Your browser is old and dusty. Try Google Chrome!

Details for slr0643

ORF slr0643
Accession NP_442293.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -260 -274 14.8476 0.12
NP_441061.1_2 Reverse -261 -275 4.12949 0.155
NP_440795.1_7 Forward -268 -261 14.6904 0.0123
NP_440795.1_7 Reverse -261 -268 14.6904 0.0123
NP_440795.1_7 Forward -33 -26 7.31561 0.259
NP_440795.1_7 Reverse -46 -53 6.92228 0.26
NP_441418.1_6 Reverse -260 -279 -9.93197 0.0301
NP_442291.1_5 Forward -165 -149 1.23851 0.149
NP_442291.1_5 Forward -270 -254 -4.66135 0.281
NP_440897.1_6 Reverse -314 -333 -4.81951 0.29
NP_441453.1_4 Reverse -260 -268 16.539 0.00633
NP_441453.1_4 Forward -269 -261 16.539 0.00633
NP_442151.1_6 Forward -269 -255 7.57108 0.194
NP_440226.1_1 Forward -269 -250 10.9142 0.0579
NP_442655.1_1 Reverse -255 -274 7.27595 0.115
NP_442173.1_1 Forward -268 -260 15.4574 0.00633
NP_442173.1_1 Reverse -261 -269 15.4574 0.00633
NP_442752.1_4 Forward -269 -262 13.8055 0.0199
NP_442752.1_4 Reverse -260 -267 13.8055 0.0199
NP_442752.1_4 Reverse -314 -321 5.44732 0.202
NP_442752.1_4 Forward -94 -87 5.44732 0.202
NP_443027.1_4 Forward -271 -261 13.2547 0.0521
NP_443027.1_4 Reverse -258 -268 13.2547 0.0521
NP_442975.1_10 Forward -273 -259 4.22722 0.245
NP_442975.1_10 Reverse -256 -270 3.93223 0.249
NP_441675.1_4 Reverse -181 -200 8.25926 0.232
NP_440784.1_7 Forward -268 -261 15.9687 0.0123
NP_440784.1_7 Reverse -261 -268 15.9687 0.0123
NP_440061.1_9 Reverse -312 -326 11.602 0.107
NP_440061.1_9 Forward -271 -257 11.2087 0.116
NP_440061.1_9 Reverse -258 -272 11.2087 0.116
NP_441054.1_2 Reverse -156 -175 13.4708 0.199
NP_442062.1_8 Reverse -260 -270 10.3048 0.0493
NP_442062.1_8 Forward -269 -259 10.3048 0.0493
NP_442062.1_8 Reverse -314 -324 4.50326 0.212
NP_441859.1_3 Reverse -259 -278 6.78348 0.171
NP_440304.1_4 Forward -271 -261 10.8948 0.051
NP_440304.1_4 Reverse -258 -268 10.8948 0.051
NP_440304.1_4 Reverse -344 -354 5.68323 0.196
NP_442242.1_4 Forward -268 -261 14.3954 0.0124
NP_442242.1_4 Reverse -261 -268 14.3954 0.0124
NP_440044.1_8 Reverse -261 -280 -1.96717 0.256
NP_441935.1_10 Reverse -265 -284 23.4022 0.0123
NP_441208.1_9 Forward -272 -258 8.25939 0.219
NP_441208.1_9 Reverse -257 -271 8.25939 0.219
NP_441208.1_9 Reverse -103 -117 5.89945 0.259
NP_441208.1_9 Reverse -311 -325 4.81781 0.285
NP_440764.1_1 Reverse -337 -351 18.2892 0.21
NP_441594.1_6 Reverse -263 -282 4.12936 0.222
NP_441594.1_6 Forward -278 -259 0.884433 0.279
NP_440370.1_10 Reverse -251 -270 13.1758 0.129
NP_442110.1_7 Reverse -260 -274 3.44117 0.21
NP_442110.1_7 Forward -269 -255 2.5562 0.222
NP_440856.1_7 Reverse -33 -52 -4.91709 0.224
NP_440856.1_7 Reverse -345 -364 -8.65367 0.274
NP_441083.1_3 Forward -356 -346 13.4509 0.213
NP_441083.1_5 Forward -323 -313 15.2213 0.0126
NP_441083.1_5 Forward -269 -259 11.2881 0.0159
NP_441083.1_5 Reverse -260 -270 11.2881 0.0159
NP_441083.1_5 Reverse -314 -324 0.471689 0.226
NP_441738.1_2 Forward -267 -260 15.28 0.0102
NP_441738.1_2 Reverse -262 -269 15.28 0.0102
NP_441738.1_2 Reverse -87 -94 10.2652 0.101
NP_441738.1_2 Forward -321 -314 9.77352 0.143
NP_441558.1_5 Forward -271 -252 11.0125 0.0879
NP_441558.1_5 Reverse -258 -277 4.916 0.267
NP_440209.1_1 Reverse -260 -268 18.1123 0.00295
NP_440209.1_1 Forward -269 -261 18.1123 0.00295
NP_441713.1_1 Forward -100 -81 -13.8652 0.257
NP_441713.1_1 Forward -275 -256 -16.8151 0.286
NP_440178.1_7 Forward -270 -251 -3.24547 0.0451
NP_442570.1_3 Forward -261 -242 -4.52377 0.231
NP_441716.1_1 Reverse -260 -274 7.86607 0.156
NP_442111.1_4 Reverse -259 -273 19.8624 0.00373
NP_442111.1_4 Forward -270 -256 10.4227 0.0544
NP_440906.1_5 Forward -268 -261 15.8704 0.0124
NP_440906.1_5 Reverse -261 -268 15.8704 0.0124
NP_440747.1_10 Forward -272 -260 17.1486 0.000663
NP_440747.1_10 Reverse -257 -269 17.1486 0.000663
NP_440747.1_10 Reverse -311 -323 5.15219 0.0179
NP_440747.1_10 Forward -326 -314 -12.1541 0.227
NP_442634.1_2 Reverse -312 -331 3.83436 0.278
NP_442634.1_4 Forward -271 -257 17.3058 0.01
NP_442634.1_4 Reverse -258 -272 17.3058 0.01
NP_441014.1_10 Forward -356 -337 1.86696 0.223
NP_443018.1_3 Forward -268 -261 14.8871 0.0123
NP_443018.1_3 Reverse -261 -268 14.8871 0.0123
NP_441634.1_8 Reverse -40 -54 1.76955 0.181
NP_440376.1_1 Forward -269 -260 19.4693 0.000692
NP_440376.1_1 Reverse -260 -269 19.4693 0.000692
NP_440376.1_1 Reverse -314 -323 7.07956 0.0869
NP_440376.1_1 Forward -323 -314 0.0980582 0.285
NP_442687.1_7 Reverse -24 -34 9.7148 0.0994
NP_442687.1_7 Forward -270 -260 9.02648 0.0994
NP_442687.1_7 Reverse -259 -269 9.02648 0.0994
NP_442485.1_3 Reverse -110 -129 -4.6221 0.285
NP_442485.1_3 Forward -280 -261 -5.9004 0.296
NP_441846.1_10 Reverse -345 -364 -22.2233 0.257
NP_441846.1_10 Forward -100 -81 -22.9117 0.271
NP_440781.1_1 Reverse -109 -123 10.816 0.296
NP_442958.1_3 Reverse -249 -268 -2.55715 0.295
