Your browser is old and dusty. Try Google Chrome!

Details for slr0633

ORF slr0633
Accession NP_442281.1
Symbol thiG
Category Thiamin
Definition thiamine biosynthesis protein ThiG
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -136 -122 7.57108 0.101
NP_441061.1_2 Reverse -129 -143 3.63784 0.161
NP_440557.1_1 Forward -136 -117 5.40766 0.162
NP_440795.1_7 Forward -136 -129 14.6904 0.0123
NP_440795.1_7 Reverse -129 -136 14.6904 0.0123
NP_441418.1_6 Forward -137 -118 -2.45882 0.019
NP_441418.1_6 Reverse -128 -147 -27.9265 0.203
NP_441418.1_6 Reverse -116 -135 -30.0898 0.256
NP_440815.1_5 Reverse -128 -147 3.14605 0.288
NP_442291.1_5 Reverse -127 -143 -1.12144 0.192
NP_442291.1_7 Reverse -194 -208 11.3077 0.217
NP_440897.1_6 Forward -137 -118 -2.55791 0.216
NP_441453.1_4 Reverse -128 -136 16.539 0.00633
NP_441453.1_4 Forward -137 -129 16.539 0.00633
NP_441453.1_4 Forward -207 -199 4.24765 0.259
NP_442877.1_3 Reverse -117 -136 12.585 0.217
NP_442151.1_6 Forward -207 -193 11.6026 0.0956
NP_442151.1_6 Forward -137 -123 11.5043 0.0981
NP_442151.1_6 Reverse -128 -142 11.3077 0.104
NP_442151.1_6 Reverse -198 -212 10.3243 0.125
NP_441818.1_1 Reverse -129 -140 10.1862 0.232
NP_440226.1_1 Forward -137 -118 9.73422 0.0694
NP_441465.1_8 Forward -270 -252 4.9357 0.299
NP_441630.1_3 Forward -145 -126 -0.885524 0.29
NP_442744.1_8 Reverse -270 -289 -0.590531 0.254
NP_442173.1_1 Forward -136 -128 15.4574 0.00633
NP_442173.1_1 Reverse -129 -137 15.4574 0.00633
NP_442173.1_1 Forward -258 -250 7.00092 0.186
NP_442752.1_4 Forward -137 -130 13.8055 0.0199
NP_442752.1_4 Reverse -128 -135 13.8055 0.0199
NP_442752.1_4 Forward -259 -252 6.23397 0.161
NP_443027.1_4 Reverse -126 -136 13.943 0.0452
NP_443027.1_4 Reverse -248 -258 7.35486 0.24
NP_443027.1_4 Reverse -359 -369 7.25653 0.24
NP_443027.1_4 Forward -209 -199 6.56821 0.275
NP_442975.1_10 Reverse -124 -138 20.9434 0.00133
NP_442975.1_10 Forward -141 -127 2.75226 0.269
NP_440784.1_7 Forward -136 -129 15.9687 0.0123
NP_440784.1_7 Reverse -129 -136 15.9687 0.0123
NP_440061.1_9 Forward -139 -125 13.6669 0.0775
NP_440110.1_8 Forward -139 -120 -1.67217 0.249
NP_441476.1_5 Forward -142 -123 -1.7705 0.205
NP_439979.1_4 Reverse -164 -183 20.7685 0.0278
NP_440878.1_9 Reverse -188 -207 6.78429 0.174
NP_442062.1_8 Forward -137 -127 19.4496 0.000558
NP_442062.1_8 Reverse -128 -138 17.3846 0.00193
NP_440761.1_4 Forward -212 -193 -12.0953 0.226
NP_441802.1_1 Forward -197 -178 4.12936 0.298
NP_440304.1_4 Reverse -126 -136 9.91146 0.051
NP_440304.1_4 Forward -139 -129 1.84832 0.299
NP_442242.1_4 Forward -136 -129 14.3954 0.0124
NP_442242.1_4 Reverse -129 -136 14.3954 0.0124
NP_440044.1_8 Reverse -129 -148 10.7175 0.0551
NP_440044.1_8 Forward -363 -344 2.85105 0.143
NP_440011.1_1 Forward -340 -321 11.6025 0.27
NP_440916.1_1 Reverse -9 -23 7.76774 0.291
NP_439918.1_2 Forward -258 -239 -3.44213 0.254
NP_441208.1_9 Forward -140 -126 13.5693 0.103
NP_442110.1_7 Forward -137 -123 9.93102 0.0684
NP_442110.1_7 Reverse -128 -142 0.982901 0.241
NP_440014.1_7 Reverse -119 -133 17.6985 0.119
NP_441083.1_5 Reverse -128 -138 20.3345 0.00053
NP_441083.1_5 Forward -137 -127 11.3864 0.0159
NP_441083.1_5 Reverse -198 -208 -0.511621 0.269
NP_442827.1_8 Reverse -120 -139 5.80018 0.113
NP_441738.1_2 Forward -135 -128 15.28 0.0102
NP_441738.1_2 Reverse -130 -137 15.28 0.0102
NP_441558.1_5 Forward -139 -120 16.2241 0.0318
NP_440209.1_1 Reverse -128 -136 18.1123 0.00295
NP_440209.1_1 Forward -137 -129 18.1123 0.00295
NP_442889.1_1 Forward -213 -194 -3.54046 0.145
NP_442889.1_8 Reverse -125 -139 13.372 0.0588
NP_442889.1_8 Forward -93 -79 6.39049 0.192
NP_441770.1_3 Forward -389 -370 12.5858 0.092
NP_440178.1_7 Forward -138 -119 -11.2103 0.088
NP_442059.1_6 Reverse -352 -371 19.6753 0.182
NP_442445.1_1 Forward -206 -187 15.6341 0.151
NP_442601.1_5 Forward -183 -164 16.4207 0.151
NP_441716.1_1 Forward -137 -123 4.22782 0.256
NP_441716.1_1 Reverse -128 -142 3.53951 0.261
NP_441327.1_6 Reverse -98 -111 20.1771 0.0642
NP_442111.1_4 Forward -138 -124 19.2725 0.00439
NP_442111.1_4 Reverse -112 -126 6.88276 0.11
NP_441624.1_1 Forward -136 -117 17.7974 0.158
NP_440906.1_4 Reverse -206 -225 14.7491 0.292
NP_440906.1_5 Forward -136 -129 15.8704 0.0124
NP_440906.1_5 Reverse -129 -136 15.8704 0.0124
NP_440747.1_10 Forward -140 -128 14.9853 0.00221
NP_440747.1_10 Reverse -125 -137 -2.02597 0.0196
NP_440747.1_10 Forward -373 -361 -12.5474 0.297
NP_441130.1_10 Reverse -126 -140 10.4227 0.113
NP_441130.1_10 Forward -139 -125 9.14437 0.128
NP_441486.1_1 Reverse -125 -139 14.1593 0.00654
NP_441486.1_1 Forward -140 -126 13.2743 0.00871
NP_441486.1_1 Forward -210 -196 3.53951 0.0575
NP_441265.1_3 Reverse -122 -136 2.94952 0.181
NP_440403.1_4 Forward -146 -127 1.37609 0.136
NP_442848.1_1 Forward -143 -129 6.98109 0.0791
NP_442848.1_1 Reverse -122 -136 -1.96703 0.263
NP_442848.1_9 Forward -143 -124 3.73603 0.216
NP_441012.1_4 Reverse -194 -207 5.52582 0.294
NP_443018.1_3 Forward -136 -129 14.8871 0.0123
NP_443018.1_3 Reverse -129 -136 14.8871 0.0123
NP_443018.1_3 Forward -206 -199 12.5271 0.0523
NP_443018.1_3 Reverse -199 -206 12.5271 0.0523
NP_441634.1_8 Forward -139 -125 15.6342 0.0248
NP_441634.1_8 Reverse -385 -399 -2.55701 0.295
NP_440376.1_1 Forward -137 -128 19.4693 0.000692
