877.1_9 Forward -112 -95 2.30045 0.292
NP_441018.1_7 Forward -277 -258 11.4058 0.185
NP_442262.1_10 Forward -272 -265 14.1988 0.0123
NP_442262.1_10 Reverse -265 -272 14.1988 0.0123
NP_441689.1_5 Reverse -262 -272 8.53436 0.132
NP_441689.1_5 Forward -275 -265 5.87944 0.197
NP_440163.1_10 Reverse -261 -271 15.2213 0.0762
NP_440344.1_10 Reverse -257 -274 21.18 0.00159
NP_440344.1_10 Forward -280 -263 -8.0243 0.121
NP_440344.1_10 Reverse -50 -67 -13.3342 0.282
NP_440344.1_10 Reverse -151 -168 -13.5308 0.287
NP_442832.1_3 Reverse -232 -251 11.8975 0.288
NP_440562.1_3 Reverse -265 -282 18.5251 0.0506
NP_440562.1_10 Reverse -204 -222 6.01734 0.284
NP_440297.1_9 Forward -272 -262 9.32148 0.0917
NP_440297.1_9 Reverse -265 -275 -0.216628 0.282
NP_441592.1_4 Reverse -264 -283 0.491109 0.23
NP_441592.1_10 Forward -207 -193 15.1419 0.279
NP_441896.1_3 Forward -282 -263 0.687771 0.224
NP_441896.1_3 Reverse -255 -274 0.392778 0.226
NP_441103.1_9 Forward -63 -53 12.4895 0.291
NP_440894.1_10 Reverse -259 -278 16.9124 0.0672
NP_440894.1_10 Forward -278 -259 10.5209 0.155
NP_440999.1_9 Reverse -260 -274 14.1593 0.0277
NP_440999.1_9 Forward -277 -263 4.81781 0.115
NP_440888.1_2 Reverse -264 -278 21.8284 0.000484
NP_440888.1_2 Forward -273 -259 19.8618 0.000937
NP_442454.1_2 Reverse -72 -91 18.4773 0.251
NP_441771.1_8 Forward -43 -24 14.6576 0.0893
NP_440600.1_9 Reverse -88 -107 10.3605 0.297
NP_440179.1_4 Forward -158 -144 20.0591 0.127
NP_440491.1_1 Forward -276 -257 11.7899 0.161
NP_440491.1_1 Reverse -261 -280 10.6204 0.184
NP_440052.1_5 Reverse -253 -272 2.3594 0.165
NP_442033.1_10 Reverse -262 -281 -3.83545 0.171
NP_442033.1_10 Forward -224 -205 -14.2585 0.298
NP_441123.1_6 Forward -281 -263 10.5406 0.215
NP_441543.1_2 Forward -272 -263 18.486 0.00236
NP_441543.1_2 Reverse -265 -274 16.9127 0.00359
NP_442845.1_2 Forward -279 -265 5.21113 0.24
NP_442845.1_2 Reverse -258 -272 4.62115 0.256
NP_442710.1_7 Forward -97 -78 -4.91611 0.274
NP_442710.1_7 Reverse -76 -95 -8.27995 0.299
NP_441469.1_8 Reverse -263 -272 16.126 0.00797
NP_441469.1_8 Forward -274 -265 6.48957 0.227
NP_442315.1_1 Forward -391 -373 2.87075 0.294
NP_443064.1_6 Reverse -264 -274 12.5669 0.0796
NP_442646.1_7 Reverse -310 -329 5.70265 0.273
NP_442578.1_7 Forward -272 -265 14.5921 0.026
NP_442578.1_7 Reverse -265 -272 14.5921 0.026
NP_441462.1_2 Forward -273 -263 11.5831 0.00406
NP_441462.1_2 Reverse -264 -274 11.5831 0.00406
NP_441462.1_2 Forward -363 -353 -1.00328 0.274
NP_441621.1_7 Reverse -262 -276 -3.24533 0.188
NP_441621.1_7 Forward -275 -261 -3.44199 0.188
NP_442204.1_1 Reverse -260 -271 0.353664 0.281
NP_442204.1_5 Forward -283 -264 13.7658 0.0552
NP_442204.1_5 Reverse -254 -273 2.65439 0.209
NP_442780.1_1 Forward -98 -79 11.1109 0.17
