Your browser is old and dusty. Try Google Chrome!

Details for slr0623

ORF slr0623
Accession NP_442553.1
Symbol trxA
Category Thioredoxin, glutaredoxin, and glutathione
Definition thioredoxin
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -177 -191 10.226 0.293
NP_442711.1_3 Reverse -89 -108 15.8426 0.134
NP_441061.1_10 Reverse -383 -396 20.1771 0.203
NP_441418.1_6 Reverse -375 -394 -29.8932 0.245
NP_441453.1_7 Reverse -134 -141 12.9205 0.23
NP_441818.1_1 Reverse -119 -130 8.80962 0.277
NP_441818.1_9 Reverse -248 -267 -3.93378 0.233
NP_441818.1_9 Reverse -376 -395 -4.72043 0.242
NP_441818.1_9 Forward -177 -158 -5.60541 0.254
NP_441818.1_9 Reverse -228 -247 -8.06369 0.274
NP_441818.1_9 Reverse -254 -273 -8.16202 0.274
NP_440120.1_4 Forward -139 -125 14.5526 0.273
NP_441098.1_3 Reverse -282 -301 -7.746 0.296
NP_441438.1_1 Reverse -282 -301 5.40766 0.295
NP_440110.1_8 Reverse -255 -274 -1.37718 0.238
NP_440878.1_9 Reverse -102 -121 4.22769 0.174
NP_442062.1_3 Reverse -274 -293 7.57094 0.154
NP_442062.1_3 Forward -105 -86 -2.75381 0.272
NP_441802.1_1 Forward -139 -120 6.88262 0.257
NP_441208.1_9 Forward -177 -163 9.73436 0.204
NP_441925.1_4 Forward -397 -378 -7.27777 0.194
NP_441925.1_4 Forward -200 -181 -16.3242 0.282
NP_441925.1_5 Reverse -291 -305 20.2558 0.0337
NP_441434.1_6 Reverse -298 -308 14.533 0.278
NP_440109.1_2 Reverse -157 -176 23.6972 0.0151
NP_442889.1_8 Reverse -41 -55 4.22722 0.27
NP_440447.1_5 Forward -144 -134 11.7798 0.291
NP_442461.1_4 Reverse -214 -233 9.24257 0.214
NP_441387.1_5 Forward -95 -76 17.5248 0.261
NP_440747.1_10 Reverse -19 -31 -12.5474 0.297
NP_442634.1_4 Forward -165 -151 -6.09693 0.299
NP_443017.1_1 Forward -300 -281 16.014 0.214
NP_441014.1_8 Forward -257 -238 -9.24366 0.293
NP_441846.1_10 Reverse -230 -249 -20.5517 0.256
NP_441846.1_10 Reverse -240 -259 -21.6334 0.256
NP_441846.1_10 Reverse -238 -257 -21.6334 0.256
NP_441846.1_10 Reverse -179 -198 -22.0267 0.257
NP_441846.1_10 Reverse -376 -395 -22.125 0.257
NP_441846.1_10 Reverse -378 -397 -23.2067 0.279
NP_441422.1_7 Forward -250 -233 -3.79607 0.235
NP_440667.1_2 Forward -221 -202 -7.96535 0.288
NP_442782.1_2 Forward -135 -121 1.57289 0.281
NP_440184.1_1 Forward -300 -281 6.22578 0.193
NP_440184.1_10 Forward -305 -286 15.8299 0.171
NP_439919.1_5 Reverse -184 -198 20.4524 0.215
NP_441415.1_3 Reverse -293 -312 10.3242 0.295
NP_440993.1_7 Forward -18 -4 17.7731 0.202
NP_441099.1_5 Forward -400 -381 -11.0136 0.27
NP_441398.1_5 Reverse -238 -257 7.37428 0.258
NP_441295.1_4 Forward -256 -237 -1.96717 0.29
NP_441550.1_8 Forward -33 -23 6.56775 0.201
NP_442996.1_1 Forward -109 -90 8.06865 0.21
NP_440983.1_5 Forward -277 -258 -4.91709 0.261
NP_441076.1_1 Reverse -340 -359 8.74784 0.295
NP_441079.1_7 Reverse -73 -92 8.16011 0.107
NP_439983.1_1 Forward -199 -181 10.5398 0.289
NP_442068.1_4 Forward -257 -238 11.7 0.146
NP_441644.1_6 Forward -31 -21 8.3377 0.103
NP_442933.1_3 Reverse -323 -342 16.8539 0.225
NP_440576.1_2 Forward -93 -74 5.99764 0.299
