Your browser is old and dusty. Try Google Chrome!

Details for slr0616

ORF slr0616
Accession NP_442543.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -178 -192 11.406 0.0519
NP_441061.1_2 Forward -185 -171 1.86788 0.181
NP_440795.1_7 Forward -185 -178 14.6904 0.0123
NP_440795.1_7 Reverse -178 -185 14.6904 0.0123
NP_440795.1_7 Forward -104 -97 8.00392 0.218
NP_441418.1_3 Reverse -129 -148 10.5514 0.272
NP_441418.1_6 Reverse -177 -196 -20.8467 0.129
NP_441418.1_6 Forward -186 -167 -29.7948 0.238
NP_440815.1_2 Reverse -278 -292 10.3237 0.265
NP_442291.1_5 Reverse -176 -192 10.5799 0.0434
NP_442291.1_5 Forward -187 -171 -4.1697 0.266
NP_441453.1_4 Reverse -177 -185 16.539 0.00633
NP_441453.1_4 Forward -186 -178 16.539 0.00633
NP_442151.1_6 Forward -186 -172 18.5841 0.0071
NP_441818.1_1 Forward -185 -174 16.0861 0.0221
NP_441818.1_1 Reverse -178 -189 9.79292 0.232
NP_440226.1_1 Forward -186 -167 8.55425 0.0849
NP_440150.1_6 Reverse -174 -193 0.982764 0.295
NP_442173.1_1 Forward -185 -177 15.4574 0.00633
NP_442173.1_1 Reverse -178 -186 15.4574 0.00633
NP_442752.1_4 Forward -186 -179 13.8055 0.0199
NP_442752.1_4 Reverse -177 -184 13.8055 0.0199
NP_443027.1_4 Reverse -175 -185 13.1564 0.0521
NP_443027.1_4 Forward -188 -178 11.0914 0.107
NP_443027.1_4 Forward -107 -97 6.96153 0.253
NP_441812.1_3 Forward -187 -173 7.9644 0.254
NP_441812.1_3 Forward -106 -92 7.27608 0.282
NP_442975.1_10 Reverse -173 -187 3.63724 0.252
NP_440784.1_7 Forward -185 -178 15.9687 0.0123
NP_440784.1_7 Reverse -178 -185 15.9687 0.0123
NP_440061.1_9 Forward -188 -174 13.1753 0.0839
NP_440061.1_9 Reverse -175 -189 11.897 0.105
NP_442062.1_8 Forward -186 -176 17.3846 0.00193
NP_442062.1_8 Reverse -177 -187 17.3846 0.00193
NP_442062.1_8 Forward -117 -107 3.51995 0.267
NP_441859.1_3 Reverse -176 -195 9.53674 0.129
NP_441859.1_3 Forward -187 -168 3.34192 0.244
NP_440304.1_4 Reverse -175 -185 9.91146 0.051
NP_440304.1_4 Forward -188 -178 1.84832 0.299
NP_440304.1_9 Reverse -68 -87 19.9606 0.0969
NP_442242.1_4 Forward -185 -178 14.3954 0.0124
NP_442242.1_4 Reverse -178 -185 14.3954 0.0124
NP_440044.1_8 Forward -185 -166 7.66927 0.0817
NP_441200.1_4 Reverse -30 -49 5.211 0.297
NP_441208.1_9 Reverse -174 -188 4.52282 0.299
NP_441594.1_6 Reverse -180 -199 5.40766 0.209
NP_442375.1_5 Reverse -180 -194 14.8469 0.289
NP_442110.1_7 Forward -186 -172 7.76774 0.108
NP_441083.1_5 Forward -186 -176 20.3345 0.00053
NP_441083.1_5 Reverse -177 -187 20.3345 0.00053
NP_441434.1_7 Forward -184 -170 4.12949 0.225
NP_441738.1_2 Forward -184 -177 15.28 0.0102
NP_441738.1_2 Reverse -179 -186 15.28 0.0102
NP_441558.1_5 Forward -188 -169 7.57094 0.176
NP_440209.1_1 Reverse -177 -185 18.1123 0.00295
NP_440209.1_1 Forward -186 -178 18.1123 0.00295
NP_442889.1_8 Reverse -174 -188 3.8339 0.273
NP_441713.1_1 Reverse -171 -190 -14.7502 0.259
NP_440178.1_7 Forward -187 -168 -14.6519 0.156
NP_440178.1_7 Forward -247 -228 -21.4367 0.223
NP_441716.1_1 Reverse -177 -191 8.84938 0.13