NP_442766.1_6 Forward -360 -346 20.2551 0.116
NP_441422.1_7 Forward -271 -254 -3.5994 0.235
NP_441422.1_7 Reverse -258 -275 -4.18939 0.238
NP_442658.1_1 Reverse -258 -268 14.2375 0.0237
NP_442658.1_1 Forward -271 -261 14.2375 0.0237
NP_442782.1_2 Forward -269 -255 8.84938 0.198
NP_442782.1_2 Forward -94 -80 1.96621 0.281
NP_442782.1_2 Reverse -260 -274 1.47456 0.281
NP_442205.1_9 Reverse -254 -270 -2.20308 0.268
NP_442544.1_2 Forward -347 -333 6.98109 0.217
NP_443061.1_10 Reverse -241 -260 16.6174 0.275
NP_441487.1_9 Reverse -157 -176 -1.96717 0.29
NP_441487.1_9 Forward -270 -251 -2.75381 0.293
NP_442937.1_5 Forward -392 -373 12.0942 0.119
NP_441317.1_4 Reverse -290 -304 11.0873 0.262
NP_441958.1_5 Forward -270 -260 21.2195 0.000805
NP_441958.1_5 Reverse -259 -269 21.2195 0.000805
NP_441958.1_5 Forward -324 -314 0.963343 0.12
NP_440373.1_1 Forward -259 -242 17.3451 0.288
NP_440984.1_7 Reverse -255 -269 16.0275 0.0466
NP_440984.1_7 Forward -328 -314 5.99778 0.231
NP_440984.1_7 Forward -359 -345 5.21113 0.265
NP_439990.1_5 Forward -274 -261 10.7374 0.128
NP_442911.1_2 Forward -279 -260 -10.1286 0.27
NP_440153.1_5 Forward -268 -254 13.6676 0.0551
NP_440153.1_5 Reverse -261 -275 10.6193 0.0951
NP_442064.1_4 Forward -279 -260 4.32522 0.29
NP_443055.1_3 Reverse -251 -270 13.7963 0.156
NP_443055.1_6 Reverse -314 -332 -1.06322 0.271
NP_440993.1_2 Reverse -255 -271 3.40179 0.259
NP_440993.1_2 Forward -274 -258 2.61514 0.263
NP_440993.1_3 Reverse -35 -54 -2.36125 0.299
NP_440602.1_2 Reverse -255 -274 7.86593 0.208
NP_441129.1_3 Reverse -256 -275 -17.7001 0.285
NP_441099.1_5 Forward -279 -260 -9.34199 0.219
NP_440809.1_9 Forward -278 -260 -6.56903 0.225
NP_441646.1_1 Forward -276 -257 -1.18052 0.28
NP_441000.1_6 Forward -270 -256 -3.73699 0.225
NP_440147.1_4 Forward -271 -258 17.3255 0.0071
NP_440147.1_4 Reverse -258 -271 17.3255 0.0071
NP_440147.1_4 Reverse -312 -325 6.50913 0.0911
NP_441550.1_8 Reverse -258 -268 15.8108 0.0132
NP_441550.1_8 Forward -271 -261 15.8108 0.0132
NP_441550.1_8 Reverse -270 -280 5.58445 0.242
NP_441916.1_7 Forward -269 -259 18.9579 0.00144
NP_441916.1_7 Reverse -260 -270 18.9579 0.00144
NP_441916.1_7 Reverse -155 -165 3.12662 0.227
NP_440206.1_4 Forward -134 -115 -1.96793 0.293
NP_441041.1_4 Reverse -260 -279 -8.45701 0.203
NP_441041.1_4 Forward -269 -250 -13.2752 0.285
NP_441041.1_7 Forward -272 -260 13.3454 0.0485
NP_441041.1_7 Reverse -257 -269 13.3454 0.0485
NP_441041.1_7 Forward -326 -314 7.02889 0.18
NP_440569.1_8 Reverse -260 -279 13.2741 0.145
NP_441725.1_4 Forward -274 -260 22.7134 0.00544
NP_441725.1_4 Reverse -80 -94 9.83206 0.144
NP_441725.1_4 Reverse -255 -269 4.03056 0.278
NP_441725.1_5 Forward -354 -344 7.35486 0.101
NP_441725.1_5 Forward -268 -258 1.94665 0.115
NP_441725.1_5 Reverse -261 -271 1.94665 0.115
NP_439966.1_7 Reverse -258 -268 14.3359 0.0203
NP_439966.1_7 Forward -271 -261 14.3359 0.0203
NP_439966.1_8 Reverse -311 -330 10.3242 0.152
NP_440202.1_10 Forward -301 -282 14.1591 0.21
NP_442941.1_3 Forward -268 -258 19.2529 0.00262
NP_442941.1_3 Reverse -261 -271 19.2529 0.00262
NP_442941.1_3 Reverse -315 -325 -1.10161 0.284
NP_440289.1_2 Forward -326 -313 -0.177378 0.186
NP_440289.1_2 Forward -272 -259 -3.61896 0.267
NP_440289.1_2 Reverse -257 -270 -3.61896 0.267
NP_441514.1_1 Reverse -390 -400 17.0188 0.274
NP_441514.1_6 Reverse -344 -351 12.7238 0.29
NP_442281.1_1 Forward -274 -260 17.2068 0.00633
NP_442281.1_1 Reverse -255 -269 16.9119 0.00698
NP_442281.1_1 Reverse -341 -355 4.22722 0.203
NP_441334.1_7 Forward -271 -252 -20.4534 0.276
NP_440177.1_1 Reverse -323 -341 2.77242 0.295
NP_442256.1_2 Forward -271 -253 -8.14232 0.217
NP_440647.1_9 Forward -271 -253 12.2122 0.141
NP_442012.1_5 Reverse -345 -364 4.81767 0.261
NP_441556.1_10 Forward -264 -250 15.0887 0.154
NP_440453.1_5 Reverse -340 -358 8.08229 0.246
NP_441644.1_6 Forward -269 -259 19.0557 0.000803
NP_441644.1_6 Reverse -260 -270 19.0557 0.000803
NP_442215.1_2 Forward -357 -341 -3.08806 0.209
NP_440929.1_8 Forward -269 -260 19.2726 0.000701
NP_440929.1_8 Reverse -260 -269 19.2726 0.000701
NP_442933.1_2 Forward -312 -294 8.40528 0.257
NP_442933.1_10 Forward -269 -260 17.601 0.00325
NP_442933.1_10 Reverse -260 -269 17.601 0.00325
NP_440891.1_8 Forward -190 -171 23.9557 0.00389
NP_440891.1_8 Forward -191 -172 20.0228 0.0722
NP_440891.1_8 Forward -325 -306 13.7878 0.269
NP_441751.2_8 Reverse -261 -275 16.3225 0.00876
NP_441751.2_8 Forward -268 -254 -2.36035 0.132
NP_442554.1_8 Forward -268 -258 17.2863 0.00543
NP_442554.1_8 Reverse -261 -271 17.2863 0.00543
NP_442554.1_8 Forward -322 -312 2.83163 0.253
NP_442075.1_10 Forward -269 -250 12.9791 0.282
NP_441762.1_7 Forward -270 -258 -6.74586 0.284
NP_441762.1_7 Reverse -259 -271 -6.74586 0.284
NP_442142.1_4 Forward -272 -259 13.49 0.0348
NP_442142.1_4 Reverse -257 -270 13.49 0.0348
NP_442292.1_1 Forward -268 -259 17.5026 0.00435