NP_442554.1_8 Reverse -23 -33 4.3066 0.189
NP_441741.1_6 Reverse -2 -21 8.06259 0.249
NP_440730.1_4 Reverse -255 -274 1.47442 0.237
NP_440158.1_1 Forward -299 -280 10.4559 0.243
NP_442076.1_5 Reverse -190 -209 11.9958 0.186
NP_442076.1_5 Forward -343 -324 6.78429 0.256
NP_441015.1_10 Reverse -376 -395 5.211 0.115
NP_441015.1_10 Reverse -237 -256 -6.78538 0.256
NP_441015.1_10 Reverse -231 -250 -10.1286 0.283
NP_441015.1_10 Reverse -379 -398 -11.7019 0.3
NP_441876.1_9 Forward -252 -242 12.2709 0.267
NP_442063.1_2 Reverse -102 -121 6.19431 0.0795
NP_442719.1_2 Forward -21 -3 -11.0929 0.287
NP_442719.1_2 Reverse -103 -121 -11.6829 0.294
NP_441944.1_1 Forward -251 -232 15.4374 0.223
NP_442542.1_2 Reverse -240 -253 7.6891 0.173
NP_442050.1_1 Reverse -177 -196 8.16093 0.253
NP_440385.1_6 Forward -105 -86 18.0953 0.107
NP_440111.2_8 Forward -151 -135 17.1681 0.0747
NP_441590.1_1 Forward -400 -381 11.1109 0.256
NP_442347.1_2 Forward -147 -138 6.29291 0.175
NP_442594.1_8 Reverse -238 -257 3.24438 0.286
NP_442508.1_10 Forward -199 -180 12.88 0.128
NP_441633.1_3 Forward -267 -254 -7.25721 0.3
NP_441728.2_4 Forward -304 -285 15.2305 0.215
NP_440899.1_8 Forward -209 -190 -5.01543 0.231
NP_440640.1_2 Forward -296 -277 9.93088 0.277
NP_440640.1_6 Reverse -376 -395 1.57275 0.266
NP_442334.1_2 Reverse -238 -255 -13.9242 0.297
NP_440256.1_1 Reverse -19 -38 -7.17871 0.231
NP_441270.1_5 Reverse -256 -275 12.8967 0.236
NP_442785.1_8 Reverse -255 -273 17.2271 0.269
NP_441866.1_6 Forward -371 -352 9.63507 0.238
NP_440702.1_2 Reverse -373 -392 11.1109 0.137
NP_440702.1_2 Reverse -376 -395 1.47442 0.257
NP_441199.1_3 Reverse -131 -149 -0.0791831 0.231
NP_441199.1_7 Reverse -281 -300 2.85105 0.253
NP_442993.1_1 Reverse -249 -265 -10.7579 0.226
NP_442993.1_1 Reverse -119 -135 -12.1345 0.266
NP_441952.1_9 Forward -113 -94 13.7941 0.282
NP_440027.1_3 Forward -258 -240 4.04996 0.262
NP_440439.1_6 Reverse -281 -300 4.12936 0.242
NP_441789.1_7 Reverse -46 -65 -5.60616 0.299
NP_440819.1_5 Forward -266 -258 7.59091 0.272
NP_442114.1_8 Reverse -144 -158 11.012 0.234
NP_441877.1_9 Reverse -282 -299 23.245 0.00793
NP_440344.1_1 Reverse -178 -197 16.1257 0.08
NP_440075.1_2 Reverse -236 -255 1.96607 0.292
NP_440562.1_10 Forward -40 -22 6.60732 0.284
NP_442553.1_1 Forward -204 -185 37.9542 0.000000768
NP_442553.1_2 Forward -169 -150 30.9737 0.0000157
NP_442553.1_4 Forward -65 -46 20.059 0.0397
NP_442553.1_7 Forward -184 -170 15.8309 0.255
NP_440999.1_1 Forward -395 -376 7.76679 0.156
NP_440237.1_5 Forward -361 -347 11.307 0.257
NP_442277.1_4 Forward -274 -255 2.45694 0.243
NP_442337.1_6 Reverse -109 -128 13.1535 0.263
NP_440220.1_4 Reverse -159 -178 -1.18128 0.263
NP_440516.1_6 Forward -257 -243 8.55376 0.246
NP_440128.1_10 Reverse -179 -198 25.0739 0.0037
NP_441443.1_1 Forward -135 -116 -2.75381 0.271
NP_440455.1_2 Reverse -289 -302 16.328 0.225
NP_440314.1_9 Reverse -155 -174 -9.93197 0.281
NP_441004.1_2 Reverse -110 -129 -0.197208 0.252
NP_442873.1_5 Reverse -159 -178 11.995 0.219