NP_442111.1_4 Reverse -176 -190 5.01447 0.181
NP_440906.1_5 Forward -185 -178 15.8704 0.0124
NP_440906.1_5 Reverse -178 -185 15.8704 0.0124
NP_440747.1_10 Forward -189 -177 26.5883 0.000317
NP_440747.1_10 Reverse -174 -186 7.51213 0.00286
NP_441130.1_10 Forward -188 -174 14.3559 0.0483
NP_441130.1_10 Reverse -175 -189 7.9644 0.144
NP_441486.1_1 Reverse -174 -188 5.99778 0.0344
NP_441486.1_1 Forward -189 -175 -2.95034 0.175
NP_442634.1_4 Reverse -175 -189 -2.85201 0.156
NP_442634.1_4 Forward -188 -174 -3.34366 0.161
NP_440403.1_4 Reverse -168 -187 -7.57203 0.247
NP_442848.1_1 Reverse -171 -185 -3.147 0.263
NP_443018.1_3 Forward -185 -178 14.8871 0.0123
NP_443018.1_3 Reverse -178 -185 14.8871 0.0123
NP_443018.1_3 Forward -104 -97 4.07068 0.299
NP_441316.1_7 Reverse -175 -190 -3.85501 0.296
NP_441634.1_8 Forward -188 -174 14.8476 0.0248
NP_440376.1_1 Forward -186 -177 19.4693 0.000692
NP_440376.1_1 Reverse -177 -186 19.4693 0.000692
NP_441857.1_5 Reverse -170 -188 6.90232 0.189
NP_441588.1_4 Forward -184 -174 8.63316 0.14
NP_442687.1_7 Forward -187 -177 8.92815 0.0994
NP_442687.1_7 Reverse -176 -186 8.92815 0.0994
NP_441077.1_6 Reverse -317 -333 1.74139 0.298
NP_440642.1_10 Forward -291 -277 7.57046 0.221
NP_441682.1_6 Reverse -346 -365 13.4708 0.291
NP_440887.1_8 Reverse -168 -182 16.4209 0.263
NP_442658.1_1 Reverse -175 -185 9.616 0.147
NP_442658.1_1 Forward -188 -178 7.94438 0.199
NP_442198.1_3 Forward -247 -228 5.01433 0.264
NP_442544.1_6 Forward -193 -174 1.86774 0.111
NP_441414.1_9 Reverse -177 -196 0.884433 0.0782
NP_441414.1_9 Forward -186 -167 -0.983855 0.0964
NP_441958.1_5 Forward -187 -177 12.2714 0.00183
NP_441958.1_5 Reverse -176 -186 12.2714 0.00183
NP_440450.1_1 Forward -106 -87 7.07928 0.113
NP_442836.1_5 Reverse -171 -190 4.62101 0.204
NP_442836.1_5 Forward -192 -173 4.03102 0.22
NP_442685.1_2 Reverse -140 -150 13.943 0.278
NP_440203.1_5 Reverse -93 -103 9.02601 0.275
NP_439905.1_1 Forward -185 -172 10.344 0.216
NP_440984.1_7 Reverse -172 -186 19.7641 0.0061
NP_440984.1_7 Forward -191 -177 9.34103 0.127
NP_439990.1_5 Forward -191 -178 10.5407 0.128
NP_439990.1_5 Reverse -172 -185 8.37742 0.174
NP_442690.1_1 Reverse -51 -70 -2.26216 0.136
NP_442690.1_1 Forward -72 -53 -14.0619 0.268
NP_442690.1_1 Forward -101 -82 -17.3068 0.299
NP_442911.1_2 Forward -196 -177 5.50599 0.0332
NP_441580.1_6 Reverse -166 -185 -5.21209 0.235
NP_443055.1_6 Reverse -169 -187 -1.84987 0.284
NP_441099.1_5 Forward -196 -177 -10.9153 0.266
NP_440475.1_1 Reverse -168 -187 10.5844 0.268
NP_441294.1_7 Reverse -173 -187 8.96266 0.269
NP_441646.1_1 Forward -193 -174 8.75091 0.14
NP_442438.1_10 Reverse -172 -186 9.04604 0.0692
NP_440147.1_4 Forward -188 -175 18.1122 0.00478
NP_440147.1_4 Reverse -175 -188 9.75405 0.0371
NP_441550.1_8 Reverse -175 -185 16.7941 0.00906
NP_441550.1_8 Forward -188 -178 15.1225 0.0132
NP_441916.1_7 Forward -186 -176 10.3048 0.0261
NP_441916.1_7 Reverse -177 -187 10.3048 0.0261