NP_442780.1_3 Reverse -84 -103 6.73176 0.269
NP_440516.1_8 Forward -273 -264 16.9127 0.00442
NP_440516.1_8 Reverse -264 -273 16.9127 0.00442
NP_442080.1_7 Forward -129 -110 -1.08219 0.287
NP_442428.1_4 Reverse -263 -282 4.42435 0.231
NP_442428.1_5 Forward -272 -265 15.8704 0.0124
NP_442428.1_5 Reverse -265 -272 15.8704 0.0124
NP_440455.1_2 Reverse -45 -58 15.3617 0.274
NP_442120.1_10 Reverse -258 -277 -16.2252 0.297
NP_441867.1_2 Forward -232 -213 -20.5517 0.292
NP_440673.1_2 Reverse -254 -273 17.0231 0.0543
NP_440673.1_2 Forward -283 -264 8.43855 0.27
NP_440673.1_3 Forward -271 -264 12.4288 0.0426
NP_440673.1_3 Reverse -266 -273 12.4288 0.0426
NP_440673.1_7 Forward -284 -265 0.687771 0.264
NP_441052.1_2 Reverse -264 -274 19.9412 0.00106
NP_441052.1_2 Forward -273 -263 10.5014 0.0285
NP_440992.1_8 Reverse -346 -365 17.109 0.242
NP_442219.1_8 Forward -290 -271 11.1627 0.188
NP_442219.1_8 Reverse -260 -279 9.61661 0.224
NP_442219.1_9 Reverse -265 -274 17.7976 0.00718
NP_442219.1_9 Forward -272 -263 8.35786 0.0681
NP_440436.1_4 Forward -272 -263 18.1905 0.00233
NP_440436.1_4 Reverse -265 -274 17.2072 0.00233
NP_441884.1_9 Reverse -261 -280 -4.03212 0.0594
NP_441884.1_9 Forward -276 -257 -12.8819 0.138
NP_441086.1_3 Forward -106 -87 5.9443 0.289
NP_441719.1_4 Forward -272 -265 16.3621 0.0124
NP_441719.1_4 Reverse -265 -272 16.3621 0.0124
NP_441719.1_6 Forward -344 -325 6.58682 0.269
NP_441733.1_10 Forward -276 -263 19.6855 0.0151
NP_440746.1_7 Forward -183 -164 13.6675 0.23
NP_441004.1_1 Forward -279 -260 -11.8003 0.242
NP_441004.1_1 Reverse -252 -271 -15.9302 0.279
NP_442366.1_3 Reverse -263 -281 5.03403 0.0899
NP_442873.1_3 Reverse -269 -288 3.14526 0.294
NP_440296.1_6 Forward -115 -97 10.5061 0.295
NP_441115.1_4 Reverse -263 -281 17.6196 0.0166
NP_443054.1_2 Reverse -262 -276 12.586 0.0722
NP_443054.1_2 Reverse -352 -366 8.94771 0.104
NP_443054.1_2 Forward -275 -261 3.34284 0.24
NP_441851.1_6 Reverse -91 -110 14.916 0.203
NP_441851.1_10 Reverse -263 -273 16.008 0.00552
NP_441851.1_10 Forward -274 -264 15.8113 0.00552
NP_441851.1_10 Forward -213 -203 7.35486 0.142
NP_440495.1_1 Forward -380 -361 8.35759 0.198
NP_442856.1_7 Reverse -255 -274 -2.0655 0.233
NP_442515.1_1 Reverse -263 -277 -4.4253 0.298
NP_442515.1_1 Forward -274 -260 -4.91696 0.298
NP_441683.1_7 Reverse -328 -347 -5.40875 0.259
NP_441683.1_7 Reverse -331 -350 -12.2919 0.287
NP_440593.1_3 Forward -278 -259 0.982764 0.19
NP_441982.1_6 Reverse -92 -101 12.4854 0.275
NP_441982.1_6 Reverse -171 -180 10.7665 0.292
NP_440463.1_6 Reverse -261 -280 9.14423 0.249
NP_440338.1_4 Forward -93 -74 12.585 0.15
NP_442689.1_8 Reverse -88 -105 12.0352 0.103
NP_441349.1_10 Forward -283 -264 -2.85214 0.127
NP_441409.1_6 Reverse -258 -277 -9.047 0.178
NP_440432.1_9 Reverse -265 -280 -2.47838 0.172