NP_440376.1_1 Reverse -128 -137 19.4693 0.000692
NP_441588.1_4 Reverse -130 -140 18.1713 0.0143
NP_441588.1_4 Forward -362 -352 7.64985 0.178
NP_443065.1_6 Forward -374 -355 2.16274 0.221
NP_442687.1_7 Reverse -127 -137 15.8113 0.0125
NP_442687.1_7 Forward -138 -128 8.92815 0.0994
NP_442687.1_7 Reverse -197 -207 4.69992 0.238
NP_442191.1_4 Forward -136 -122 15.2592 0.0634
NP_442958.1_3 Reverse -117 -136 -2.0655 0.293
NP_440642.1_10 Reverse -189 -203 5.70218 0.241
NP_440533.1_9 Reverse -198 -217 2.75272 0.264
NP_441950.1_7 Reverse -88 -107 -8.55534 0.287
NP_442296.1_9 Forward -89 -70 -0.688862 0.197
NP_441763.1_10 Reverse -117 -136 4.81688 0.297
NP_442658.1_1 Reverse -126 -136 18.7607 0.00222
NP_442658.1_1 Forward -139 -129 6.76441 0.214
NP_440141.1_8 Reverse -33 -52 9.83255 0.211
NP_440141.1_8 Reverse -32 -51 5.11266 0.278
NP_442782.1_2 Forward -344 -330 5.89945 0.234
NP_442496.1_5 Reverse -42 -60 10.7372 0.217
NP_442496.1_5 Reverse -143 -161 10.4422 0.217
NP_442205.1_2 Reverse -126 -145 14.1593 0.21
NP_441414.1_9 Forward -137 -118 4.03102 0.0557
NP_442937.1_5 Forward -142 -123 15.7324 0.0546
NP_442937.1_5 Reverse -350 -369 7.07928 0.263
NP_441958.1_5 Forward -138 -128 12.2714 0.00183
NP_441958.1_5 Reverse -127 -137 12.2714 0.00183
NP_441958.1_5 Forward -260 -250 0.0783647 0.168
NP_441127.1_1 Reverse -125 -139 7.9644 0.3
NP_442836.1_5 Reverse -122 -141 1.27776 0.287
NP_439905.1_1 Forward -136 -123 11.819 0.204
NP_440984.1_7 Reverse -123 -137 13.1759 0.117
NP_439990.1_5 Forward -142 -129 10.049 0.128
NP_442911.1_2 Reverse -118 -137 22.4189 0.00418
NP_440153.1_5 Forward -136 -122 13.7659 0.0551
NP_442119.1_9 Forward -138 -119 10.6192 0.248
NP_443055.1_2 Reverse -258 -277 12.1925 0.222
NP_440993.1_2 Forward -142 -126 2.8118 0.262
NP_440993.1_2 Reverse -123 -139 2.22182 0.269
NP_440993.1_3 Reverse -118 -137 6.39016 0.148
NP_439975.1_3 Reverse -39 -52 16.9322 0.201
NP_441099.1_5 Forward -147 -128 2.85105 0.0535
NP_441099.1_5 Reverse -118 -137 -8.35868 0.193
NP_442002.1_9 Reverse -127 -134 10.7572 0.185
NP_441294.1_7 Reverse -124 -138 17.1217 0.0101
NP_441294.1_7 Forward -141 -127 8.57871 0.294
NP_440411.1_10 Forward -328 -309 11.9207 0.26
NP_441646.1_1 Reverse -121 -140 2.26107 0.219
NP_442438.1_10 Reverse -123 -137 19.6658 0.0132
NP_441752.1_6 Forward -107 -88 1.17943 0.257
NP_441000.1_6 Forward -138 -124 -4.13031 0.227
NP_441000.1_6 Reverse -127 -141 -4.81863 0.252
NP_440147.1_4 Forward -139 -126 19.4888 0.00276
NP_440147.1_4 Reverse -126 -139 3.46087 0.187
NP_441550.1_8 Forward -139 -129 14.6309 0.0132
NP_441550.1_8 Reverse -126 -136 10.501 0.066
NP_441916.1_7 Forward -137 -127 18.4663 0.00144
NP_441916.1_7 Reverse -128 -138 10.3048 0.0261
NP_441916.1_7 Reverse -81 -91 2.04498 0.265
NP_441916.1_10 Forward -209 -190 4.12936 0.223
NP_441916.1_10 Forward -196 -177 3.44104 0.232
NP_441916.1_10 Reverse -120 -139 2.55606 0.244
NP_440465.1_10 Reverse -125 -144 -0.688862 0.29
NP_441041.1_4 Forward -137 -118 -4.6221 0.14
NP_441041.1_7 Forward -140 -128 11.8878 0.0689
NP_441041.1_7 Reverse -125 -137 10.2357 0.1
NP_442004.1_6 Forward -326 -312 9.63603 0.14
NP_442004.1_6 Reverse -317 -331 6.6861 0.171
NP_441725.1_5 Forward -136 -126 9.02648 0.0553
NP_441725.1_5 Reverse -129 -139 2.04498 0.115
NP_441725.1_5 Reverse -199 -209 -0.511621 0.26
NP_439966.1_7 Reverse -126 -136 17.4824 0.00636
NP_439966.1_7 Forward -139 -129 7.25606 0.15
NP_439966.1_7 Forward -96 -86 6.27276 0.185
NP_439966.1_9 Reverse -126 -135 10.7178 0.0863
NP_440202.1_4 Reverse -145 -164 15.8307 0.265
NP_442941.1_3 Reverse -129 -139 11.0914 0.0116
NP_442941.1_3 Forward -136 -126 2.53664 0.14
NP_442941.1_3 Reverse -251 -261 0.57002 0.199
NP_442941.1_3 Reverse -199 -209 0.373358 0.212
NP_440289.1_2 Reverse -125 -138 10.2457 0.0272
NP_440289.1_2 Forward -140 -127 -2.144 0.251
NP_440289.1_2 Forward -210 -197 -4.50394 0.288
NP_440260.1_8 Reverse -91 -109 -6.4707 0.291
NP_440260.1_8 Forward -146 -128 -7.15901 0.295
NP_442281.1_1 Forward -142 -128 18.1901 0.00483
NP_442281.1_1 Reverse -123 -137 9.14375 0.0736
NP_442281.1_1 Reverse -193 -207 7.17714 0.106
NP_442281.1_5 Forward -256 -237 21.828 0.0775
NP_441334.1_7 Forward -139 -120 -20.8467 0.281
NP_441334.1_7 Reverse -111 -130 -20.945 0.284
NP_442575.1_8 Forward -206 -187 -2.85214 0.245
NP_442256.1_2 Forward -139 -121 -4.79907 0.214
NP_442012.1_1 Forward -143 -124 14.0608 0.058
NP_442012.1_1 Reverse -122 -141 3.34271 0.18
NP_442049.1_6 Reverse -347 -366 5.30933 0.234
NP_442049.1_6 Forward -145 -126 4.62101 0.247
NP_441457.1_7 Forward -139 -120 -0.000545616 0.288
NP_441556.1_4 Reverse -116 -135 11.5476 0.247
NP_441556.1_10 Reverse -123 -137 14.894 0.154
NP_440498.1_1 Reverse -119 -137 1.78911 0.202
NP_441644.1_6 Reverse -128 -138 17.3841 0.00127
NP_441644.1_6 Reverse -198 -208 11.2876 0.0524
NP_441644.1_6 Forward -137 -127 10.1076 0.0628
NP_441644.1_6 Forward -207 -197 8.53436 0.0982
NP_441644.1_6 Forward -364 -354 3.42118 0.282
NP_442215.1_2 Reverse -126 -142 14.0215 0.021
NP_442215.1_2 Forward -139 -123 1.04184 0.142
NP_442215.1_2 Forward -209 -193 -0.531451 0.168
NP_442247.1_8 Forward -139 -125 8.75105 0.266
NP_440253.1_2 Reverse -128 -146 5.72234 0.0898
NP_440253.1_2 Forward -137 -119 -2.93078 0.28
NP_440929.1_8 Forward -137 -128 19.2726 0.000701