NP_442292.1_1 Reverse -261 -270 17.5026 0.00435
NP_442292.1_1 Forward -322 -313 6.5879 0.101
NP_442292.1_5 Reverse -246 -265 5.30933 0.23
NP_442476.1_6 Forward -268 -254 0.88457 0.238
NP_441523.1_6 Reverse -256 -275 4.03102 0.261
NP_443009.1_5 Reverse -259 -270 15.7911 0.0107
NP_443009.1_5 Forward -270 -259 15.7911 0.0107
NP_443009.1_5 Reverse -313 -324 4.58141 0.239
NP_441865.1_3 Forward -199 -181 13.3922 0.249
NP_441715.1_4 Forward -268 -258 16.7946 0.0106
NP_441715.1_4 Reverse -261 -271 16.7946 0.0106
NP_440730.1_8 Reverse -114 -133 19.2408 0.283
NP_441448.1_1 Forward -227 -208 3.44104 0.297
NP_441468.1_1 Forward -268 -261 15.8704 0.0124
NP_441468.1_1 Reverse -261 -268 15.8704 0.0124
NP_441020.2_6 Reverse -43 -60 8.59364 0.195
NP_441673.1_1 Forward -269 -260 20.8459 0.000698
NP_441673.1_1 Reverse -260 -269 20.8459 0.000698
NP_441673.1_1 Forward -323 -314 1.27803 0.155
NP_441673.1_1 Reverse -314 -323 1.27803 0.155
NP_441731.1_1 Reverse -184 -202 14.2303 0.281
NP_441731.1_3 Forward -277 -258 -6.29373 0.29
NP_441826.1_2 Forward -275 -261 4.62115 0.101
NP_441826.1_2 Reverse -254 -268 -3.54032 0.286
NP_441330.1_1 Reverse -255 -274 5.01433 0.0304
NP_442490.1_9 Reverse -260 -279 -0.4922 0.179
NP_442868.1_6 Forward -271 -261 10.4031 0.038
NP_442868.1_6 Reverse -258 -268 10.4031 0.038
NP_442868.1_6 Forward -325 -315 5.87989 0.136
NP_440806.1_3 Forward -293 -274 17.6007 0.091
NP_441911.1_10 Forward -311 -292 12.6081 0.21
NP_442808.1_1 Reverse -259 -269 8.73102 0.0481
NP_442808.1_1 Forward -270 -260 8.73102 0.0481
NP_442808.1_1 Reverse -383 -393 2.63453 0.26
NP_441315.1_1 Forward -280 -262 18.6037 0.257
NP_440145.1_3 Reverse -250 -269 11.7008 0.0342
NP_440145.1_3 Forward -279 -260 2.26107 0.12
NP_440145.1_3 Reverse -75 -94 -5.50708 0.269
NP_442820.1_4 Reverse -40 -57 18.5251 0.265
NP_442820.1_9 Forward -355 -337 7.09898 0.259
NP_442718.1_2 Reverse -346 -365 5.211 0.142
NP_442542.1_2 Forward -339 -326 13.589 0.114
NP_442050.1_5 Reverse -258 -268 15.9091 0.0091
NP_442050.1_5 Forward -271 -261 15.9091 0.0091
NP_442050.1_5 Forward -325 -315 8.14104 0.241
NP_442050.1_6 Reverse -68 -87 15.8307 0.203
NP_440038.1_4 Forward -277 -258 0.0977854 0.277
NP_440558.1_2 Forward -358 -339 -0.4922 0.203
NP_440558.1_2 Forward -278 -259 -3.3438 0.234
NP_441878.1_6 Forward -270 -260 10.5014 0.0176
NP_441878.1_6 Reverse -259 -269 10.5014 0.0176
NP_441878.1_6 Forward -324 -314 0.668351 0.139
NP_441878.1_6 Reverse -345 -355 -7.0998 0.204
NP_441878.1_6 Reverse -44 -54 -7.19813 0.21
NP_441036.1_3 Reverse -361 -380 1.67108 0.17
NP_441036.1_7 Reverse -244 -254 16.7941 0.0578
NP_441036.1_8 Forward -270 -260 15.713 0.00724
NP_441036.1_8 Reverse -259 -269 15.713 0.00724
NP_441557.1_5 Forward -269 -260 19.9609 0.000699
NP_441557.1_5 Reverse -260 -269 19.9609 0.000699
NP_441557.1_5 Forward -323 -314 0.393051 0.166
NP_441557.1_5 Reverse -314 -323 0.393051 0.166
NP_441557.1_7 Reverse -370 -389 14.0608 0.277
NP_441557.1_8 Reverse -91 -101 12.2709 0.236
NP_441445.1_1 Forward -393 -374 1.96607 0.245
NP_442066.2_4 Reverse -260 -279 -0.4922 0.173
NP_442066.2_4 Forward -269 -250 -7.17871 0.27
NP_441433.1_2 Reverse -28 -47 15.2408 0.252
NP_441433.1_8 Forward -129 -110 4.03102 0.192
NP_440101.1_3 Reverse -255 -274 2.55606 0.253
NP_441564.1_2 Forward -95 -76 -5.01543 0.244
NP_442183.1_1 Reverse -260 -274 9.43936 0.098
NP_442135.1_8 Forward -280 -262 13.8838 0.207
NP_441574.1_1 Reverse -260 -279 -1.7705 0.221
NP_441549.1_9 Forward -88 -70 -10.6006 0.281
NP_442347.1_2 Forward -322 -313 8.75118 0.0772
NP_442347.1_2 Forward -268 -259 3.34298 0.284
NP_442347.1_2 Reverse -261 -270 3.34298 0.284
NP_442645.1_2 Reverse -252 -271 -22.8133 0.296
NP_441037.1_4 Forward -271 -261 7.22024 0.237
NP_441037.1_4 Reverse -258 -268 7.22024 0.237
NP_441633.1_3 Forward -271 -258 -3.81562 0.177
NP_441633.1_3 Reverse -258 -271 -3.81562 0.177
NP_440136.1_2 Forward -268 -261 15.9687 0.0123
NP_440136.1_2 Reverse -261 -268 15.9687 0.0123
NP_442590.1_10 Forward -360 -341 4.81767 0.27
NP_442590.1_10 Reverse -253 -272 3.93269 0.283
NP_442998.1_5 Reverse -178 -188 13.0581 0.158
NP_442998.1_5 Reverse -120 -130 8.04317 0.274
NP_442998.1_10 Forward -267 -260 15.5754 0.0102
NP_442998.1_10 Reverse -262 -269 15.5754 0.0102
NP_440299.1_1 Forward -273 -260 11.1301 0.0518
NP_441799.1_1 Reverse -256 -270 15.3386 0.0187
NP_441799.1_1 Forward -273 -259 8.75042 0.106
NP_441799.1_1 Forward -327 -313 3.93223 0.274
NP_441007.1_10 Reverse -40 -53 6.01747 0.175
NP_441007.1_10 Reverse -255 -268 1.39592 0.203
NP_441007.1_10 Forward -274 -261 1.00259 0.209
NP_442201.1_10 Reverse -249 -268 -4.03212 0.152
NP_440256.1_1 Forward -272 -253 11.7008 0.0138
NP_440256.1_1 Reverse -257 -276 9.3409 0.0206
NP_441559.1_8 Forward -274 -260 11.0127 0.0574
NP_441559.1_8 Reverse -255 -269 1.47456 0.155
NP_441559.1_8 Forward -264 -250 -5.70361 0.27
NP_441559.1_8 Reverse -50 -64 -7.76856 0.299