NP_440432.1_9 Forward -272 -257 -2.77337 0.175
NP_442843.1_1 Forward -229 -210 -10.9153 0.282
NP_440474.1_8 Forward -272 -258 5.89884 0.237
NP_441477.1_10 Forward -280 -262 5.23069 0.199
NP_441124.1_5 Forward -320 -310 13.9631 0.215
NP_441124.1_5 Forward -97 -87 10.2389 0.289
NP_442450.1_5 Reverse -262 -272 9.32148 0.115
NP_440588.1_2 Forward -282 -263 -0.295539 0.15
NP_441031.1_1 Reverse -99 -118 6.62992 0.264
NP_441031.1_1 Forward -104 -85 5.56945 0.282
NP_441031.1_1 Reverse -89 -108 5.18382 0.288
NP_441031.1_1 Forward -115 -96 4.02695 0.293
NP_441031.1_1 Reverse -79 -98 4.02695 0.293
NP_440195.1_4 Reverse -252 -271 5.99764 0.283
NP_442006.1_2 Reverse -353 -370 -17.0707 0.269
NP_440483.1_1 Forward -236 -217 -7.27704 0.258
NP_442243.1_1 Forward -279 -261 2.37835 0.204
NP_441570.1_1 Forward -273 -255 -7.749 0.0949
NP_441570.1_1 Reverse -264 -282 -9.51896 0.139
NP_441078.1_4 Forward -273 -264 19.6659 0.0007
NP_441078.1_4 Reverse -264 -273 19.6659 0.0007
NP_441078.1_4 Forward -363 -354 -1.18024 0.237
NP_442729.1_8 Forward -277 -264 8.77074 0.125
NP_442729.1_8 Reverse -260 -273 8.18076 0.125
NP_441539.1_1 Reverse -83 -97 11.9953 0.284
NP_441539.1_1 Reverse -41 -55 11.897 0.284
NP_440707.1_6 Reverse -151 -170 10.815 0.274
NP_441094.1_6 Reverse -257 -274 10.9528 0.257
NP_440526.1_3 Reverse -265 -276 20.0193 0.0113
NP_440526.1_3 Forward -272 -261 1.92649 0.267
NP_441432.1_8 Forward -274 -265 16.8143 0.00595
NP_441432.1_8 Reverse -263 -272 8.25953 0.0755
NP_441432.1_9 Reverse -80 -93 8.69532 0.287
NP_441333.1_1 Forward -80 -70 11.6853 0.241
NP_441333.1_1 Reverse -82 -92 11.4946 0.247
NP_441333.1_2 Reverse -93 -106 18.7782 0.147
NP_442320.1_8 Reverse -258 -272 23.009 0.0038
NP_442320.1_8 Forward -279 -265 13.5693 0.0144
NP_442344.1_7 Reverse -340 -359 -8.06369 0.202
NP_441732.1_2 Reverse -260 -276 2.91013 0.0145
NP_442003.1_9 Forward -272 -253 2.55606 0.295
NP_440760.1_1 Reverse -264 -283 -16.6185 0.182
NP_440760.1_1 Forward -363 -344 -19.3717 0.219
NP_442797.1_7 Forward -342 -324 2.0841 0.245
NP_440199.1_10 Reverse -261 -271 14.533 0.0861
NP_440199.1_10 Forward -276 -266 7.35486 0.231
NP_442489.1_7 Forward -273 -264 20.1576 0.000695
NP_442489.1_7 Reverse -264 -273 20.1576 0.000695
NP_440757.1_8 Reverse -90 -102 20.1448 0.0961
NP_442079.1_7 Forward -272 -253 2.55606 0.226
NP_440559.1_1 Reverse -265 -274 17.4043 0.00658
NP_440559.1_1 Forward -272 -263 8.75118 0.0586
NP_441659.2_8 Reverse -264 -274 18.1713 0.00133
NP_441659.2_8 Forward -273 -263 11.9764 0.0147
NP_441022.1_1 Reverse -41 -50 13.2728 0.216
NP_441022.1_1 Forward -52 -43 13.2728 0.216
NP_442913.1_10 Forward -282 -263 10.2259 0.0421
NP_441040.1_2 Forward -275 -256 -11.8986 0.255
NP_442849.1_1 Reverse -171 -185 8.25939 0.282
NP_440779.1_5 Reverse -264 -281 -14.4158 0.246