NP_440929.1_8 Reverse -128 -137 19.2726 0.000701
NP_440929.1_8 Reverse -250 -259 4.81794 0.176
NP_442933.1_10 Forward -137 -128 17.601 0.00325
NP_442933.1_10 Reverse -128 -137 17.601 0.00325
NP_441751.2_8 Reverse -251 -265 4.12949 0.0534
NP_441751.2_8 Reverse -129 -143 -3.04867 0.134
NP_442554.1_8 Forward -136 -126 16.008 0.0065
NP_442554.1_8 Reverse -129 -139 15.3197 0.00882
NP_442554.1_8 Reverse -199 -209 13.7464 0.0153
NP_442554.1_8 Forward -258 -248 8.63316 0.0712
NP_442554.1_8 Forward -206 -196 2.53664 0.268
NP_442075.1_10 Forward -259 -240 11.5042 0.282
NP_441762.1_7 Forward -138 -126 12.4287 0.0142
NP_441762.1_7 Reverse -127 -139 9.57708 0.0142
NP_442142.1_4 Forward -140 -127 13.49 0.0348
NP_442142.1_4 Reverse -195 -208 13.0967 0.0397
NP_442142.1_4 Reverse -125 -138 6.0169 0.175
NP_442142.1_4 Forward -210 -197 2.772 0.278
NP_442292.1_1 Reverse -129 -138 18.486 0.00229
NP_442292.1_1 Forward -136 -127 9.63616 0.0183
NP_442292.1_1 Reverse -199 -208 5.80125 0.129
NP_442292.1_1 Forward -258 -249 5.11294 0.162
NP_440919.1_1 Reverse -123 -142 -1.96717 0.221
NP_442476.1_6 Forward -136 -122 7.47274 0.112
NP_441711.1_4 Reverse -119 -138 17.8957 0.0413
NP_443009.1_5 Forward -138 -127 18.3477 0.00265
NP_443009.1_5 Reverse -316 -327 7.72798 0.122
NP_443009.1_5 Forward -115 -104 3.99143 0.268
NP_441715.1_4 Forward -136 -126 9.32148 0.097
NP_441715.1_4 Reverse -129 -139 7.94484 0.107
NP_440357.1_3 Reverse -126 -145 0.786102 0.28
NP_440015.1_9 Reverse -198 -216 -1.94747 0.298
NP_441198.1_8 Reverse -315 -325 12.0994 0.159
NP_440464.1_10 Reverse -129 -139 13.0082 0.169
NP_441468.1_1 Forward -136 -129 15.8704 0.0124
NP_441468.1_1 Reverse -129 -136 15.8704 0.0124
NP_441468.1_1 Reverse -199 -206 3.97235 0.277
NP_441468.1_1 Forward -206 -199 3.97235 0.277
NP_441020.2_6 Reverse -48 -65 8.39697 0.2
NP_441020.2_6 Forward -139 -122 6.52869 0.262
NP_441015.1_10 Forward -142 -123 -4.81876 0.212
NP_441015.1_10 Forward -212 -193 -7.17871 0.264
NP_441673.1_1 Forward -137 -128 20.8459 0.000698
NP_441673.1_1 Reverse -128 -137 20.8459 0.000698
NP_441826.1_2 Reverse -122 -136 12.291 0.0289
NP_441826.1_2 Forward -143 -129 4.03116 0.105
NP_442868.1_6 Forward -139 -129 9.81313 0.038
NP_442868.1_6 Reverse -126 -136 8.53483 0.0555
NP_442719.1_2 Forward -57 -39 -10.4046 0.273
NP_441056.1_1 Forward -370 -351 -1.37718 0.181
NP_441612.1_2 Reverse -128 -138 8.54929 0.21
NP_441612.1_5 Forward -86 -74 20.7868 0.0649
NP_442361.1_3 Reverse -332 -345 7.78743 0.288
NP_442808.1_1 Reverse -127 -137 18.4657 0.00201
NP_442808.1_1 Forward -138 -128 8.63269 0.0481
NP_442808.1_1 Reverse -279 -289 4.01116 0.212
NP_442775.1_1 Reverse -126 -145 13.2741 0.274
NP_440145.1_3 Forward -147 -128 13.1758 0.0248
NP_442542.1_2 Reverse -126 -139 11.9173 0.114
NP_442542.1_9 Reverse -121 -135 13.372 0.108
NP_442050.1_5 Forward -372 -362 8.23937 0.234
NP_442050.1_5 Reverse -126 -136 8.23937 0.234
NP_442050.1_5 Forward -139 -129 7.64939 0.243
NP_442342.1_9 Reverse -126 -142 3.10679 0.271
NP_440334.1_2 Forward -193 -180 14.6706 0.234
NP_440342.1_1 Forward -335 -316 10.3242 0.287
NP_441114.1_3 Forward -389 -380 7.96454 0.231
NP_440558.1_2 Forward -394 -375 -3.04881 0.232
NP_440558.1_2 Reverse -282 -301 -4.22878 0.243
NP_440558.1_2 Reverse -125 -144 -6.39206 0.274
NP_441518.1_3 Forward -147 -128 -3.3438 0.114
NP_441518.1_3 Reverse -118 -137 -15.8318 0.299
NP_441878.1_6 Reverse -197 -207 10.4031 0.0176
NP_441878.1_6 Forward -138 -128 10.4031 0.0176
NP_441878.1_6 Reverse -127 -137 10.4031 0.0176
NP_441878.1_6 Forward -208 -198 0.668351 0.139
NP_441036.1_8 Reverse -127 -137 17.7779 0.000554
NP_441036.1_8 Forward -138 -128 8.33817 0.174
NP_441557.1_5 Forward -137 -128 19.9609 0.000699
NP_441557.1_5 Reverse -128 -137 19.9609 0.000699
NP_441557.1_8 Reverse -258 -268 15.2208 0.183
NP_441445.1_1 Forward -216 -197 2.45773 0.233
NP_441308.1_8 Forward -261 -251 12.3697 0.22
NP_441308.1_8 Reverse -126 -136 9.22315 0.226
NP_440101.1_3 Reverse -123 -142 6.78429 0.181
NP_441458.1_10 Forward -146 -127 2.45773 0.269
NP_442183.1_1 Reverse -128 -142 9.5377 0.0966
NP_442183.1_1 Forward -137 -123 9.34103 0.0986
NP_442183.1_1 Forward -259 -245 6.88276 0.157
NP_442347.1_2 Reverse -129 -138 12.4878 0.056
NP_442347.1_2 Forward -136 -127 11.1111 0.056
NP_442645.1_2 Reverse -373 -392 -18.3884 0.272
NP_442645.1_2 Forward -145 -126 -22.125 0.29
NP_442888.1_6 Forward -218 -199 4.81767 0.228
NP_441037.1_4 Reverse -126 -136 16.2838 0.0168
NP_441037.1_4 Forward -139 -129 7.9999 0.237
NP_441633.1_3 Forward -139 -126 18.3088 0.00715
NP_441633.1_3 Reverse -126 -139 -3.71729 0.177
NP_440136.1_2 Forward -136 -129 15.9687 0.0123
NP_440136.1_2 Reverse -129 -136 15.9687 0.0123
NP_442590.1_10 Reverse -122 -141 10.0292 0.183
NP_442998.1_5 Reverse -38 -48 9.7148 0.236
NP_442998.1_10 Forward -135 -128 15.5754 0.0102
NP_442998.1_10 Reverse -130 -137 15.5754 0.0102
NP_442998.1_10 Reverse -252 -259 5.74231 0.255
NP_440731.1_2 Reverse -69 -88 3.24438 0.295
NP_440299.1_1 Reverse -124 -137 17.3249 0.0065
NP_440299.1_1 Forward -141 -128 14.08 0.0259
NP_441799.1_1 Forward -141 -127 9.53707 0.0901
NP_441799.1_1 Reverse -124 -138 6.19383 0.179
NP_441799.1_9 Forward -138 -119 0.786102 0.213
NP_440640.1_6 Forward -213 -194 -0.197208 0.28
NP_441007.1_10 Reverse -123 -136 2.18257 0.195