NP_440915.1_6 Forward -273 -259 19.6658 0.00738
NP_440915.1_6 Reverse -256 -270 10.1277 0.0346
NP_440717.1_3 Reverse -317 -331 7.66879 0.28
NP_442866.1_1 Forward -360 -341 -3.54046 0.221
NP_442866.1_1 Reverse -255 -274 -7.37537 0.266
NP_441464.1_1 Forward -273 -254 12.4875 0.24
NP_441464.1_1 Reverse -256 -275 10.0292 0.24
NP_440695.1_5 Reverse -260 -279 9.14423 0.15
NP_441939.1_3 Reverse -315 -334 5.50599 0.273
NP_441199.1_6 Reverse -256 -275 4.03102 0.175
NP_439985.1_7 Reverse -44 -63 7.86593 0.188
NP_442386.1_9 Forward -270 -261 6.39082 0.219
NP_442386.1_9 Reverse -259 -268 6.39082 0.219
NP_441340.1_5 Forward -268 -261 15.6737 0.0124
NP_441340.1_5 Reverse -261 -268 15.6737 0.0124
NP_443028.1_4 Forward -307 -288 8.44315 0.293
NP_440168.1_9 Forward -260 -241 -4.72043 0.296
NP_440168.1_9 Reverse -258 -277 -5.60541 0.296
NP_442240.1_2 Forward -268 -249 -1.27885 0.0609
NP_440211.1_1 Forward -60 -41 12.0933 0.224
NP_440586.1_8 Forward -268 -261 13.2151 0.026
NP_440586.1_8 Reverse -261 -268 13.2151 0.026
NP_442251.1_6 Forward -268 -261 15.2804 0.0124
NP_442251.1_6 Reverse -261 -268 15.2804 0.0124
NP_440192.1_5 Reverse -38 -57 14.2574 0.116
NP_441262.1_3 Reverse -260 -267 14.7888 0.0223
NP_441262.1_3 Forward -269 -262 14.7888 0.0223
NP_440027.1_3 Reverse -250 -268 8.17984 0.195
NP_443051.1_1 Reverse -259 -268 19.5676 0.00335
NP_443051.1_1 Forward -270 -261 19.5676 0.00335
NP_439937.1_9 Forward -191 -174 -16.4814 0.287
NP_440836.1_6 Forward -262 -248 18.9775 0.135
NP_440398.1_6 Reverse -139 -158 2.45773 0.294
NP_440408.1_7 Reverse -345 -364 17.699 0.111
NP_440439.1_1 Reverse -257 -270 17.8172 0.0105
NP_440439.1_1 Forward -272 -259 17.8172 0.0105
NP_439943.1_7 Forward -274 -255 3.53937 0.29
NP_440372.1_2 Forward -268 -261 16.3621 0.0124
NP_440372.1_2 Reverse -261 -268 16.3621 0.0124
NP_440819.1_5 Reverse -177 -185 17.424 0.185
NP_440819.1_5 Forward -179 -171 15.8507 0.185
NP_440819.1_5 Forward -178 -170 7.68924 0.266
NP_440819.1_5 Reverse -176 -184 6.41093 0.285
NP_441572.1_7 Forward -275 -256 5.30933 0.0887
NP_441572.1_7 Reverse -254 -273 -2.65548 0.197
NP_440267.1_2 Reverse -255 -269 20.5501 0.00946
NP_440267.1_2 Forward -274 -260 12.487 0.125
NP_442384.1_10 Reverse -260 -273 18.8988 0.00338
NP_442384.1_10 Forward -269 -256 9.95071 0.047
NP_442384.1_10 Forward -281 -268 0.805932 0.278
NP_442114.1_8 Forward -304 -290 10.6187 0.234
NP_442572.1_6 Forward -278 -259 10.2259 0.229
NP_442790.1_4 Forward -278 -259 3.34271 0.0729
NP_442262.1_10 Forward -268 -261 14.1988 0.0123
NP_442262.1_10 Reverse -261 -268 14.1988 0.0123
NP_441689.1_5 Reverse -258 -268 8.3377 0.132
NP_441689.1_5 Forward -271 -261 8.3377 0.132
NP_440282.1_10 Forward -279 -260 -9.73531 0.288
NP_442910.1_1 Reverse -307 -326 1.86774 0.125
NP_441965.1_10 Reverse -42 -58 7.04003 0.157
NP_442529.1_4 Forward -278 -259 9.43923 0.235
NP_440297.1_9 Forward -354 -344 7.25653 0.136
NP_440297.1_9 Forward -268 -258 -0.216628 0.282
NP_440297.1_9 Reverse -261 -271 -0.216628 0.282
NP_440350.1_5 Reverse -294 -313 0.58944 0.16
NP_440350.1_5 Reverse -290 -309 0.392778 0.162
NP_441592.1_4 Forward -331 -312 -0.885524 0.247
NP_441592.1_10 Forward -44 -30 13.6669 0.284
NP_440999.1_9 Forward -273 -259 7.66941 0.0846
NP_440999.1_9 Reverse -256 -270 -1.8687 0.252
NP_440999.1_9 Forward -27 -13 -2.95034 0.281
NP_440888.1_2 Forward -269 -255 13.2736 0.0307
NP_440888.1_2 Reverse -260 -274 13.2736 0.0307
NP_440600.1_4 Reverse -252 -270 2.28076 0.125
NP_440600.1_4 Forward -277 -259 0.510803 0.14
NP_441748.1_3 Forward -389 -370 20.5372 0.0644
NP_442948.1_2 Reverse -259 -278 9.43923 0.173
NP_442277.1_4 Forward -278 -259 6.68515 0.157
NP_442033.1_5 Forward -130 -111 16.1257 0.19
NP_442033.1_10 Forward -271 -252 -10.227 0.23
NP_442033.1_10 Forward -339 -320 -12.5869 0.273
NP_441543.1_2 Forward -268 -259 15.9293 0.00518
NP_441543.1_2 Reverse -261 -270 15.9293 0.00518
NP_442845.1_2 Forward -275 -261 4.71948 0.254
NP_441551.1_5 Reverse -256 -272 5.85938 0.293
NP_441469.1_8 Forward -324 -315 11.3078 0.173
NP_441469.1_8 Forward -270 -261 6.5879 0.227
NP_441469.1_8 Reverse -259 -268 6.5879 0.227
NP_441548.1_3 Reverse -261 -280 11.0117 0.24
NP_443064.1_6 Forward -269 -259 10.8217 0.13
NP_443064.1_6 Reverse -260 -270 10.8217 0.13
NP_442337.1_8 Forward -400 -381 -1.7705 0.29
NP_442578.1_7 Forward -268 -261 14.5921 0.026
NP_442578.1_7 Reverse -261 -268 14.5921 0.026
NP_440710.1_1 Reverse -252 -270 -0.374176 0.163
NP_441462.1_2 Forward -269 -259 20.2362 0.000805
NP_441462.1_2 Reverse -260 -270 20.2362 0.000805
NP_441462.1_2 Reverse -314 -324 0.57002 0.144
NP_441621.1_7 Forward -271 -257 -5.11362 0.248
NP_441621.1_7 Reverse -258 -272 -5.11362 0.248
NP_443062.1_1 Forward -269 -251 18.6867 0.022
NP_443062.1_1 Reverse -260 -278 18.1016 0.0228
NP_441410.1_3 Forward -278 -259 11.7008 0.174
NP_441410.1_3 Reverse -251 -270 6.09597 0.23