NP_442346.1_5 Forward -274 -264 16.6963 0.00248
NP_442346.1_5 Reverse -263 -273 9.02648 0.118
NP_442346.1_5 Reverse -231 -241 5.78156 0.229
NP_440545.1_3 Forward -277 -260 4.95539 0.0658
NP_440831.1_1 Forward -272 -253 11.4058 0.277
NP_440459.1_2 Reverse -255 -272 11.6419 0.169
NP_440459.1_2 Reverse -262 -279 11.2486 0.18
NP_440459.1_2 Forward -269 -252 8.88863 0.246
NP_440459.1_2 Forward -275 -258 8.29864 0.266
NP_440010.1_3 Forward -278 -259 -5.21209 0.25
NP_440847.1_3 Reverse -214 -228 10.717 0.283
NP_442603.1_7 Reverse -264 -278 13.1753 0.0923
NP_441888.1_7 Reverse -259 -273 2.5562 0.225
NP_440449.1_6 Forward -281 -263 7.38047 0.225
NP_441948.1_4 Reverse -257 -275 -2.73412 0.175
NP_441833.1_4 Forward -272 -265 15.9687 0.0124
NP_441833.1_4 Reverse -265 -272 15.9687 0.0124
NP_441329.1_1 Forward -113 -94 11.0289 0.194
NP_441329.1_1 Reverse -91 -110 7.01823 0.244
NP_441329.1_1 Forward -46 -27 4.43995 0.291
NP_441329.1_3 Forward -179 -169 13.6534 0.261
NP_442162.1_9 Forward -272 -265 16.2637 0.0124
NP_442162.1_9 Reverse -265 -272 16.2637 0.0124
NP_440671.1_1 Reverse -81 -100 20.5824 0.0322
NP_440671.1_4 Reverse -258 -272 17.5025 0.0199
NP_440671.1_4 Forward -279 -265 6.98109 0.23
NP_440224.1_1 Reverse -253 -272 0.687771 0.132
NP_442045.1_5 Reverse -255 -274 3.73603 0.239
NP_442140.1_3 Reverse -265 -275 13.5497 0.0542
NP_442140.1_3 Forward -272 -262 8.33817 0.119
NP_442723.1_1 Forward -75 -56 2.6536 0.286
NP_441609.1_1 Forward -316 -297 -1.96717 0.278
NP_440875.1_9 Reverse -266 -276 8.66404 0.233
NP_440875.1_9 Forward -271 -261 8.37203 0.233
NP_441813.1_5 Reverse -262 -272 17.188 0.00979
NP_441813.1_5 Forward -275 -265 8.73149 0.0367
NP_440590.1_4 Reverse -265 -278 21.0621 0.00401
NP_440590.1_4 Forward -272 -259 13.0973 0.013
NP_440590.1_4 Reverse -226 -239 -4.01229 0.257
NP_440567.1_1 Forward -272 -258 15.6342 0.017
NP_440567.1_1 Reverse -265 -279 8.55439 0.0567
NP_442497.1_10 Forward -272 -263 10.4228 0.0087
NP_442497.1_10 Reverse -265 -274 10.4228 0.0087
NP_440821.1_4 Reverse -262 -272 19.0562 0.00399
NP_440821.1_4 Forward -275 -265 17.9746 0.00497
NP_440227.1_6 Reverse -97 -111 15.1948 0.263
NP_441239.1_9 Reverse -262 -274 13.3137 0.037
NP_441239.1_9 Forward -275 -263 9.67541 0.0987
NP_441951.1_4 Forward -279 -260 4.62101 0.273
NP_442270.1_9 Forward -284 -265 -0.39387 0.142
NP_440219.1_1 Forward -114 -95 15.5152 0.158
NP_441508.1_1 Reverse -84 -103 16.8047 0.101
NP_441698.1_1 Forward -54 -37 18.1595 0.228
NP_442643.1_5 Reverse -184 -203 -5.01543 0.293
NP_441017.1_6 Reverse -260 -274 16.4202 0.0651
NP_441541.1_1 Reverse -82 -100 20.4373 0.0386
NP_441541.1_1 Forward -111 -93 13.1799 0.0795
NP_441541.1_1 Forward -91 -73 3.15322 0.187
NP_441541.1_1 Reverse -26 -44 -2.19433 0.254