NP_441041.1_7 Reverse -174 -186 12.4708 0.0611
NP_441041.1_7 Forward -189 -177 7.51478 0.162
NP_441725.1_4 Forward -191 -177 3.53891 0.278
NP_441725.1_5 Forward -185 -175 9.02648 0.0553
NP_441725.1_5 Reverse -178 -188 2.04498 0.115
NP_439966.1_7 Forward -188 -178 15.3192 0.0152
NP_439966.1_7 Reverse -175 -185 14.8275 0.0177
NP_439966.1_7 Reverse -94 -104 9.321 0.117
NP_439966.1_9 Reverse -175 -184 0.884706 0.253
NP_442941.1_3 Reverse -178 -188 19.2529 0.00262
NP_442941.1_3 Forward -185 -175 10.9931 0.0116
NP_440289.1_2 Reverse -174 -187 11.6223 0.0184
NP_440289.1_2 Reverse -226 -239 7.49244 0.0557
NP_440289.1_2 Forward -189 -176 3.06754 0.0811
NP_440983.1_5 Forward -183 -164 -2.0655 0.231
NP_441514.1_4 Forward -149 -130 13.9592 0.25
NP_442281.1_1 Forward -191 -177 16.6169 0.00772
NP_442281.1_1 Reverse -172 -186 14.2569 0.0198
NP_441079.1_7 Reverse -128 -147 -1.96793 0.212
NP_441079.1_7 Forward -149 -130 -3.14789 0.231
NP_442256.1_2 Reverse -175 -193 -3.52077 0.214
NP_440437.1_1 Forward -192 -173 -4.91709 0.271
NP_441644.1_6 Forward -186 -176 17.3841 0.00127
NP_441644.1_6 Reverse -177 -187 17.3841 0.00127
NP_442215.1_2 Forward -188 -172 4.58176 0.0832
NP_442215.1_2 Reverse -175 -191 0.353528 0.153
NP_442029.1_6 Forward -225 -206 7.57094 0.223
NP_442029.1_6 Forward -110 -91 2.94938 0.286
NP_442247.1_6 Forward -46 -27 10.2259 0.285
NP_440253.1_2 Forward -186 -168 -1.65248 0.245
NP_440253.1_2 Reverse -177 -195 -3.52077 0.294
NP_440929.1_8 Forward -186 -177 19.2726 0.000701
NP_440929.1_8 Reverse -177 -186 19.2726 0.000701
NP_442933.1_1 Forward -74 -55 10.9334 0.249
NP_442933.1_2 Reverse -9 -27 9.45569 0.257
NP_442933.1_10 Forward -186 -177 17.601 0.00325
NP_442933.1_10 Reverse -177 -186 17.601 0.00325
NP_441095.1_6 Reverse -289 -308 13.2741 0.14
NP_441751.2_8 Reverse -178 -192 23.5007 0.00466
NP_441751.2_8 Forward -185 -171 2.75286 0.0759
NP_442554.1_8 Forward -185 -175 18.0729 0.00543
NP_442554.1_8 Reverse -178 -188 16.2046 0.0065
NP_441762.1_7 Forward -187 -175 2.69391 0.0676
NP_441762.1_7 Reverse -176 -188 -6.74586 0.284
NP_442142.1_4 Forward -189 -176 13.49 0.0348
NP_442142.1_4 Reverse -174 -187 12.2117 0.0464
NP_442142.1_4 Reverse -93 -106 4.73861 0.212
NP_442292.1_1 Forward -185 -176 18.486 0.00229
NP_442292.1_1 Reverse -178 -187 18.486 0.00229
NP_442476.1_6 Forward -185 -171 15.2409 0.037
NP_442476.1_6 Reverse -178 -192 8.65272 0.0982
NP_440895.1_6 Forward -192 -179 11.524 0.202
NP_442381.1_8 Reverse -174 -193 -6.1954 0.154
NP_443009.1_5 Reverse -176 -187 8.90795 0.0965
NP_443009.1_5 Forward -187 -176 8.90795 0.0965
NP_441715.1_4 Reverse -178 -188 17.3846 0.0106
NP_441715.1_4 Forward -185 -175 7.84651 0.107
NP_440357.1_3 Reverse -175 -194 3.34271 0.242
NP_440881.1_10 Reverse -178 -191 11.229 0.253
NP_441468.1_1 Forward -185 -178 15.8704 0.0124
NP_441468.1_1 Reverse -178 -185 15.8704 0.0124
NP_441468.1_1 Forward -104 -97 10.2655 0.0906
NP_439939.1_6 Reverse -177 -196 13.9625 0.277