NP_440296.1_6 Reverse -280 -298 9.93315 0.298
NP_442694.1_4 Reverse -300 -309 15.536 0.164
NP_442898.1_3 Reverse -186 -200 22.8124 0.0266
NP_441668.1_4 Forward -339 -320 -1.67217 0.278
NP_442515.1_1 Forward -266 -252 -0.000409212 0.206
NP_442843.1_2 Forward -58 -39 12.9791 0.22
NP_441031.1_1 Forward -305 -286 16.4634 0.086
NP_441031.1_1 Reverse -279 -298 3.73773 0.296
NP_439950.1_1 Reverse -309 -318 12.1928 0.296
NP_442006.1_2 Forward -143 -126 -18.4474 0.291
NP_441539.1_1 Reverse -284 -298 12.0937 0.284
NP_442348.1_2 Reverse -299 -308 7.47288 0.28
NP_440707.1_9 Reverse -185 -204 3.6377 0.267
NP_441333.1_1 Reverse -283 -293 11.9712 0.241
NP_440760.1_1 Reverse -154 -173 -19.9617 0.22
NP_441057.1_4 Reverse -253 -271 -1.25915 0.272
NP_443011.1_4 Forward -181 -162 9.24257 0.225
NP_442400.1_10 Forward -293 -280 7.51014 0.284
NP_440713.1_4 Forward -181 -162 2.0644 0.273
NP_442079.1_1 Reverse -282 -301 14.9458 0.213
NP_442346.1_5 Forward -54 -44 5.09324 0.262
NP_440545.1_5 Reverse -378 -395 6.33202 0.219
NP_441710.1_5 Forward -176 -157 -0.000545616 0.219
NP_440250.1_4 Reverse -276 -295 6.68515 0.253
NP_442934.1_8 Reverse -189 -208 14.6508 0.173
NP_441653.1_3 Reverse -257 -271 13.4709 0.279
NP_441943.1_8 Forward -275 -256 3.93269 0.164
NP_440034.1_4 Forward -306 -294 16.7275 0.254
NP_442828.1_8 Reverse -294 -313 20.354 0.0643
NP_441329.1_1 Reverse -281 -300 8.16414 0.229
NP_441895.1_10 Forward -118 -99 -18.8801 0.282
NP_443015.1_8 Forward -141 -127 16.5468 0.276
NP_440671.1_1 Reverse -282 -301 8.52366 0.204
NP_440671.1_5 Forward -398 -384 16.4202 0.181
NP_442404.1_9 Forward -317 -303 9.43874 0.271
NP_443026.1_5 Reverse -248 -267 1.37609 0.283
NP_440224.1_8 Forward -172 -153 16.3224 0.108
NP_441813.1_7 Forward -272 -258 8.94708 0.268
NP_440594.1_5 Forward -307 -288 7.66846 0.293
NP_441259.1_6 Reverse -173 -192 22.4189 0.0128
NP_442839.1_10 Forward -123 -109 12.291 0.288
NP_440821.1_2 Forward -278 -259 19.0757 0.0322
NP_442270.1_9 Forward -395 -376 -9.53865 0.235
NP_441541.1_1 Reverse -283 -301 -1.81236 0.242
NP_440546.1_4 Reverse -248 -258 7.91294 0.214
NP_441474.1_1 Forward -267 -248 -2.26292 0.273
NP_442402.1_4 Forward -87 -68 -6.98278 0.268
NP_442402.1_4 Reverse -48 -67 -9.04772 0.285
NP_442402.1_4 Reverse -97 -116 -9.73604 0.292
NP_442402.1_10 Forward -275 -265 10.9926 0.272
NP_442679.1_1 Reverse -139 -158 -2.75381 0.242
NP_440825.1_1 Reverse -186 -205 36.8736 0.000000936
NP_440825.1_2 Reverse -157 -176 12.7825 0.107
NP_440825.1_3 Reverse -213 -232 6.39097 0.167
NP_442696.1_4 Forward -328 -314 16.6272 0.283
NP_440013.1_4 Reverse -181 -195 18.2892 0.267
NP_442532.1_4 Forward -92 -74 7.38318 0.3
NP_441700.1_2 Reverse -299 -318 16.1257 0.158
NP_440009.1_4 Forward -268 -249 6.4893 0.299
NP_441011.1_8 Reverse -23 -32 6.78456 0.184
NP_442533.1_1 Reverse -378 -397 2.94938 0.0967
NP_442533.1_1 Reverse -372 -391 -13.9635 0.239
NP_442533.1_6 Forward -31 -22 2.65466 0.246
NP_441028.1_6 Reverse -130 -140 10.9926 0.193
NP_441028.1_6 Reverse -59 -69 10.6976 0.197