NP_441541.1_1 Forward -101 -83 -2.5763 0.264
NP_441541.1_1 Reverse -92 -110 -4.58163 0.279
NP_441541.1_7 Reverse -93 -111 11.9065 0.225
NP_440949.1_7 Reverse -256 -275 8.35677 0.288
NP_442138.1_10 Reverse -235 -254 -7.08038 0.286
NP_440546.1_4 Forward -273 -263 11.8882 0.0679
NP_440546.1_4 Reverse -264 -274 10.046 0.109
NP_440546.1_4 Forward -363 -353 6.55553 0.291
NP_440462.1_6 Reverse -262 -272 15.418 0.0142
NP_440462.1_6 Forward -275 -265 10.3048 0.0396
NP_440868.1_4 Reverse -260 -272 1.7106 0.174
NP_440868.1_4 Forward -277 -265 0.432302 0.212
NP_442479.1_5 Forward -241 -222 7.48109 0.222
NP_442402.1_4 Forward -344 -325 -3.83621 0.22
NP_441848.1_4 Reverse -33 -49 10.7974 0.241
NP_441848.1_4 Reverse -34 -50 10.4154 0.253
NP_441848.1_4 Reverse -70 -86 10.0335 0.265
NP_441848.1_4 Reverse -299 -315 8.50558 0.288
NP_441848.1_5 Forward -59 -40 17.154 0.188
NP_441848.1_5 Forward -57 -38 15.5112 0.214
NP_441848.1_7 Forward -206 -187 5.89851 0.208
NP_442460.1_7 Reverse -252 -271 -1.27885 0.292
NP_441843.2_9 Forward -271 -253 12.0482 0.205
NP_442039.1_4 Forward -272 -265 15.1821 0.0124
NP_442039.1_4 Reverse -265 -272 15.1821 0.0124
NP_442039.1_7 Reverse -334 -344 10.0098 0.257
NP_442837.1_3 Forward -272 -265 15.7721 0.0124
NP_442837.1_3 Reverse -265 -272 15.7721 0.0124
NP_440160.1_9 Forward -273 -254 9.14423 0.246
NP_439994.1_3 Reverse -263 -282 17.5109 0.0645
NP_442053.1_1 Forward -273 -264 18.3876 0.0007
NP_442053.1_1 Reverse -264 -273 18.3876 0.0007
NP_442053.1_1 Reverse -354 -363 5.80125 0.164
NP_440505.1_3 Forward -275 -265 16.598 0.00683
NP_440505.1_3 Reverse -262 -272 13.8447 0.0247
NP_440351.1_9 Reverse -76 -94 10.2456 0.191
NP_441701.1_3 Reverse -189 -206 11.5436 0.213
NP_441102.1_1 Forward -272 -253 10.9142 0.134
NP_441203.1_1 Reverse -265 -284 -19.7651 0.297
NP_440914.1_1 Reverse -264 -274 17.5935 0.000537
NP_440914.1_1 Forward -273 -263 8.6151 0.186
NP_441011.1_8 Forward -272 -263 16.9127 0.00602
NP_441011.1_8 Reverse -265 -274 8.25953 0.144
NP_442533.1_1 Reverse -112 -131 -10.0303 0.23
NP_442533.1_6 Forward -273 -264 17.2076 0.00137
NP_442533.1_6 Reverse -264 -273 17.2076 0.00137
NP_442533.1_6 Reverse -354 -363 2.458 0.255
NP_442322.1_9 Forward -354 -336 17.5212 0.139
NP_442229.1_1 Forward -275 -261 8.94708 0.184
NP_442535.1_9 Forward -282 -264 -4.01242 0.262
NP_441482.1_7 Reverse -348 -362 -3.34366 0.118
NP_441482.1_7 Forward -279 -265 -8.26021 0.193
NP_441482.1_7 Reverse -258 -272 -8.75187 0.193
NP_439944.1_9 Reverse -265 -275 19.1546 0.00329
NP_439944.1_9 Forward -272 -262 10.3048 0.0887
NP_442597.1_5 Reverse -92 -111 14.2756 0.292
NP_441697.1_5 Reverse -78 -97 10.265 0.127
NP_441697.1_5 Forward -95 -76 1.09773 0.187
NP_441697.1_5 Reverse -32 -51 -3.29489 0.217
NP_441697.1_5 Reverse -98 -117 -4.53629 0.222