NP_441007.1_10 Forward -142 -129 0.314277 0.233
NP_442201.1_10 Reverse -117 -136 -7.57203 0.201
NP_440256.1_1 Forward -140 -121 7.96426 0.0243
NP_441090.1_5 Forward -133 -115 18.2104 0.151
NP_441559.1_8 Reverse -123 -137 2.45787 0.143
NP_440915.1_6 Reverse -124 -138 7.47274 0.0689
NP_440915.1_6 Forward -141 -127 4.42448 0.0953
NP_440717.1_1 Forward -136 -117 6.88262 0.265
NP_442866.1_1 Reverse -123 -142 -1.37718 0.203
NP_441464.1_8 Forward -161 -147 4.03116 0.283
NP_442150.1_2 Forward -240 -221 15.087 0.298
NP_441939.1_3 Forward -136 -117 25.7622 0.000415
NP_441494.1_6 Reverse -123 -136 8.27909 0.23
NP_442993.1_1 Forward -259 -243 -1.90808 0.103
NP_442993.1_1 Reverse -250 -266 -11.4462 0.247
NP_442993.1_1 Reverse -198 -214 -11.5445 0.251
NP_442386.1_9 Reverse -127 -136 15.7322 0.0144
NP_442386.1_9 Forward -138 -129 13.8639 0.0289
NP_442386.1_9 Forward -208 -199 10.324 0.132
NP_442386.1_9 Forward -43 -34 5.40752 0.253
NP_442386.1_9 Reverse -197 -206 4.81753 0.282
NP_441340.1_5 Forward -136 -129 15.6737 0.0124
NP_441340.1_5 Reverse -129 -136 15.6737 0.0124
NP_441340.1_5 Reverse -199 -206 4.07068 0.239
NP_441340.1_5 Forward -206 -199 4.07068 0.239
NP_442484.1_2 Reverse -187 -206 4.32602 0.187
NP_442791.1_5 Forward -145 -126 -11.8003 0.29
NP_440768.1_1 Reverse -114 -128 7.17775 0.29
NP_440168.1_4 Reverse -194 -213 -7.37537 0.283
NP_442240.1_2 Forward -136 -117 -6.88371 0.122
NP_442240.1_2 Reverse -28 -47 -18.9784 0.295
NP_440586.1_8 Forward -136 -129 13.2151 0.026
NP_440586.1_8 Reverse -129 -136 13.2151 0.026
NP_440586.1_8 Forward -206 -199 7.61025 0.227
NP_440586.1_8 Reverse -199 -206 7.61025 0.227
NP_442251.1_6 Forward -136 -129 15.2804 0.0124
NP_442251.1_6 Reverse -129 -136 15.2804 0.0124
NP_440684.1_9 Forward -143 -129 11.406 0.177
NP_441262.1_3 Reverse -128 -135 14.7888 0.0223
NP_441262.1_3 Forward -137 -130 14.7888 0.0223
NP_443051.1_1 Reverse -127 -136 10.4228 0.00754
NP_443051.1_1 Forward -138 -129 10.4228 0.00754
NP_443051.1_1 Forward -260 -251 6.8829 0.066
NP_439937.1_9 Forward -138 -121 -8.02495 0.173
NP_440408.1_7 Forward -207 -188 9.73422 0.255
NP_440439.1_1 Reverse -125 -138 11.9173 0.0288
NP_440372.1_2 Forward -136 -129 16.3621 0.0124
NP_440372.1_2 Reverse -129 -136 16.3621 0.0124
NP_440372.1_2 Forward -258 -251 4.07068 0.262
NP_440316.1_10 Forward -208 -198 8.4365 0.239
NP_441803.1_2 Forward -142 -123 12.7825 0.0576
NP_441803.1_2 Reverse -123 -142 4.22769 0.18
NP_441803.1_2 Forward -41 -22 1.0811 0.241
NP_439977.1_5 Forward -376 -357 2.3594 0.174
NP_439977.1_5 Reverse -122 -141 -1.7705 0.26
NP_439977.1_5 Forward -143 -124 -3.14714 0.296
NP_440139.1_1 Reverse -122 -141 0.686995 0.284
NP_441572.1_7 Forward -200 -181 -5.99873 0.278
NP_442384.1_10 Forward -137 -124 11.229 0.0372
NP_442384.1_10 Reverse -128 -141 10.049 0.047
NP_440472.1_1 Forward -374 -355 15.0432 0.265
NP_442114.1_4 Forward -137 -126 12.1534 0.107
NP_441604.1_4 Reverse -190 -209 -2.95047 0.212
NP_441018.1_7 Reverse -90 -109 8.06259 0.256
NP_442262.1_10 Forward -136 -129 14.1988 0.0123
NP_442262.1_10 Reverse -129 -136 14.1988 0.0123
NP_442262.1_10 Forward -206 -199 10.4622 0.145
NP_442262.1_10 Reverse -199 -206 10.4622 0.145
NP_441689.1_5 Forward -261 -251 12.7626 0.113
NP_441689.1_5 Forward -139 -129 5.78111 0.197
NP_440163.1_10 Forward -210 -200 13.5497 0.122
NP_440163.1_10 Reverse -201 -211 9.12481 0.247
NP_440344.1_10 Forward -144 -127 15.5751 0.00445
NP_440344.1_10 Reverse -121 -138 1.21881 0.0311
NP_440344.1_10 Reverse -191 -208 -9.20427 0.141
NP_440282.1_3 Forward -363 -344 2.26107 0.274
NP_440531.1_6 Forward -215 -196 12.3892 0.051
NP_440531.1_6 Forward -145 -126 3.14605 0.148
NP_440531.1_6 Reverse -120 -139 -5.40875 0.297
NP_442910.1_1 Forward -144 -125 12.5858 0.0484
NP_441965.1_3 Forward -147 -128 0.687771 0.231
NP_441965.1_3 Reverse -118 -137 -1.86883 0.297
NP_441965.1_10 Reverse -125 -141 5.17175 0.216
NP_441640.1_8 Forward -212 -193 -2.0655 0.225
NP_440297.1_9 Reverse -199 -209 9.32148 0.0917
NP_440297.1_9 Forward -206 -196 1.16001 0.282
NP_440297.1_9 Reverse -129 -139 -0.118297 0.282
NP_440297.1_9 Forward -136 -126 -0.216628 0.282
NP_442280.1_10 Reverse -182 -200 16.8503 0.0964
NP_441592.1_4 Forward -90 -71 -0.4922 0.244
NP_441592.1_4 Reverse -317 -336 -2.75381 0.269
NP_441103.1_2 Reverse -117 -135 12.3097 0.156
NP_440894.1_10 Reverse -123 -142 14.7491 0.0958
NP_442067.1_4 Forward -349 -330 5.30933 0.24
NP_442067.1_4 Reverse -117 -136 2.65439 0.289
NP_440999.1_1 Forward -154 -135 2.85027 0.249
NP_440999.1_9 Reverse -124 -138 21.7307 0.0083
NP_440888.1_2 Forward -137 -123 20.6484 0.000502
NP_440888.1_2 Reverse -128 -142 10.3237 0.0974
NP_440888.1_2 Reverse -381 -395 6.19383 0.243
NP_440600.1_4 Forward -145 -127 -7.06068 0.291
NP_440491.1_1 Forward -140 -121 8.28142 0.246
NP_442277.1_4 Reverse -119 -138 1.76863 0.266
NP_442033.1_10 Reverse -126 -145 -5.80207 0.18
NP_442033.1_10 Reverse -268 -287 -11.6036 0.255
NP_441917.1_2 Forward -210 -192 5.13236 0.288
NP_441543.1_2 Forward -136 -127 18.486 0.00236
NP_441543.1_2 Reverse -129 -138 16.9127 0.00359
NP_441543.1_2 Reverse -199 -208 5.11294 0.209
NP_442845.1_2 Forward -213 -199 12.0943 0.116
NP_442845.1_2 Forward -143 -129 10.521 0.148
NP_442845.1_2 Forward -265 -251 8.55439 0.193