NP_441028.1_6 Forward -147 -137 9.02601 0.216
NP_441028.1_6 Reverse -129 -139 7.94438 0.217
NP_441028.1_6 Forward -349 -339 5.58445 0.246
NP_441028.1_6 Reverse -128 -138 5.38779 0.255
NP_441028.1_6 Forward -253 -243 4.40448 0.278
NP_441527.1_4 Forward -110 -91 -6.35064 0.217
NP_440903.1_1 Reverse -186 -196 17.5813 0.185
NP_441106.1_3 Reverse -281 -300 16.0274 0.121
NP_441825.1_4 Reverse -299 -309 15.8113 0.186
NP_441479.1_1 Forward -177 -158 6.68596 0.292
NP_440886.1_7 Forward -391 -381 5.68278 0.168
NP_440886.1_7 Forward -32 -22 4.60114 0.227
NP_440799.1_10 Reverse -345 -364 12.8808 0.267
NP_442213.1_5 Reverse -377 -396 1.96607 0.239
NP_441463.1_2 Reverse -279 -297 -1.35932 0.293
NP_442211.1_9 Reverse -152 -171 2.75272 0.247
NP_441993.1_1 Reverse -250 -269 0.484826 0.298
NP_441720.1_9 Reverse -220 -239 15.7324 0.161
NP_440766.1_5 Reverse -352 -364 7.46481 0.29
NP_441421.1_6 Forward -298 -281 15.7128 0.212
NP_442743.1_4 Reverse -257 -276 -0.983855 0.185
NP_442867.1_8 Reverse -126 -145 9.3409 0.224
NP_442867.1_8 Forward -247 -228 3.83436 0.297
NP_441801.1_4 Forward -146 -136 2.92996 0.231
NP_441332.1_6 Forward -249 -239 16.9714 0.0994
NP_441436.1_2 Reverse -174 -193 -3.83545 0.28
NP_442514.1_5 Forward -149 -130 -9.24438 0.295
NP_442862.1_3 Forward -374 -357 11.0519 0.202
NP_442112.1_8 Forward -283 -264 17.2074 0.231
NP_442703.1_1 Forward -301 -282 6.92274 0.266
NP_442341.1_9 Forward -33 -19 6.48882 0.225
NP_440552.1_8 Forward -299 -282 11.7976 0.239
NP_443059.1_8 Reverse -164 -183 13.4708 0.233
NP_442513.1_6 Forward -147 -128 6.39016 0.296
NP_442275.1_3 Forward -137 -118 10.7175 0.281
NP_440172.1_1 Forward -163 -153 5.48657 0.143
NP_441226.1_7 Forward -247 -240 5.64364 0.286
NP_440416.1_1 Reverse -248 -267 -14.4552 0.288
NP_442552.1_5 Reverse -183 -202 19.764 0.0568
NP_442552.1_7 Reverse -155 -174 21.1397 0.0712
NP_442552.1_9 Reverse -231 -250 18.9773 0.0993
NP_442154.1_1 Reverse -300 -318 -14.0422 0.217
NP_442154.1_1 Reverse -255 -273 -15.9105 0.228
NP_442154.1_1 Reverse -178 -196 -19.1554 0.291
NP_440261.1_7 Forward -143 -124 -5.50708 0.237
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGCTCCTCCCCCGACCACAATCACAGTTCTTGTCATAGTTTTGACCAACCTTTATCTCTGGATTTCACTGGAAAATGGATCTAATCACCCCAAAAATCCCTTTAAAAAACTTAACAAATACGGAACTCCCCACCGGCAAAAACCCTATGCCCCCCGTCCCAACCTGTACAATGAAGAGGGCGGAGACGTAAGTTTCCGTTCACTCCTCACACCACACTCCGCCTGGATGATGTTCGGGCGGTTTCTTCTTATCTGCTCCCCAGGGGGAAAAGTGTGACGCCAACTGTGACAAAAGATGAATAAATTCTAAGTTTCACGATATTTTTCCATACAGGGGTCAACAATTGGTTATGGTAGTATTCTAATCAGCCCATCACGAGGTTTAGAAGGATTTCCAGT

CDS

ATGAGTGCTACCCCTCAAGTTTCCGACGCAAGTTTTAAAGAGGATGTATTAGACAGCGAGTTACCCGTGCTCGTAGACTTTTGGGCTCCCTGGTGTGGCCCTTGTCGCATGGTAGCCCCCGTCGTTGATGAAATCTCACAACAGTACGAAGGTAAGGTCAAAGTCGTTAAGTTAAACACCGACGAGAACCCCAATACCGCTAGTCAGTATGGCATCCGCAGTATTCCCACCCTAATGATTTTCAAGGGGGGCCAGAGAGTGGATATGGTGGTGGGAGCCGTGCCCAAAACCACCCTGGCCAGCACCCTAGAAAAATATCTTTAA

Protein

MSATPQVSDASFKEDVLDSELPVLVDFWAPWCGPCRMVAPVVDEISQQYEGKVKVVKLNTDENPNTASQYGIRSIPTLMIFKGGQRVDMVVGAVPKTTLASTLEKYL