NP_441697.1_5 Forward -93 -74 -9.59736 0.271
NP_441697.1_5 Forward -115 -96 -9.88384 0.278
NP_441028.1_6 Forward -346 -336 17.1874 0.132
NP_441028.1_6 Forward -64 -54 5.38779 0.255
NP_441028.1_6 Forward -63 -53 5.38779 0.255
NP_441028.1_6 Forward -336 -326 3.42118 0.296
NP_439945.1_1 Reverse -79 -98 21.703 0.0634
NP_442664.1_8 Forward -338 -319 13.5683 0.233
NP_440116.1_8 Reverse -265 -284 3.14605 0.0825
NP_440116.1_8 Forward -272 -253 -7.67036 0.236
NP_441527.1_4 Reverse -333 -352 -10.5523 0.272
NP_441527.1_4 Reverse -108 -127 -13.0351 0.298
NP_441527.1_5 Reverse -55 -74 12.8913 0.297
NP_440115.1_6 Forward -276 -266 9.81313 0.115
NP_440007.1_9 Reverse -260 -274 4.03116 0.267
NP_442492.1_2 Reverse -264 -283 0.982764 0.24
NP_441059.1_2 Reverse -328 -347 -5.40875 0.253
NP_441602.1_3 Forward -278 -259 -0.885524 0.226
NP_441106.1_1 Reverse -263 -272 18.191 0.0028
NP_441106.1_1 Forward -274 -265 9.63616 0.0311
NP_440429.1_2 Reverse -259 -278 9.83255 0.272
NP_440797.1_2 Reverse -253 -272 12.9594 0.241
NP_441186.1_4 Forward -98 -88 15.6142 0.232
NP_441286.1_1 Forward -274 -262 14.4936 0.00418
NP_441286.1_1 Reverse -263 -275 12.1337 0.0104
NP_440670.1_8 Forward -273 -264 18.3876 0.000699
NP_440670.1_8 Reverse -264 -273 18.3876 0.000699
NP_441705.1_9 Forward -101 -82 16.9494 0.292
NP_440886.1_7 Reverse -263 -273 17.7774 0.0011
NP_440886.1_7 Forward -274 -264 7.94438 0.0805
NP_440828.1_1 Forward -239 -220 2.26028 0.231
NP_439995.1_5 Forward -283 -264 3.93269 0.291
NP_442072.1_9 Reverse -263 -281 -3.91409 0.0388
NP_442072.1_9 Forward -274 -256 -13.4522 0.112
NP_439899.1_1 Reverse -80 -98 9.83286 0.165
NP_441753.1_10 Reverse -323 -342 6.4893 0.186
NP_440907.2_8 Reverse -265 -275 10.8943 0.0969
NP_440907.2_8 Forward -272 -262 7.84605 0.117
NP_441021.1_1 Reverse -265 -284 -7.4737 0.184
NP_441463.1_2 Forward -115 -97 6.81001 0.143
NP_441626.1_2 Forward -272 -265 15.7721 0.0124
NP_441626.1_2 Reverse -265 -272 15.7721 0.0124
NP_442794.1_1 Forward -277 -265 3.48056 0.286
NP_442615.1_1 Forward -282 -264 8.7706 0.0275
NP_441962.1_4 Forward -278 -259 -0.197208 0.117
NP_441962.1_4 Forward -272 -253 -9.24366 0.215
NP_441962.1_4 Reverse -259 -278 -12.4886 0.259
NP_441962.1_4 Forward -263 -244 -14.8485 0.294
NP_440387.1_1 Reverse -264 -280 5.86006 0.0304
NP_441431.1_2 Reverse -261 -275 5.70218 0.291
NP_441521.1_8 Reverse -25 -44 14.5524 0.299
NP_441993.1_1 Forward -279 -260 1.36194 0.28
NP_440114.1_10 Forward -273 -259 7.57108 0.231
NP_440935.1_6 Reverse -81 -98 8.55092 0.179
NP_440766.1_4 Forward -277 -263 17.6992 0.0255
NP_440766.1_4 Reverse -260 -274 8.55439 0.0871
NP_440766.1_5 Reverse -170 -182 13.0988 0.225
NP_440766.1_5 Forward -99 -87 7.46481 0.29
NP_440766.1_6 Forward -117 -98 12.2908 0.292
NP_441421.1_6 Reverse -95 -112 9.41035 0.3