NP_442845.1_2 Reverse -355 -369 5.89945 0.22
NP_442845.1_2 Forward -207 -193 5.70279 0.225
NP_442845.1_2 Forward -332 -318 5.60446 0.228
NP_442845.1_2 Forward -396 -382 3.44117 0.29
NP_441469.1_8 Reverse -127 -136 16.126 0.00797
NP_441469.1_8 Reverse -197 -206 10.2261 0.227
NP_441469.1_8 Forward -138 -129 6.48957 0.227
NP_443064.1_6 Reverse -128 -138 12.5669 0.0796
NP_441306.1_10 Reverse -333 -347 11.7987 0.263
NP_442578.1_7 Forward -136 -129 14.5921 0.026
NP_442578.1_7 Reverse -129 -136 14.5921 0.026
NP_441462.1_2 Forward -137 -127 11.5831 0.00406
NP_441462.1_2 Reverse -128 -138 11.5831 0.00406
NP_441462.1_2 Forward -259 -249 -0.118297 0.184
NP_441621.1_7 Reverse -126 -140 -3.24533 0.188
NP_441621.1_7 Forward -139 -125 -3.44199 0.188
NP_443062.1_1 Forward -137 -119 6.69328 0.194
NP_443062.1_6 Forward -145 -126 7.17762 0.173
NP_442204.1_1 Reverse -124 -135 0.648657 0.281
NP_442204.1_2 Reverse -240 -259 5.80098 0.292
NP_442204.1_5 Reverse -118 -137 0.58944 0.258
NP_441560.1_10 Forward -145 -126 6.78429 0.287
NP_441351.1_8 Reverse -126 -145 5.40766 0.202
NP_442487.1_5 Reverse -117 -136 2.16195 0.3
NP_442872.1_1 Reverse -235 -254 -11.8003 0.252
NP_440516.1_2 Forward -143 -125 0.904127 0.213
NP_440516.1_8 Forward -137 -128 16.9127 0.00442
NP_440516.1_8 Reverse -128 -137 16.9127 0.00442
NP_440516.1_8 Forward -259 -250 -0.196935 0.185
NP_440516.1_8 Reverse -355 -364 -0.295266 0.232
NP_440516.1_8 Forward -207 -198 -0.590259 0.283
NP_442428.1_5 Forward -136 -129 15.8704 0.0124
NP_442428.1_5 Reverse -129 -136 15.8704 0.0124
NP_442428.1_5 Forward -206 -199 4.36568 0.271
NP_442428.1_5 Reverse -199 -206 4.36568 0.271
NP_441443.1_1 Reverse -148 -167 0.491109 0.225
NP_441790.1_3 Forward -136 -117 14.4541 0.033
NP_441867.1_2 Reverse -31 -50 -20.3551 0.291
NP_440673.1_2 Forward -147 -128 9.02386 0.259
NP_440673.1_3 Forward -135 -128 12.4288 0.0426
NP_440673.1_3 Reverse -130 -137 12.4288 0.0426
NP_441714.1_3 Reverse -121 -139 20.2745 0.0252
NP_440718.1_2 Reverse -164 -183 14.7491 0.197
NP_441052.1_2 Reverse -128 -138 19.9412 0.00106
NP_441052.1_2 Reverse -198 -208 14.3364 0.0224
NP_441052.1_2 Forward -137 -127 10.5014 0.0285
NP_442219.1_8 Reverse -124 -143 7.97384 0.257
NP_442219.1_9 Reverse -129 -138 17.7976 0.00718
NP_442219.1_9 Forward -136 -127 8.35786 0.0681
NP_440436.1_4 Forward -136 -127 18.1905 0.00233
NP_440436.1_4 Reverse -129 -138 17.2072 0.00233
NP_440436.1_4 Reverse -199 -208 4.7192 0.244
NP_441884.1_9 Forward -140 -121 -3.14714 0.0594
NP_441884.1_9 Reverse -125 -144 -4.81876 0.0594
NP_441719.1_4 Forward -136 -129 16.3621 0.0124
NP_441719.1_4 Reverse -129 -136 16.3621 0.0124
NP_441719.1_6 Forward -154 -135 5.70185 0.288
NP_441733.1_10 Forward -140 -127 9.85238 0.106
NP_441004.1_1 Reverse -34 -53 -8.16202 0.2
NP_441004.1_1 Reverse -35 -54 -8.65367 0.201
NP_441004.1_4 Reverse -353 -363 13.5497 0.216
NP_441004.1_5 Reverse -37 -51 11.996 0.24
NP_442366.1_3 Reverse -127 -145 -0.570838 0.194
NP_442366.1_5 Forward -140 -130 14.8275 0.0375
NP_442873.1_3 Reverse -118 -137 8.35677 0.201
NP_441115.1_4 Forward -138 -120 11.2281 0.148
NP_442206.1_10 Reverse -128 -143 1.74985 0.219
NP_440094.1_9 Forward -138 -119 0.0977854 0.199
NP_443054.1_2 Forward -139 -125 2.94952 0.24
NP_443054.1_2 Reverse -126 -140 2.16287 0.245
NP_442430.1_10 Reverse -118 -137 20.5498 0.0391
NP_441851.1_10 Reverse -127 -137 16.008 0.00552
NP_441851.1_10 Forward -138 -128 15.8113 0.00552
NP_441851.1_10 Forward -327 -317 4.79825 0.247
NP_442856.1_7 Reverse -119 -138 -1.86883 0.231
NP_442515.1_1 Forward -138 -124 4.71948 0.107
NP_441683.1_7 Reverse -141 -160 -10.7186 0.284
NP_440593.1_3 Forward -142 -123 4.22769 0.139
NP_440593.1_3 Reverse -187 -206 1.37609 0.19
NP_440593.1_3 Reverse -123 -142 1.17943 0.19
NP_440165.1_5 Reverse -127 -146 -7.27704 0.259
NP_441349.1_10 Forward -147 -128 1.67108 0.0817
NP_440389.1_5 Reverse -121 -140 12.0296 0.277
NP_440432.1_9 Forward -136 -121 -0.80675 0.167
NP_440432.1_9 Reverse -129 -144 -1.98672 0.167
NP_439960.1_10 Forward -144 -126 3.75572 0.163
NP_440474.1_8 Forward -136 -122 7.27547 0.207
NP_440431.1_3 Reverse -269 -288 -11.8986 0.292
NP_442450.1_5 Forward -139 -129 7.55152 0.13
NP_442450.1_5 Reverse -196 -206 4.99491 0.271
NP_440588.1_2 Reverse -189 -208 0.786102 0.144
NP_440588.1_2 Forward -146 -127 -4.52377 0.22
NP_442006.1_2 Reverse -119 -136 -16.4808 0.254
NP_442006.1_2 Forward -207 -190 -16.6774 0.261
NP_441003.1_9 Reverse -189 -208 4.32602 0.281
NP_442243.1_1 Reverse -122 -140 4.63995 0.195
NP_441570.1_1 Reverse -128 -146 1.78911 0.0286
NP_441570.1_1 Forward -137 -119 -8.73231 0.12
NP_441570.1_1 Forward -295 -277 -16.7954 0.254
NP_441570.1_1 Reverse -355 -373 -16.8938 0.257
NP_440078.1_10 Reverse -74 -93 5.99764 0.224
NP_441078.1_4 Forward -137 -128 19.6659 0.0007
NP_441078.1_4 Reverse -128 -137 19.6659 0.0007
NP_441078.1_4 Forward -207 -198 -1.6719 0.266
NP_441078.1_4 Reverse -198 -207 -1.77023 0.266
NP_442729.1_5 Forward -208 -198 8.33817 0.248
NP_442729.1_8 Reverse -124 -137 8.47575 0.125
NP_440526.1_3 Reverse -129 -140 10.2846 0.0646
NP_440526.1_3 Forward -136 -125 2.41814 0.267
NP_440526.1_3 Reverse -199 -210 0.451529 0.281
NP_441432.1_8 Forward -138 -129 16.8143 0.00595
NP_441432.1_8 Reverse -127 -136 8.25953 0.0755
NP_441432.1_8 Forward -208 -199 6.19458 0.118