NP_442204.1_1 Forward -273 -262 21.1015 0.0035
NP_442204.1_1 Reverse -256 -267 11.3667 0.0565
NP_441560.1_8 Forward -342 -323 11.9023 0.273
NP_440504.1_3 Reverse -23 -42 11.7008 0.239
NP_440544.1_2 Forward -342 -323 8.94757 0.207
NP_440516.1_2 Forward -275 -257 4.24738 0.138
NP_440516.1_8 Forward -269 -260 16.9127 0.00442
NP_440516.1_8 Reverse -260 -269 16.9127 0.00442
NP_442428.1_5 Forward -268 -261 15.8704 0.0124
NP_442428.1_5 Reverse -261 -268 15.8704 0.0124
NP_441353.1_8 Reverse -306 -325 18.2673 0.245
NP_441790.1_3 Reverse -347 -366 0.884433 0.209
NP_440673.1_3 Forward -267 -260 12.4288 0.0426
NP_440673.1_3 Reverse -262 -269 12.4288 0.0426
NP_440673.1_3 Reverse -202 -209 8.98723 0.203
NP_441714.1_3 Forward -388 -370 15.8496 0.138
NP_440865.1_9 Reverse -254 -273 -7.27704 0.244
NP_441052.1_2 Forward -269 -259 10.4031 0.0285
NP_441052.1_2 Reverse -260 -270 10.4031 0.0285
NP_441052.1_2 Forward -323 -313 8.63316 0.0415
NP_442219.1_8 Forward -341 -322 12.3223 0.158
NP_442219.1_9 Forward -268 -259 8.25953 0.0681
NP_442219.1_9 Reverse -261 -270 8.25953 0.0681
NP_442219.1_9 Forward -322 -313 5.3096 0.177
NP_440436.1_4 Forward -268 -259 9.24241 0.0871
NP_440436.1_4 Reverse -261 -270 9.24241 0.0871
NP_440436.1_4 Forward -354 -345 7.07914 0.142
NP_440436.1_4 Forward -322 -313 4.52254 0.256
NP_441884.1_8 Forward -270 -251 -10.0303 0.268
NP_442902.1_7 Forward -364 -345 13.1758 0.24
NP_440314.1_9 Reverse -261 -280 -0.295539 0.106
NP_441719.1_4 Forward -268 -261 16.3621 0.0124
NP_441719.1_4 Reverse -261 -268 16.3621 0.0124
NP_441719.1_6 Forward -366 -347 5.50519 0.29
NP_441004.1_8 Reverse -339 -358 19.174 0.178
NP_442366.1_3 Reverse -259 -277 -1.25915 0.208
NP_440129.1_10 Forward -276 -262 5.1128 0.185
NP_442873.1_5 Forward -52 -33 6.88182 0.294
NP_440296.1_10 Forward -148 -129 -13.7669 0.269
NP_441115.1_4 Reverse -259 -277 11.8181 0.127
NP_441115.1_4 Forward -270 -252 8.08151 0.263
NP_442206.1_10 Forward -99 -84 6.56807 0.178
NP_442206.1_10 Reverse -260 -275 4.69978 0.178
NP_442854.1_6 Forward -269 -250 22.7139 0.0459
NP_442854.1_6 Reverse -260 -279 5.01433 0.249
NP_440328.1_4 Forward -275 -256 15.0441 0.0338
NP_440328.1_4 Reverse -254 -273 12.5858 0.0513
NP_443054.1_2 Reverse -344 -358 3.44117 0.24
NP_441851.1_10 Forward -270 -260 8.53483 0.114
NP_441851.1_10 Reverse -259 -269 8.53483 0.114
NP_441851.1_10 Forward -324 -314 6.37155 0.172
NP_441851.1_10 Reverse -313 -323 5.09324 0.227
NP_441668.1_4 Reverse -180 -199 0.491109 0.237
NP_442515.1_1 Reverse -327 -341 11.996 0.0362
NP_442515.1_1 Reverse -313 -327 0.88457 0.178
NP_440463.1_8 Forward -364 -345 6.14452 0.271
NP_440165.1_5 Reverse -259 -278 12.1925 0.0454
NP_440165.1_5 Forward -270 -251 -5.21209 0.22
NP_442709.1_3 Reverse -253 -272 10.4225 0.121
NP_441349.1_10 Reverse -250 -269 15.7324 0.0122
NP_441349.1_10 Forward -279 -260 -0.295539 0.0936
NP_441349.1_10 Reverse -304 -323 -3.04881 0.132
NP_441409.1_6 Forward -275 -256 1.76941 0.0586
NP_441409.1_6 Reverse -254 -273 -15.1435 0.28
NP_441409.1_8 Forward -309 -290 7.69133 0.279
NP_440432.1_9 Forward -268 -253 12.0746 0.0274
NP_440432.1_9 Forward -354 -339 -5.13331 0.236
NP_440726.1_1 Forward -288 -269 13.5691 0.103
NP_440431.1_3 Reverse -259 -278 -6.1954 0.188
NP_440588.1_2 Forward -278 -259 -1.86883 0.157
NP_440588.1_2 Reverse -305 -324 -5.50708 0.252
NP_441003.1_9 Forward -364 -345 9.24257 0.215
NP_441570.1_1 Forward -269 -251 8.08229 0.0149
NP_441570.1_1 Reverse -260 -278 -9.81395 0.15
NP_440078.1_10 Reverse -260 -279 8.35759 0.208
NP_441078.1_4 Forward -269 -260 19.6659 0.0007
NP_441078.1_4 Reverse -260 -269 19.6659 0.0007
NP_441078.1_4 Forward -323 -314 7.37455 0.0688
NP_441078.1_4 Reverse -314 -323 0.29472 0.205
NP_441663.1_8 Forward -275 -256 8.55425 0.0906
NP_441663.1_8 Reverse -254 -273 -1.47551 0.243
NP_442348.1_2 Forward -94 -85 6.98123 0.293
NP_441432.1_8 Reverse -259 -268 16.8143 0.00595
NP_441432.1_8 Forward -270 -261 16.8143 0.00595
NP_441333.1_1 Reverse -291 -301 12.9245 0.217
NP_442344.1_7 Reverse -261 -280 -8.06369 0.202
NP_441732.1_2 Forward -273 -257 -6.52964 0.0495
NP_441732.1_2 Reverse -256 -272 -16.2644 0.165
NP_441805.1_1 Forward -317 -298 6.68596 0.082
NP_440913.1_1 Forward -271 -253 14.1788 0.125
NP_440713.1_4 Forward -279 -260 7.86593 0.174
NP_442489.1_7 Forward -269 -260 20.1576 0.000695
NP_442489.1_7 Reverse -260 -269 20.1576 0.000695
NP_442489.1_7 Forward -323 -314 0.589713 0.17
NP_442489.1_7 Reverse -314 -323 0.589713 0.17
NP_441452.1_1 Forward -133 -114 13.0775 0.292
NP_440559.1_1 Reverse -261 -270 8.65285 0.0586
NP_440559.1_1 Forward -268 -259 8.65285 0.0586
NP_441659.2_8 Forward -269 -259 20.9245 0.000805
NP_441659.2_8 Reverse -260 -270 20.9245 0.000805
NP_441659.2_8 Reverse -314 -324 -0.216628 0.292
NP_442913.1_10 Reverse -251 -270 4.03102 0.0942
NP_442913.1_10 Forward -332 -313 -2.65548 0.19
NP_442008.1_2 Reverse -257 -276 21.5339 0.0218