NP_439988.1_3 Reverse -183 -197 9.73436 0.246
NP_441237.1_9 Reverse -265 -275 14.9263 0.0242
NP_441979.1_5 Reverse -258 -277 -12.5869 0.228
NP_442930.1_1 Reverse -43 -53 12.5659 0.239
NP_441133.1_1 Reverse -181 -200 11.9958 0.277
NP_439910.1_2 Reverse -256 -273 -12.4492 0.0863
NP_440457.1_1 Reverse -260 -272 7.02048 0.105
NP_440457.1_1 Forward -277 -265 5.34885 0.141
NP_440801.1_8 Reverse -270 -289 -1.67217 0.282
NP_440801.1_10 Forward -271 -252 4.32602 0.291
NP_440142.1_9 Forward -71 -57 12.487 0.284
NP_441436.1_2 Reverse -325 -344 4.52268 0.196
NP_441436.1_8 Reverse -187 -206 14.9458 0.215
NP_442509.1_9 Forward -273 -263 16.2041 0.00739
NP_442509.1_9 Reverse -264 -274 8.14104 0.192
NP_442582.1_3 Reverse -100 -114 12.6166 0.284
NP_442936.1_10 Forward -53 -39 14.3362 0.216
NP_442936.1_10 Reverse -40 -54 13.9534 0.216
NP_442514.1_5 Forward -204 -185 -8.16275 0.285
NP_440554.1_4 Forward -272 -262 14.6313 0.02
NP_440554.1_4 Reverse -265 -275 6.37155 0.123
NP_441885.1_5 Reverse -264 -274 20.9245 0.000538
NP_441885.1_5 Forward -273 -263 11.4848 0.00668
NP_441885.1_5 Forward -363 -353 -1.69159 0.277
NP_441275.1_1 Forward -111 -93 1.29745 0.253
NP_442703.1_9 Forward -107 -89 6.214 0.244
NP_442341.1_7 Reverse -263 -277 20.3541 0.00702
NP_442341.1_7 Forward -274 -260 19.7641 0.00702
NP_442341.1_9 Reverse -262 -276 5.80051 0.255
NP_441173.1_9 Forward -179 -171 14.0803 0.17
NP_441173.1_9 Forward -345 -337 11.3271 0.226
NP_441173.1_9 Forward -178 -170 10.9338 0.242
NP_441173.1_9 Forward -99 -91 10.6388 0.261
NP_440409.1_1 Forward -281 -262 -3.63879 0.255
NP_440191.1_4 Forward -345 -335 13.439 0.282
NP_440750.1_5 Reverse -98 -112 5.01447 0.294
NP_443000.1_7 Forward -275 -265 10.4031 0.0345
NP_443000.1_7 Reverse -262 -272 8.73149 0.0437
NP_440507.2_3 Forward -282 -263 8.25844 0.257
NP_440552.1_8 Forward -108 -91 21.9198 0.00957
NP_440552.1_8 Reverse -85 -102 17.5272 0.0678
NP_441842.1_10 Reverse -257 -271 13.8643 0.0667
NP_441842.1_10 Forward -280 -266 6.88276 0.271
NP_440275.1_3 Forward -275 -265 17.6796 0.0102
NP_440275.1_3 Reverse -262 -272 8.4365 0.0602
NP_440091.1_1 Reverse -260 -272 10.7571 0.0429
NP_440091.1_1 Forward -277 -265 10.7571 0.0429
NP_440312.1_8 Forward -120 -101 9.71588 0.271
NP_441397.1_3 Forward -106 -87 12.0933 0.293
NP_443010.1_10 Reverse -261 -278 6.63614 0.181
NP_442451.1_2 Reverse -256 -275 9.14423 0.0761
NP_442451.1_2 Forward -281 -262 -4.72043 0.213
NP_442638.1_3 Forward -22 -3 14.1801 0.277
NP_441635.1_1 Forward -94 -75 7.11373 0.245
NP_440258.1_3 Forward -107 -88 -3.83545 0.225
NP_439962.1_4 Forward -275 -256 -5.80207 0.28
NP_439962.1_4 Forward -266 -247 -8.45701 0.294
NP_440804.1_7 Forward -101 -84 5.74131 0.291
NP_440149.1_8 Forward -273 -254 -2.85214 0.176
NP_441804.1_1 Reverse -108 -127 14.7491 0.164