NP_441432.1_8 Forward -260 -251 4.32629 0.223
NP_442320.1_8 Forward -143 -129 13.4709 0.0144
NP_442320.1_8 Reverse -122 -136 6.29277 0.029
NP_441732.1_2 Forward -141 -125 3.30346 0.0141
NP_441732.1_2 Reverse -124 -140 -6.52964 0.0495
NP_442815.1_2 Reverse -148 -166 3.75572 0.259
NP_440760.1_1 Forward -137 -118 -11.4069 0.0851
NP_440760.1_1 Reverse -128 -147 -14.9469 0.138
NP_442797.1_6 Reverse -188 -207 10.552 0.238
NP_440199.1_10 Forward -210 -200 15.6147 0.0861
NP_440199.1_10 Forward -262 -252 13.5497 0.108
NP_440199.1_10 Forward -140 -130 7.25653 0.231
NP_441805.1_2 Reverse -117 -136 -3.83545 0.275
NP_441072.1_2 Forward -270 -251 10.2259 0.202
NP_441072.1_10 Forward -109 -90 22.3197 0.0526
NP_440713.1_4 Forward -400 -381 1.27776 0.289
NP_442489.1_7 Forward -137 -128 20.1576 0.000695
NP_442489.1_7 Reverse -128 -137 20.1576 0.000695
NP_442489.1_7 Forward -207 -198 -1.6719 0.235
NP_442489.1_7 Reverse -198 -207 -1.77023 0.247
NP_440559.1_1 Reverse -129 -138 17.4043 0.00658
NP_440559.1_1 Forward -136 -127 8.75118 0.0586
NP_441659.2_8 Reverse -128 -138 18.1713 0.00133
NP_441659.2_8 Forward -137 -127 11.9764 0.0147
NP_440860.1_8 Reverse -94 -113 12.9791 0.296
NP_442913.1_10 Reverse -119 -138 14.1591 0.0242
NP_441040.1_2 Forward -349 -330 -8.26035 0.236
NP_441800.1_3 Forward -206 -188 3.65739 0.292
NP_440315.1_6 Forward -111 -95 10.1866 0.126
NP_442346.1_5 Forward -138 -128 16.6963 0.00248
NP_442346.1_5 Reverse -197 -207 12.1731 0.0475
NP_442346.1_5 Reverse -127 -137 9.02648 0.118
NP_442346.1_5 Forward -208 -198 6.27322 0.208
NP_440545.1_3 Forward -141 -124 13.7068 0.0167
NP_440545.1_3 Reverse -124 -141 -6.54933 0.283
NP_440545.1_5 Forward -141 -124 10.5603 0.21
NP_440025.1_1 Forward -141 -122 11.8975 0.147
NP_440459.1_2 Forward -51 -34 7.31533 0.296
NP_441653.1_2 Reverse -117 -136 19.6675 0.0262
NP_440010.1_4 Reverse -118 -137 2.75194 0.222
NP_442603.1_7 Forward -137 -123 12.8803 0.0937
NP_441888.1_7 Reverse -123 -137 4.12949 0.225
NP_441888.1_7 Forward -142 -128 2.16287 0.225
NP_440449.1_6 Reverse -120 -138 11.5628 0.129
NP_441948.1_4 Reverse -250 -268 -4.01242 0.214
NP_441833.1_4 Forward -136 -129 15.9687 0.0124
NP_441833.1_4 Reverse -129 -136 15.9687 0.0124
NP_442162.1_9 Forward -136 -129 16.2637 0.0124
NP_442162.1_9 Reverse -129 -136 16.2637 0.0124
NP_440671.1_4 Forward -265 -251 12.1926 0.114
NP_440671.1_4 Forward -143 -129 7.86607 0.207
NP_440671.1_4 Reverse -116 -130 7.27608 0.222
NP_440224.1_1 Forward -148 -129 2.3594 0.132
NP_440772.1_8 Forward -143 -124 10.8159 0.253
NP_442073.1_6 Reverse -189 -208 -1.96717 0.286
NP_442199.1_5 Reverse -120 -139 -6.39206 0.273
NP_442140.1_3 Forward -136 -126 17.4829 0.0159
NP_442140.1_3 Reverse -129 -139 12.2714 0.0632
NP_442140.1_3 Forward -206 -196 10.5014 0.0902
NP_442723.1_1 Reverse -314 -333 5.01354 0.276
NP_440875.1_9 Forward -135 -125 15.2829 0.0295
NP_441813.1_5 Reverse -126 -136 10.0098 0.0208
NP_441813.1_5 Forward -139 -129 8.63316 0.0367
NP_441813.1_5 Reverse -248 -258 2.14332 0.199
NP_440590.1_4 Forward -136 -123 22.0454 0.00377
NP_440590.1_4 Reverse -129 -142 12.114 0.016
NP_440567.1_1 Forward -136 -122 18.8791 0.0136
NP_440567.1_1 Reverse -129 -143 12.586 0.0225
NP_442497.1_10 Forward -136 -127 10.4228 0.0087
NP_442497.1_10 Reverse -129 -138 10.4228 0.0087
NP_440821.1_4 Reverse -126 -136 18.7612 0.00422
NP_440821.1_4 Forward -139 -129 9.41981 0.0286
NP_441239.1_9 Reverse -126 -138 16.0669 0.0175
NP_441239.1_9 Reverse -196 -208 10.5604 0.076
NP_441239.1_9 Forward -139 -127 5.93884 0.202
NP_441009.1_4 Forward -207 -188 16.1257 0.158
NP_441727.1_3 Forward -144 -125 8.84924 0.199
NP_441892.1_1 Forward -146 -129 -0.944468 0.193
NP_441892.1_1 Reverse -308 -325 -5.36936 0.279
NP_441892.1_1 Reverse -119 -136 -5.66436 0.285
NP_442044.1_1 Reverse -356 -375 -11.9969 0.271
NP_442270.1_9 Forward -148 -129 -6.58872 0.207
NP_442216.1_4 Reverse -272 -280 8.27883 0.255
NP_440354.1_7 Reverse -122 -140 6.60732 0.278
NP_442138.1_10 Reverse -128 -147 0.392778 0.14
NP_442809.1_1 Forward -382 -363 9.7334 0.295
NP_440546.1_4 Forward -137 -127 11.8882 0.0679
NP_440546.1_4 Forward -207 -197 11.7912 0.0712
NP_440546.1_4 Reverse -128 -138 10.046 0.109
NP_439974.1_4 Reverse -117 -136 9.24257 0.252
NP_441230.1_5 Reverse -123 -142 0.982764 0.258
NP_440462.1_6 Reverse -126 -136 17.9746 0.00578
NP_440462.1_6 Reverse -359 -369 4.3066 0.205
NP_440462.1_6 Forward -139 -129 1.35667 0.294
NP_440868.1_4 Reverse -124 -136 12.527 0.0235
NP_440868.1_4 Forward -141 -129 -0.846001 0.282
NP_442787.1_9 Reverse -97 -116 18.1907 0.197
NP_441582.1_5 Forward -139 -120 12.29 0.141
NP_442402.1_4 Reverse -262 -281 -2.65624 0.2
NP_442402.1_4 Forward -360 -341 -6.49113 0.259
NP_442402.1_6 Forward -283 -274 14.8477 0.241
NP_442039.1_4 Forward -136 -129 15.1821 0.0124
NP_442039.1_4 Reverse -129 -136 15.1821 0.0124
NP_442039.1_4 Forward -369 -362 7.80726 0.24
NP_442039.1_4 Forward -258 -251 7.80726 0.24
NP_442039.1_7 Forward -244 -234 12.9597 0.213
NP_442039.1_7 Reverse -351 -361 6.76487 0.299
NP_440008.1_9 Forward -332 -313 13.8641 0.156
NP_440825.1_7 Reverse -129 -139 12.9096 0.152
NP_442837.1_3 Forward -136 -129 15.7721 0.0124
NP_442837.1_3 Reverse -129 -136 15.7721 0.0124
NP_442053.1_1 Forward -137 -128 18.3876 0.0007