NP_441800.1_10 Reverse -345 -364 11.7008 0.103
NP_442346.1_5 Forward -270 -260 16.303 0.00248
NP_442346.1_5 Reverse -259 -269 16.303 0.00248
NP_440545.1_3 Reverse -256 -273 14.3952 0.0154
NP_440545.1_3 Forward -273 -256 6.62702 0.0551
NP_441856.1_3 Forward -272 -253 2.3594 0.199
NP_441710.1_9 Reverse -253 -272 15.7316 0.103
NP_440847.1_3 Reverse -209 -223 11.2087 0.271
NP_442603.1_7 Forward -54 -40 10.0287 0.134
NP_442603.1_7 Reverse -260 -274 7.27547 0.211
NP_441888.1_5 Reverse -186 -205 1.86774 0.289
NP_441888.1_7 Forward -274 -260 13.3726 0.0743
NP_441888.1_8 Reverse -191 -210 7.96426 0.296
NP_441050.1_5 Forward -119 -101 -2.24246 0.279
NP_440449.1_6 Reverse -37 -55 6.11605 0.259
NP_441948.1_4 Reverse -253 -271 -5.58572 0.271
NP_441833.1_4 Forward -268 -261 15.9687 0.0124
NP_441833.1_4 Reverse -261 -268 15.9687 0.0124
NP_441329.1_6 Reverse -180 -199 3.77151 0.212
NP_441329.1_6 Forward -311 -292 0.429291 0.254
NP_442060.1_10 Reverse -208 -227 10.0292 0.244
NP_441112.1_6 Forward -183 -164 -4.22878 0.296
NP_442162.1_9 Forward -268 -261 16.2637 0.0124
NP_442162.1_9 Reverse -261 -268 16.2637 0.0124
NP_440671.1_4 Forward -275 -261 11.0127 0.142
NP_440671.1_4 Reverse -254 -268 5.50613 0.281
NP_441973.1_1 Forward -396 -381 -0.118434 0.269
NP_442045.1_5 Forward -367 -348 -1.86883 0.29
NP_442140.1_3 Forward -268 -258 4.69992 0.238
NP_442140.1_3 Reverse -261 -271 4.69992 0.238
NP_442723.1_1 Forward -370 -351 2.16195 0.291
NP_440875.1_9 Forward -267 -257 16.5483 0.0145
NP_440875.1_9 Reverse -262 -272 16.5483 0.0145
NP_440875.1_9 Reverse -87 -97 9.05339 0.233
NP_441813.1_5 Reverse -258 -268 18.1713 0.00743
NP_441813.1_5 Forward -271 -261 18.1713 0.00743
NP_441259.1_8 Reverse -237 -256 10.1267 0.288
NP_440590.1_4 Reverse -261 -274 -2.63565 0.247
NP_440590.1_4 Forward -268 -255 -5.38892 0.277
NP_440567.1_1 Reverse -261 -275 4.03116 0.131
NP_442497.1_10 Forward -268 -259 17.601 0.00813
NP_442497.1_10 Reverse -261 -270 17.601 0.00813
NP_442497.1_10 Reverse -315 -324 0.29472 0.199
NP_440821.1_4 Reverse -258 -268 2.24165 0.131
NP_440821.1_4 Forward -271 -261 2.24165 0.131
NP_441239.1_9 Forward -271 -259 13.0187 0.0389
NP_441239.1_9 Reverse -258 -270 13.0187 0.0389
NP_441239.1_9 Forward -357 -345 10.1671 0.0861
NP_442691.1_2 Reverse -88 -107 3.93269 0.283
NP_442568.1_8 Forward -311 -297 10.7177 0.257
NP_440400.1_1 Forward -364 -345 3.73524 0.22
NP_441892.1_1 Reverse -251 -268 1.51381 0.152
NP_441892.1_1 Forward -278 -261 -0.256152 0.181
NP_441892.1_1 Reverse -337 -354 -2.61609 0.224
NP_442044.1_9 Reverse -260 -279 8.65258 0.163
NP_442138.1_10 Reverse -260 -279 7.66927 0.0656
NP_442809.1_6 Reverse -69 -88 2.0644 0.269
NP_440546.1_4 Reverse -260 -270 13.5365 0.0459
NP_440546.1_4 Forward -269 -259 13.5365 0.0459
NP_439974.1_4 Forward -305 -286 8.25926 0.282
NP_440462.1_6 Reverse -258 -268 18.7612 0.00454
NP_440462.1_6 Forward -271 -261 18.7612 0.00454
NP_440462.1_6 Forward -96 -86 4.60159 0.194
NP_440868.1_4 Reverse -256 -268 14.7886 0.0169
NP_440868.1_4 Forward -273 -261 8.00379 0.0602
NP_440868.1_4 Forward -84 -72 -0.551008 0.274
NP_442499.1_1 Reverse -323 -342 3.73603 0.251
NP_442499.1_1 Forward -59 -40 3.44104 0.257
NP_441582.1_5 Reverse -312 -331 17.5015 0.0852
NP_442402.1_2 Forward -373 -359 10.5204 0.292
NP_442402.1_4 Forward -194 -175 -6.29447 0.255
NP_442402.1_4 Forward -193 -174 -9.63771 0.292
NP_441848.1_6 Forward -363 -344 21.5331 0.062
NP_441848.1_7 Forward -204 -185 0.785326 0.228
NP_440696.1_3 Forward -269 -251 9.36059 0.149
NP_442039.1_4 Forward -268 -261 15.1821 0.0124
NP_442039.1_4 Reverse -261 -268 15.1821 0.0124
NP_442039.1_4 Forward -322 -315 7.80726 0.24
NP_442039.1_7 Reverse -324 -334 15.6147 0.211
NP_442273.1_10 Reverse -339 -357 19.0954 0.0507
NP_442679.1_1 Forward -310 -291 -5.60541 0.293
NP_441926.1_3 Forward -269 -253 5.95839 0.17
NP_442837.1_3 Forward -268 -261 15.7721 0.0124
NP_442837.1_3 Reverse -261 -268 15.7721 0.0124
NP_441760.1_7 Forward -88 -70 9.95058 0.246
NP_440160.1_2 Reverse -345 -364 -9.047 0.293
NP_440160.1_9 Reverse -260 -279 13.5691 0.204
NP_442053.1_1 Forward -269 -260 18.3876 0.0007
NP_442053.1_1 Reverse -260 -269 18.3876 0.0007
NP_442053.1_1 Reverse -314 -323 11.4061 0.0409
NP_440505.1_3 Reverse -258 -268 17.188 0.00332
NP_440505.1_3 Forward -271 -261 17.188 0.00332
NP_440505.1_3 Forward -117 -107 7.64985 0.151
NP_440505.1_3 Reverse -68 -78 4.50326 0.284
NP_440505.1_3 Reverse -326 -336 4.40493 0.292
NP_440505.1_7 Forward -330 -311 4.42435 0.197
NP_440505.1_7 Forward -263 -244 2.94938 0.222
NP_441203.1_1 Forward -268 -249 -15.0452 0.21
NP_441408.2_7 Forward -314 -295 2.65439 0.205
NP_442174.1_9 Reverse -258 -277 14.7491 0.164
NP_440914.1_1 Forward -269 -259 16.3248 0.00196
NP_440914.1_1 Reverse -260 -270 16.3248 0.00196
NP_440914.1_1 Forward -323 -313 7.34642 0.241
NP_441011.1_8 Forward -268 -259 16.6177 0.00602