NP_441105.1_3 Forward -284 -265 -6.1954 0.23
NP_441730.1_2 Forward -49 -31 5.62401 0.299
NP_440216.1_1 Forward -273 -259 8.25939 0.0061
NP_440216.1_1 Reverse -264 -278 0.0979218 0.0284
NP_440216.1_1 Reverse -354 -368 -6.19526 0.139
NP_440216.1_6 Reverse -257 -273 5.95839 0.189
NP_440216.1_9 Forward -58 -49 11.4061 0.267
NP_440172.1_1 Reverse -264 -274 15.0247 0.00945
NP_440172.1_1 Forward -273 -263 8.73149 0.0586
NP_440167.1_3 Forward -283 -264 8.45592 0.28
NP_442015.1_10 Reverse -260 -273 10.639 0.0391
NP_442015.1_10 Forward -277 -264 3.65753 0.178
NP_441226.1_7 Forward -272 -265 14.4934 0.0123
NP_441226.1_7 Reverse -265 -272 14.4934 0.0123
NP_441111.1_7 Forward -272 -264 18.7023 0.00294
NP_441111.1_7 Reverse -265 -273 18.7023 0.00294
NP_441766.1_2 Forward -273 -264 17.5026 0.00297
NP_441766.1_2 Reverse -264 -273 17.5026 0.00297
NP_442417.1_5 Forward -273 -259 11.5043 0.0983
NP_443052.1_8 Reverse -254 -273 -2.26216 0.0885
NP_443052.1_8 Forward -283 -264 -9.34199 0.189
NP_443052.1_8 Forward -178 -159 -11.7019 0.236
NP_443052.1_9 Reverse -247 -266 3.6377 0.162
NP_443052.1_9 Reverse -151 -170 -6.88371 0.289
NP_442116.1_6 Forward -115 -98 11.8931 0.189
NP_442116.1_6 Forward -104 -87 11.8931 0.189
NP_442116.1_6 Reverse -99 -116 9.31486 0.231
NP_442116.1_6 Forward -103 -86 9.12387 0.235
NP_442116.1_6 Reverse -88 -105 7.11854 0.265
NP_442046.1_8 Forward -240 -221 16.2241 0.266
NP_440261.1_5 Reverse -265 -278 -1.06236 0.0655
NP_440261.1_5 Forward -272 -259 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTAGAAGACGTGCTGTACAGCGTGTTGGAATCCATTCGGCTCTCGGCCTATCTTCTTTCCCCCATTGTTCCCCGCCTGAGTACCAAAATTTATCAACAGCTAGGTTTTACCTGGGACTTTGACCAGTGGCGATCGCCGTTGGAGCAAGCGGAAGAATTCAACCGTCACCAATCCTGGGGCCAATTGGGTGCGAACCAAAATCTGCCCCCTGCCCAACCTATTTTTACCAAACTGGAGTTACCGGCAGAGGAGTAGAATCAAAAACTGACCCCCTAGGTCAATTTCAATCTTTTTAAGATTTTTTAACAAAAATTAACATTTTTATAACTTTCCCGCCTTTTCCCCTTGAAAAAATTTTTTAAAACCCCTTTAAATTACAACTTAGTCATTTAGGAACACC

CDS

ATGTTTGAGGACTTTGAACAGGATGCACTGTTTACGCCGGATCAGTTATTAGAAAACCGGGGGCGGGTAGCCATTTTCATCGATGGTTCCAATCTTTTTTACGCCGCATTACAGTTGGGCATTGAAATTGATTACACCAAGCTATTGCACTGTTTAACGGGCGGCTCCCGCCTATTGCGGGCTTTTTTCTACACCGGAGTAGACCGTAGTAACGAAAAACAACAGGGATTTTTACTTTGGATGCGCCGCAATGGTTACCGAGTCATTGCCAAAGACTTAGTGCAATTACCAGACGGTTCTAAAAAGGCTAACTTAGACGTGGAAATTGCCGTGGACTTGATGTCCCTGGTGGGTTCCTATGACACCGCAGTGGTGGTCAGTGGCGATGGGGATTTGGCCTATGCGGCCGATGCGGTCAGTTATCGGGGGGCGCGCATTGAAGTGGTGAGTCTCCGTTCCATGACCAGCGACAGTTTAATTAATGTGTCCGACCGTTACGTGGATCTTGACAGTATTAAGGAGGAAATTCAAAAACAACCCCGTCCCAATAGTGGCTATCGTAACGTCAATCCCTTGCCTATTTTTTCTCAGGAAAAATCTTCCTAA

Protein

MFEDFEQDALFTPDQLLENRGRVAIFIDGSNLFYAALQLGIEIDYTKLLHCLTGGSRLLRAFFYTGVDRSNEKQQGFLLWMRRNGYRVIAKDLVQLPDGSKKANLDVEIAVDLMSLVGSYDTAVVVSGDGDLAYAADAVSYRGARIEVVSLRSMTSDSLINVSDRYVDLDSIKEEIQKQPRPNSGYRNVNPLPIFSQEKSS