NP_442053.1_1 Reverse -128 -137 18.3876 0.0007
NP_440505.1_3 Reverse -126 -136 14.1397 0.0235
NP_440505.1_3 Forward -139 -129 9.22315 0.122
NP_440505.1_3 Forward -261 -251 4.50326 0.284
NP_442532.1_7 Forward -137 -123 7.86607 0.171
NP_441408.2_7 Forward -197 -178 -2.26216 0.265
NP_440914.1_1 Reverse -128 -138 17.5935 0.000537
NP_440914.1_1 Forward -137 -127 8.6151 0.186
NP_440914.1_1 Forward -390 -380 8.41992 0.191
NP_440914.1_1 Reverse -361 -371 6.17532 0.293
NP_441011.1_8 Forward -136 -127 16.9127 0.00602
NP_441011.1_8 Reverse -129 -138 8.25953 0.144
NP_442533.1_6 Forward -137 -128 17.2076 0.00137
NP_442533.1_6 Reverse -128 -137 17.2076 0.00137
NP_442533.1_6 Forward -207 -198 7.17789 0.0948
NP_442533.1_6 Reverse -198 -207 6.68623 0.105
NP_442322.1_1 Forward -251 -232 19.2142 0.135
NP_442229.1_1 Reverse -126 -140 11.7987 0.18
NP_441482.1_7 Forward -143 -129 -10.3252 0.209
NP_441482.1_7 Reverse -355 -369 -11.7018 0.281
NP_439944.1_9 Reverse -129 -139 10.5014 0.0887
NP_439944.1_9 Forward -136 -126 10.4031 0.0887
NP_439944.1_9 Reverse -199 -209 6.96153 0.162
NP_441028.1_6 Forward -55 -45 9.91099 0.21
NP_441028.1_6 Forward -156 -146 8.04271 0.217
NP_441028.1_6 Reverse -272 -282 5.48612 0.255
NP_442202.1_10 Forward -104 -90 2.85119 0.282
NP_440115.1_6 Reverse -125 -135 9.61647 0.115
NP_440007.1_9 Forward -263 -249 7.76774 0.2
NP_441602.1_3 Forward -142 -123 1.47442 0.214
NP_441602.1_3 Reverse -123 -142 -3.3438 0.245
NP_441602.1_4 Reverse -117 -136 8.75091 0.282
NP_441972.1_5 Reverse -350 -369 -1.37718 0.177
NP_441972.1_5 Forward -136 -117 -1.37718 0.177
NP_441972.1_5 Reverse -129 -148 -3.73712 0.201
NP_441972.1_5 Forward -200 -181 -7.67036 0.252
NP_441106.1_1 Reverse -127 -136 18.191 0.0028
NP_441106.1_1 Forward -138 -129 9.63616 0.0311
NP_439903.1_6 Reverse -247 -266 1.08032 0.255
NP_440797.1_2 Forward -148 -129 14.7126 0.21
NP_441186.1_2 Forward -107 -88 16.0274 0.242
NP_441286.1_1 Forward -138 -126 14.7886 0.00418
NP_441286.1_1 Reverse -127 -139 3.38223 0.0467
NP_441286.1_1 Forward -208 -196 -5.07423 0.188
NP_442674.1_3 Forward -145 -126 6.09517 0.246
NP_440670.1_8 Forward -137 -128 18.3876 0.000699
NP_440670.1_8 Reverse -128 -137 18.3876 0.000699
NP_440670.1_8 Reverse -250 -259 9.34117 0.0581
NP_440670.1_8 Forward -259 -250 6.29291 0.124
NP_440886.1_7 Reverse -127 -137 17.7774 0.0011
NP_440886.1_7 Forward -138 -128 7.94438 0.0805
NP_442072.1_9 Forward -138 -120 5.82068 0.0153
NP_441753.1_10 Reverse -119 -138 24.4839 0.00922
NP_440907.2_8 Forward -136 -126 17.4824 0.00685
NP_440907.2_8 Reverse -388 -398 8.14104 0.117
NP_440907.2_8 Reverse -129 -139 7.64939 0.117
NP_442264.1_2 Forward -211 -194 8.49531 0.216
NP_442264.1_2 Forward -217 -200 7.90532 0.225
NP_442264.1_5 Reverse -317 -331 16.5192 0.222
NP_441021.1_1 Forward -136 -117 -11.2103 0.258
NP_441021.1_8 Forward -142 -124 7.88563 0.181
NP_441463.1_3 Forward -374 -355 -2.45882 0.154
NP_441463.1_3 Reverse -118 -137 -7.37537 0.257
NP_441463.1_6 Forward -209 -195 9.70148 0.247
NP_441463.1_6 Forward -139 -125 6.02939 0.283
NP_441626.1_2 Forward -136 -129 15.7721 0.0124
NP_441626.1_2 Reverse -129 -136 15.7721 0.0124
NP_441460.1_2 Reverse -189 -202 14.8666 0.211
NP_442794.1_1 Forward -141 -129 12.4287 0.0721
NP_441962.1_4 Reverse -123 -142 -1.7705 0.125
NP_441962.1_4 Forward -142 -123 -7.67036 0.192
NP_440387.1_1 Forward -137 -121 15.7915 0.00512
NP_440387.1_1 Reverse -128 -144 -1.71142 0.143
NP_441431.1_2 Reverse -125 -139 20.0584 0.00685
NP_441431.1_2 Reverse -328 -342 7.17714 0.247
NP_441193.1_1 Reverse -283 -302 9.34008 0.277
NP_441993.1_1 Forward -137 -118 5.35769 0.205
NP_440095.1_8 Reverse -41 -60 12.3892 0.113
NP_440293.1_3 Forward -334 -315 -4.32711 0.262
NP_440766.1_4 Forward -141 -127 9.04604 0.0871
NP_440766.1_4 Reverse -124 -138 8.16106 0.0871
NP_440766.1_5 Forward -241 -229 7.84677 0.288
NP_440766.1_5 Reverse -46 -58 6.60538 0.296
NP_439988.1_7 Forward -135 -121 11.5037 0.292
NP_441237.1_9 Reverse -129 -139 14.828 0.0242
NP_442743.1_4 Forward -136 -117 -8.45701 0.294
NP_439910.1_2 Reverse -120 -137 -21.299 0.183
NP_442278.1_4 Reverse -146 -165 18.289 0.156
NP_440457.1_1 Reverse -124 -136 7.21714 0.105
NP_440457.1_1 Forward -263 -251 2.39892 0.212
NP_440798.1_6 Forward -136 -123 13.3923 0.0445
NP_441801.1_4 Reverse -273 -283 2.53664 0.292
NP_441332.1_6 Forward -152 -142 12.3244 0.234
NP_442509.1_9 Forward -137 -127 16.2041 0.00739
NP_442509.1_9 Reverse -128 -138 8.14104 0.192
NP_442509.1_9 Reverse -280 -290 6.66608 0.259
NP_441253.1_8 Forward -142 -128 13.8567 0.139
NP_442587.1_9 Forward -20 -7 22.3404 0.074
NP_442936.1_10 Forward -236 -222 7.7326 0.27
NP_440554.1_4 Forward -136 -126 13.943 0.0218
NP_440554.1_4 Forward -258 -248 4.40493 0.19
NP_440554.1_4 Reverse -251 -261 3.32329 0.234
NP_441885.1_5 Reverse -128 -138 20.9245 0.000538
NP_441885.1_5 Forward -137 -127 11.4848 0.00668
NP_442341.1_7 Forward -138 -124 21.6324 0.00413
NP_442341.1_7 Reverse -127 -141 18.0925 0.0111
NP_442341.1_9 Reverse -126 -140 8.65209 0.166
NP_441173.1_9 Reverse -234 -242 13.1954 0.184
NP_441173.1_9 Forward -45 -37 13.1954 0.184
NP_440423.1_10 Forward -144 -125 10.8159 0.259
NP_443000.1_7 Forward -139 -129 10.3048 0.0345
NP_443000.1_7 Reverse -126 -136 2.04498 0.226
NP_441842.1_1 Forward -135 -122 16.2433 0.0484