NP_441011.1_8 Reverse -261 -270 16.6177 0.00602
NP_442101.1_10 Reverse -252 -271 -5.60541 0.173
NP_442533.1_1 Reverse -36 -55 -6.58872 0.175
NP_442533.1_6 Forward -269 -260 17.2076 0.00137
NP_442533.1_6 Reverse -260 -269 17.2076 0.00137
NP_442533.1_6 Forward -323 -314 6.78456 0.103
NP_442533.1_6 Forward -354 -345 3.53964 0.21
NP_442533.1_6 Forward -164 -155 2.35967 0.259
NP_442541.1_10 Forward -372 -358 5.89884 0.248
NP_442541.1_10 Forward -60 -46 1.08065 0.292
NP_442322.1_4 Forward -363 -346 -9.10659 0.287
NP_441482.1_7 Forward -275 -261 14.5526 0.0117
NP_441482.1_7 Reverse -254 -268 6.6861 0.0269
NP_442293.1_7 Forward -190 -171 20.0581 0.251
NP_442293.1_8 Forward -79 -60 23.4022 0.0082
NP_439944.1_9 Forward -268 -258 9.12481 0.1
NP_439944.1_9 Reverse -261 -271 9.12481 0.1
NP_441028.1_6 Forward -127 -117 3.8145 0.281
NP_440116.1_5 Reverse -257 -274 6.33202 0.167
NP_440116.1_8 Reverse -261 -280 -5.21209 0.188
NP_441527.1_4 Forward -310 -291 -3.77235 0.173
NP_441527.1_4 Forward -311 -292 -4.63178 0.188
NP_441527.1_4 Forward -307 -288 -6.15965 0.215
NP_441527.1_4 Forward -303 -284 -6.35064 0.217
NP_441527.1_4 Forward -309 -290 -6.54162 0.221
NP_441527.1_4 Forward -301 -282 -8.06949 0.24
NP_441527.1_4 Forward -304 -285 -8.73794 0.25
NP_441527.1_4 Forward -302 -283 -10.1703 0.266
NP_441527.1_4 Reverse -339 -358 -10.8388 0.275
NP_441527.1_4 Forward -313 -294 -11.0297 0.278
NP_441527.1_7 Forward -359 -340 10.7167 0.282
NP_440115.1_6 Forward -272 -262 14.0414 0.0615
NP_440115.1_6 Reverse -257 -267 14.0414 0.0615
NP_440007.1_9 Forward -273 -259 10.816 0.163
NP_440007.1_9 Reverse -256 -270 1.37622 0.285
NP_441347.1_5 Reverse -79 -93 10.0287 0.269
NP_441059.1_10 Reverse -343 -356 11.1307 0.275
NP_441544.1_1 Forward -357 -345 16.8536 0.232
NP_442673.1_7 Forward -398 -379 12.0793 0.267
NP_441972.1_3 Reverse -350 -369 11.2092 0.284
NP_441972.1_5 Forward -280 -261 -2.45882 0.184
NP_441106.1_1 Reverse -259 -268 18.486 0.0028
NP_441106.1_1 Forward -270 -261 18.486 0.0028
NP_440429.1_9 Reverse -345 -364 2.55606 0.278
NP_439903.1_6 Reverse -257 -276 12.3883 0.0872
NP_001035870.1_10 Forward -305 -286 16.4378 0.146
NP_441286.1_1 Forward -270 -258 -3.50094 0.145
NP_441286.1_1 Reverse -259 -271 -3.50094 0.145
NP_441286.1_1 Reverse -313 -325 -4.09092 0.149
NP_440670.1_8 Forward -269 -260 18.3876 0.000699
NP_440670.1_8 Reverse -260 -269 18.3876 0.000699
NP_440670.1_8 Reverse -314 -323 5.40793 0.158
NP_440886.1_7 Forward -270 -260 8.04271 0.0805
NP_440886.1_7 Reverse -259 -269 8.04271 0.0805
NP_440828.1_1 Reverse -236 -255 1.08032 0.256
NP_442614.1_2 Reverse -345 -359 7.57108 0.271
NP_440404.1_9 Forward -302 -283 8.54611 0.242
NP_442072.1_9 Forward -270 -252 -12.8622 0.0926
NP_442072.1_9 Reverse -259 -277 -13.1572 0.102
NP_440907.2_8 Forward -268 -258 9.616 0.103
NP_440907.2_8 Reverse -261 -271 9.616 0.103
NP_441463.1_3 Forward -279 -260 -0.885524 0.134
NP_442842.1_10 Reverse -285 -304 2.01867 0.254
NP_441626.1_2 Forward -268 -261 15.7721 0.0124
NP_441626.1_2 Reverse -261 -268 15.7721 0.0124
NP_441988.1_2 Reverse -243 -262 12.6841 0.239
NP_441988.1_2 Reverse -240 -259 10.5209 0.239
NP_441460.1_2 Forward -126 -113 15.555 0.171
NP_441460.1_2 Reverse -239 -252 13.5883 0.289
NP_440107.1_2 Forward -274 -255 8.65258 0.299
NP_442794.1_1 Forward -273 -261 10.5604 0.0721
NP_442615.1_1 Forward -278 -260 2.57575 0.066
NP_442615.1_1 Reverse -251 -269 -1.25915 0.127
NP_442615.1_1 Reverse -305 -323 -5.29072 0.209
NP_440387.1_1 Reverse -260 -276 8.61333 0.0282
NP_440387.1_1 Forward -269 -253 -2.98973 0.153
NP_440855.1_5 Reverse -239 -258 2.6536 0.288
NP_441431.1_2 Forward -272 -258 7.07881 0.251
NP_441431.1_2 Reverse -257 -271 7.07881 0.251
NP_441488.1_8 Reverse -267 -281 7.76712 0.228
NP_440634.1_10 Reverse -369 -388 7.96345 0.239
NP_441993.1_1 Forward -275 -256 3.506 0.233
NP_440114.1_10 Forward -269 -255 10.3243 0.148
NP_442323.1_7 Reverse -255 -274 0.785326 0.299
NP_440725.1_4 Reverse -102 -121 -0.4922 0.292
NP_440457.1_1 Forward -273 -261 7.70879 0.101
NP_440457.1_1 Reverse -256 -268 0.727295 0.25
NP_440798.1_1 Forward -201 -183 13.5374 0.294
NP_440798.1_6 Forward -268 -255 10.5407 0.074
NP_442680.1_5 Reverse -57 -76 0.560681 0.263
NP_442680.1_7 Reverse -170 -189 -3.3438 0.265
NP_442680.1_7 Forward -185 -166 -6.49039 0.265
NP_441436.1_8 Reverse -327 -346 7.27595 0.293
NP_440473.1_1 Reverse -311 -330 12.3179 0.238
NP_440473.1_9 Reverse -144 -163 -8.16202 0.246
NP_442509.1_9 Reverse -260 -270 8.04271 0.192
NP_442509.1_9 Forward -269 -259 8.04271 0.192
NP_442509.1_9 Reverse -314 -324 6.66608 0.259
NP_440554.1_4 Forward -268 -258 17.9746 0.0131
NP_440554.1_4 Reverse -261 -271 17.9746 0.0131
NP_442862.1_3 Forward -199 -182 7.41366 0.255
NP_441885.1_5 Forward -269 -259 11.3864 0.00668
NP_441885.1_5 Reverse -260 -270 11.3864 0.00668
NP_441885.1_5 Forward -323 -313 8.92815 0.0272
NP_442228.1_10 Reverse -27 -46 15.3391 0.185