NP_441842.1_10 Reverse -121 -135 13.3726 0.0776
NP_441842.1_10 Forward -144 -130 11.3077 0.134
NP_440275.1_3 Reverse -126 -136 17.9746 0.0082
NP_440275.1_3 Forward -139 -129 8.04317 0.0602
NP_440091.1_1 Reverse -124 -136 10.1671 0.0498
NP_440091.1_1 Forward -141 -129 1.31728 0.198
NP_443010.1_10 Reverse -125 -142 9.82506 0.132
NP_440175.1_4 Reverse -126 -145 -11.2103 0.185
NP_440175.1_7 Forward -315 -297 9.65589 0.278
NP_442495.1_5 Forward -337 -318 9.63589 0.287
NP_440149.1_8 Forward -137 -118 -4.81876 0.213
NP_441105.1_3 Forward -148 -129 2.26107 0.106
NP_441105.1_3 Reverse -117 -136 -5.31042 0.216
NP_441105.1_3 Reverse -344 -363 -6.1954 0.23
NP_441105.1_3 Forward -212 -193 -7.86702 0.261
NP_441105.1_3 Forward -101 -82 -8.45701 0.272
NP_440216.1_1 Forward -137 -123 8.55439 0.00592
NP_440216.1_1 Reverse -128 -142 -9.63684 0.145
NP_440216.1_6 Reverse -121 -137 5.86006 0.189
NP_440172.1_1 Reverse -128 -138 15.0247 0.00945
NP_440172.1_1 Forward -137 -127 8.73149 0.0586
NP_440172.1_1 Forward -207 -197 4.89658 0.162
NP_440172.1_1 Reverse -250 -260 2.92996 0.258
NP_442015.1_10 Reverse -124 -137 12.9006 0.0365
NP_442015.1_10 Forward -141 -128 11.3273 0.0372
NP_442015.1_10 Reverse -194 -207 1.29759 0.206
NP_441226.1_7 Forward -136 -129 14.4934 0.0123
NP_441226.1_7 Reverse -129 -136 14.4934 0.0123
NP_441226.1_7 Reverse -356 -363 9.47853 0.147
NP_441226.1_7 Reverse -332 -339 6.52862 0.253
NP_441111.1_7 Forward -136 -128 18.7023 0.00294
NP_441111.1_7 Reverse -129 -137 18.7023 0.00294
NP_442379.1_10 Reverse -121 -138 -0.551145 0.223
NP_441766.1_2 Forward -137 -128 17.5026 0.00297
NP_441766.1_2 Reverse -128 -137 17.5026 0.00297
NP_441766.1_2 Reverse -250 -259 8.84951 0.0484
NP_440416.1_9 Forward -144 -125 -17.5035 0.241
NP_440416.1_9 Reverse -250 -269 -18.6834 0.262
NP_440416.1_9 Reverse -380 -399 -20.945 0.289
NP_443052.1_8 Reverse -118 -137 4.03102 0.0452
NP_442116.1_2 Reverse -200 -219 11.8967 0.289
NP_440261.1_5 Forward -136 -123 6.80412 0.0316
NP_440261.1_5 Forward -206 -193 -12.3704 0.284
NP_440988.1_5 Forward -53 -34 15.2 0.202
NP_440988.1_10 Forward -209 -195 7.22233 0.219
NP_440988.1_10 Forward -392 -378 3.9307 0.276
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGCTTGGATAGCAATGCGCAACACTTCCTTGAGATCCCGTTGGCCAATGTAATCCGCTAACCGTTGGGGCCTGAGGGATGCCTCTTGCTGTTCTAACTCTGGGCTGGTACTGCGTTCCTGGGGAATAACTTCCGGGGAAAGGAGATCGGATTTAACGTTGGGAGAAAGATTATTGTTGCCGGAACGTTTAATGGCCATGGCGCAGGGAAAAGGAAAGGCTCAGCTTGAGTCGGTTCTAGTCAGTATCCCCCCATCCTACATTGGCGATCGCCGCCGGGTTGTTCGGAACATCCCAGCAAAAAAGCCTCCAGCCCTCGATAATCCGCTAACCTGAAATTAGGTACTTCTCCCCCATTTACCCAAGGCGTTAAAGCATTCAGGGGTTGATTTTTTAAGGTT

CDS

ATGCAAACAACCAGTGACGTTCTCATTATTGGCGGTGGCATCATCGGTTTGGCGATCGCCGTGGAACTGAAATTAAAGCAAAAGCGGTTGCAGGTCACAGTGCTGAGTCGGGATTTTGCCCAGGCGGCCAGCCATGCGGCGGCGGGAATGTTAGCCCCCCATGCGGAACAAATCGCCCCAGGCCCCATGCTGGATCTATGTTTGGCTTCCCGCTGGCGTTACGGGGAATGGGTGGAAAAACTGGAACAGTTAACAGGCATGGAAACGGGTTATAACCCCTGTGGCATCCTCTCCCCCGTGTTTGAAGCGCCCCATGGCAATAGTTCCACTAATTCTGCCTGGTTAGACCAGGAAACCATTCGATACTATCAACCAGGGCTGGGGGAAGACGTAATTGGTGGTTGGTGGCATCCCGACGATGGCCAAGTGGATAACCGCAAACTGGTCAGTGCTCTGCGGCAAGCGGCCCAATCCCTGGGAGTACAAATTCAAGAAGGGGTCACCGTCCAGGCGATCGCCCAACGTCATGGCCAAGTGACTGCGGTGCTAACGGATCAGGGTTCTTTCCAAGCAGATAGCTACGTGTTGGCCAACGGCTCCTGGGCCAAGGAATTACTGCCCCTGCCGGTATTCCCAGTTAAAGGTCAAATGATGGCCCTGCGGATGCCAGCGGGAACTCACCAGCCCTATCCTTTGCAACGGGTACTTTTTGGTCCCCAAACCTATCTGGTGCCCCGGCGGGATGGCCGCTTAATTGTGGGGGCAACTTCGGAGCAGGTGGACTGGCAGCCCCATAATACGCCCCAGGGCATTCAAACCCTATTAGGTCGAGCCATTAGACTTTTCCCGGCCCTAGGCGATTGGGCCATTGAGGATTTTTGGTGGGGATTTCGCCCCGGCACCCCCGATGAACAGCCTTTCTTGGGCTATGGCCCCTGTGATAATCTCATTTTGGCGATCGGTCATTACCGCAACGGCATTTTGCTCGCCCCCATCACCGCCGCTTTGATTAGCGATTTAATCCTCGACCAGAAGGTTTCTCCCCTCATCCATGCCTTTAGTCCCCAACGTTTTCTAACAACTACCAATCCCCCTGTACTGTCCTGCCGCCCTATGACTGCTGTATTTCCTTCCATTGCCAACCCTTCCCTGCCCCATGCCGCTGAAAATTCAGAGGGCAGTAAAGATTTGCTAGAAATTGCTGGCCGTAAATTCCACTCCCGCCTAATGACGGGCACCGGCAAATATCCTTCCCTCACCACCATGCAGGAAAGCGTCGCTAGCAGTGGTTGTCAGATTGTCACCGTGGCAGTGCGCCGAGTACAAACCAATGCCCCAGGCCACGAGGGATTAGCGGAAGCCATTGATTGGTCCACCATTTGGATGCTCCCCAACACCGCTGGTTGTCAAACGGCCGAGGAAGCTATTCGGGTAGCCCGGTTGGGAAGGGAAATGGCTAAGTTACTGGGCCAGGAAGATAATAATTTCATCAAGCTAGAAGTCATTCCCGATACCCAATACCTCTTACCAGACCCCATTGGCACCCTCGAGGCGGCAGAACAGTTGGTTAAGGAAGGTTTTGCCGTACTGCCCTATATCAACGCTGATCCCTTATTGGCGAAAAGGCTGGAAGAAGTGGGCTGTGCCACTGTGATGCCCCTTGGTTCCCCCATCGGTTCTGGGCAGGGTATCCGTAACGCCGCCAACATTGGCATCATTATTGAGAATGCCAAGGTTCCCGTGGTGGTGGATGCGGGCATTGGCACCCCCAGTGAAGCAGCCCAAGCAATGGAAATGGGCGCTGATGCGGTGTTGATCAACAGTGCGATCGCCATGGCGGCCAATCCCGTGGCCATGGCCCAGGCTATGGGAATGGCTACCCAAGCAGGGAGGCTCGCCTATCTGTCGGGCAGAATGCCCATTAAAGCCAAGGCCAATGCCAGTTCTCCCCTCACGGGCCTAGTGGGTTAG

Protein

MQTTSDVLIIGGGIIGLAIAVELKLKQKRLQVTVLSRDFAQAASHAAAGMLAPHAEQIAPGPMLDLCLASRWRYGEWVEKLEQLTGMETGYNPCGILSPVFEAPHGNSSTNSAWLDQETIRYYQPGLGEDVIGGWWHPDDGQVDNRKLVSALRQAAQSLGVQIQEGVTVQAIAQRHGQVTAVLTDQGSFQADSYVLANGSWAKELLPLPVFPVKGQMMALRMPAGTHQPYPLQRVLFGPQTYLVPRRDGRLIVGATSEQVDWQPHNTPQGIQTLLGRAIRLFPALGDWAIEDFWWGFRPGTPDEQPFLGYGPCDNLILAIGHYRNGILLAPITAALISDLILDQKVSPLIHAFSPQRFLTTTNPPVLSCRPMTAVFPSIANPSLPHAAENSEGSKDLLEIAGRKFHSRLMTGTGKYPSLTTMQESVASSGCQIVTVAVRRVQTNAPGHEGLAEAIDWSTIWMLPNTAGCQTAEEAIRVARLGREMAKLLGQEDNNFIKLEVIPDTQYLLPDPIGTLEAAEQLVKEGFAVLPYINADPLLAKRLEEVGCATVMPLGSPIGSGQGIRNAANIGIIIENAKVPVVVDAGIGTPSEAAQAMEMGADAVLINSAIAMAANPVAMAQAMGMATQAGRLAYLSGRMPIKAKANASSPLTGLVG