NP_440628.1_1 Forward -301 -291 14.6456 0.248
NP_442341.1_5 Forward -58 -39 11.7008 0.273
NP_442341.1_9 Reverse -258 -272 11.1104 0.13
NP_442341.1_9 Forward -271 -257 11.1104 0.13
NP_441756.1_5 Forward -273 -254 3.93269 0.199
NP_441756.1_5 Forward -364 -345 -3.54046 0.29
NP_442395.2_4 Reverse -13 -32 0.981987 0.255
NP_443000.1_7 Reverse -258 -268 20.3345 0.00223
NP_443000.1_7 Forward -271 -261 20.3345 0.00223
NP_440076.1_5 Reverse -114 -133 12.6833 0.256
NP_440275.1_3 Forward -271 -261 16.1063 0.0155
NP_440275.1_3 Reverse -258 -268 16.1063 0.0155
NP_440149.1_10 Reverse -346 -365 -10.1286 0.275
NP_441105.1_3 Forward -280 -261 19.5673 0.00876
NP_440216.1_1 Forward -269 -255 24.9757 0.000528
NP_440216.1_1 Reverse -260 -274 7.27608 0.00942
NP_440216.1_1 Reverse -314 -328 6.6861 0.0139
NP_440216.1_9 Forward -315 -306 5.70292 0.29
NP_440172.1_1 Forward -269 -259 17.5813 0.00421
NP_440172.1_1 Reverse -260 -270 17.5813 0.00421
NP_440172.1_1 Reverse -314 -324 4.69992 0.171
NP_442015.1_8 Reverse -312 -331 10.3242 0.151
NP_442015.1_10 Forward -273 -260 13.4906 0.0354
NP_442015.1_10 Reverse -256 -269 3.75586 0.178
NP_441226.1_7 Forward -268 -261 14.4934 0.0123
NP_441226.1_7 Reverse -261 -268 14.4934 0.0123
NP_441226.1_7 Forward -163 -156 8.59356 0.197
NP_441111.1_7 Forward -268 -260 18.7023 0.00294
NP_441111.1_7 Reverse -261 -269 18.7023 0.00294
NP_442379.1_10 Reverse -253 -270 -0.256152 0.223
NP_442379.1_10 Forward -276 -259 -2.3211 0.228
NP_439971.2_9 Forward -361 -342 17.7974 0.229
NP_441766.1_2 Forward -269 -260 17.5026 0.00297
NP_441766.1_2 Reverse -260 -269 17.5026 0.00297
NP_441766.1_2 Reverse -314 -323 3.93297 0.2
NP_442417.1_5 Reverse -260 -274 16.2242 0.0423
NP_442417.1_5 Forward -269 -255 4.52282 0.292
NP_440416.1_9 Forward -276 -257 -4.91709 0.0783
NP_440416.1_9 Reverse -307 -326 -15.4385 0.191
NP_440416.1_9 Reverse -253 -272 -15.9302 0.204
NP_443052.1_8 Reverse -250 -269 -8.35868 0.173
NP_443052.1_8 Forward -333 -314 -13.3736 0.283
NP_440072.1_5 Reverse -36 -54 -2.43913 0.271
NP_442116.1_6 Forward -200 -183 10.6517 0.215
NP_440591.1_9 Forward -276 -258 11.5239 0.0943
NP_440591.1_9 Reverse -148 -166 6.60732 0.215
NP_442154.1_1 Forward -260 -242 -16.4021 0.239
NP_442564.1_10 Forward -53 -39 8.65272 0.296
NP_440261.1_5 Forward -268 -255 6.60746 0.0318
NP_440261.1_5 Reverse -261 -274 -2.73398 0.0924
NP_440261.1_5 Reverse -315 -328 -4.7006 0.165
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATAATTTGGCTTTGTTGGTCATTATCACTAACCTTTCCACCCTGCTGCCCTTGCCCTTTTTGGGACTGTTGCCAGCGGGAGATCCCCAAGTAAAAGACAAAACAGAAAAAGAGGATAATCCTGATGACCCAGGCGATCGCCTGGTGTTGCCTCCAGCGGAAGTGTTTGAACATCATACAGTGGGCAGTTTGAGCGACCAAAATTTCTTGCCCGAATTTTTCCCGGAAAAAAGTTCCAGCCGTCCCTAGTTTCCGGTGAGTAGGGCTACAACGCTTTGCCCCTGGAGGCAATACTTTAGACTGGAGAGGGGATTGATTGGCCTCGAACTGCCTGTTTTGCTAATCCAGGCCACCCCGCCCAGAATCTAGCTGTGACCCTGTAACCTCCGAGTTTTGTAACA

CDS

ATGTGGCTTCTTTTGCTCATCCTTGCTGTCATCACTTATTTTGTGGTTAAAAGCAATGCCGCCCCCATCACCCGCACCCCGATTTGGATATTGTGGTTGGTGTTGATGGCTCCGGCCACCCTCTGGACAATTTGGGCCATGATTTACGGCCCCGATGCCCCCCTGCCGCCCCTACTGCTCCTGGGGCCATTTTTGGTTTGTCCACTGCTCTACTGGTGGTTGGTGCAAAAAGGTCGCATTGTCCCCGATAAAGAGGCCCAAGCTACCGCTTCCCCTAGCACCGATGGCACCCAAGGAAAAGAGCAGAAATCATCACAGCCAACCCCTCGACCCATTGATGCGGCGGAAGAAAAATCTTTGCGGGATTGTTTTCCCTGGGGAGTGTATTACCTCCAGCAATTAGACTATCGCCCCCAAGCCATTCTGTGCCGAGGTAAATTACAGGTAGCGCCGGAAATGGCCTATGAACGGGTCAAGGGCAATGTGGAAGATGTCTTTGGCGATCGCTTTTTAGTTTTATTTCAAGAAAGTTTACAAGGCCAACCTTTTTTCGCCTTGGTCCCTAACCCGGCCCAGGCGAAGGAAGATCGCGTTAATAATGGCGAAAAGCTCCATAAACCTTGGTTAGCGTTAACCTTACTGCTGCTCACTGGGTTTACCACCACCATGGTGGGGGCGGAAATGGCCGGTTTGACCCCCGAAAAACTCCAGGCAGGCATCCAGACGTTAATGGTGGGTTTACCCTACAGTTTGGCAATTTTGACTATTTTGGGGTGCCATGAATTGAGTCACTATGGGGCAGCGATCCACTACAAAATCCGCACCACTTTGCCCTATTTCATTCCCATTCCCTTCTTTTTGGGTACCTTTGGCGCTTTTATCCAGATGAAGTCCCCGGTGCCCCACCGTAAGGCCTTATTTGATGTGGCGATCGCCGGGCCGTTGGGGGGCTTGGTGGTGGCGTTGCCAATTTTATGGTGGGGGTTGGCCCAATCCACTGTGGAACCCATGCCGGACAATACTAACCTGTTGCGGTTTGATGCCCTGGATTATCGTTTTTCTCTGCTGATGACCCTAATTACGAAGGCAGCGTTGGGCAGTCAATTAGGGGCTAATACGGTGTTAGACCTCCATCCCTTGGCGATCGCCGGTTACATTGGTTTGATTGTGACTGCCTTGAATCTGATGCCCTTTGGTCAATTGGACGGGGGGCACATTATCCACGCCATGTTGGGACAACGGGCGGCCATTGTGACAGGGCAAATTACCAGGGTGGCCATGGTGCTGCTGTCCTTTATCCGTAGTGATTTTTTCATCTGGGCAATTATTTTGTTACTGATGCCTGTGGGGGATCAGCCAGCTTTAAATGATGTCAGCGAGTTGGATGACCGTCGGGATTTGTTAGGTATTCTGGCGATCGCCATTTTGATTTTGATCCTTTTGCCGGTGCCGCCCCCATTAGCCCAGTGGTTGGGAATATAG

Protein

MWLLLLILAVITYFVVKSNAAPITRTPIWILWLVLMAPATLWTIWAMIYGPDAPLPPLLLLGPFLVCPLLYWWLVQKGRIVPDKEAQATASPSTDGTQGKEQKSSQPTPRPIDAAEEKSLRDCFPWGVYYLQQLDYRPQAILCRGKLQVAPEMAYERVKGNVEDVFGDRFLVLFQESLQGQPFFALVPNPAQAKEDRVNNGEKLHKPWLALTLLLLTGFTTTMVGAEMAGLTPEKLQAGIQTLMVGLPYSLAILTILGCHELSHYGAAIHYKIRTTLPYFIPIPFFLGTFGAFIQMKSPVPHRKALFDVAIAGPLGGLVVALPILWWGLAQSTVEPMPDNTNLLRFDALDYRFSLLMTLITKAALGSQLGANTVLDLHPLAIAGYIGLIVTALNLMPFGQLDGGHIIHAMLGQRAAIVTGQITRVAMVLLSFIRSDFFIWAIILLLMPVGDQPALNDVSELDDRRDLLGILAIAILILILLPVPPPLAQWLGI