NP_441673.1_1 Forward -186 -177 20.8459 0.000698
NP_441673.1_1 Reverse -177 -186 20.8459 0.000698
NP_441731.1_3 Forward -194 -175 4.62101 0.159
NP_441826.1_2 Reverse -171 -185 6.48943 0.0931
NP_441826.1_2 Forward -192 -178 3.93283 0.105
NP_441764.1_4 Reverse -58 -75 16.4751 0.0851
NP_442868.1_6 Forward -188 -178 19.2529 0.00563
NP_442868.1_6 Reverse -175 -185 17.4829 0.012
NP_442719.1_2 Forward -69 -51 -11.2896 0.291
NP_441612.1_2 Reverse -177 -187 8.54929 0.21
NP_441612.1_2 Forward -186 -176 8.54929 0.21
NP_442427.1_8 Reverse -168 -187 11.2092 0.152
NP_442808.1_1 Reverse -176 -186 8.63269 0.0481
NP_442808.1_1 Forward -187 -177 8.63269 0.0481
NP_441849.1_3 Reverse -93 -112 15.4366 0.177
NP_440145.1_3 Reverse -167 -186 -0.197208 0.14
NP_442542.1_2 Reverse -175 -188 11.229 0.114
NP_442050.1_5 Reverse -175 -185 15.6142 0.01
NP_442050.1_5 Forward -188 -178 14.3359 0.0206
NP_440558.1_2 Forward -180 -161 -3.14714 0.234
NP_441518.1_3 Reverse -167 -186 -13.6686 0.264
NP_441878.1_6 Forward -187 -177 10.4031 0.0176
NP_441878.1_6 Reverse -176 -186 10.4031 0.0176
NP_441036.1_8 Forward -187 -177 8.33817 0.174
NP_441036.1_8 Reverse -176 -186 8.33817 0.174
NP_441557.1_5 Forward -186 -177 19.9609 0.000699
NP_441557.1_5 Reverse -177 -186 19.9609 0.000699
NP_441445.1_1 Reverse -168 -187 10.5209 0.0945
NP_441445.1_1 Forward -195 -176 1.67108 0.248
NP_441590.1_4 Reverse -96 -115 4.81688 0.279
NP_442066.2_4 Forward -186 -167 -9.24366 0.296
NP_442066.2_9 Reverse -173 -186 17.6205 0.0254
NP_442066.2_9 Forward -190 -177 10.8357 0.154
NP_442183.1_1 Forward -186 -172 10.0294 0.0903
NP_442183.1_1 Reverse -177 -191 8.94771 0.105
NP_442135.1_8 Forward -197 -179 11.6222 0.207
NP_441574.1_1 Forward -117 -98 -3.14714 0.236
NP_441549.1_9 Forward -190 -172 -5.97904 0.198
NP_442347.1_2 Forward -185 -176 12.4878 0.056
NP_442347.1_2 Reverse -178 -187 12.4878 0.056
NP_442888.1_6 Reverse -10 -29 2.65439 0.249
NP_441037.1_4 Reverse -175 -185 9.55921 0.21
NP_441633.1_3 Forward -188 -175 13.1956 0.018
NP_441633.1_3 Reverse -175 -188 -5.97891 0.236
NP_440136.1_2 Forward -185 -178 15.9687 0.0123
NP_440136.1_2 Reverse -178 -185 15.9687 0.0123
NP_440136.1_2 Forward -104 -97 4.26735 0.218
NP_442998.1_5 Reverse -286 -296 10.8948 0.201
NP_442998.1_10 Forward -184 -177 15.5754 0.0102
NP_442998.1_10 Reverse -179 -186 15.5754 0.0102
NP_440299.1_1 Forward -190 -177 10.5401 0.0569
NP_440299.1_1 Reverse -173 -186 3.85363 0.228
NP_441799.1_1 Forward -190 -176 15.4369 0.0182
NP_441799.1_1 Reverse -173 -187 12.5853 0.0421
NP_441007.1_10 Reverse -172 -185 19.9805 0.0184
NP_441007.1_10 Forward -191 -178 8.57408 0.112
NP_440256.1_1 Forward -189 -170 2.55606 0.0625
NP_440256.1_1 Forward -120 -101 -8.16202 0.253
NP_440256.1_1 Forward -317 -298 -10.0303 0.293
NP_440709.1_1 Forward -79 -60 2.9486 0.219
NP_440709.1_1 Forward -69 -50 0.490334 0.259
NP_441559.1_8 Forward -191 -177 -6.49025 0.279
NP_440915.1_6 Reverse -173 -187 4.42448 0.0953
NP_440915.1_6 Forward -109 -95 2.94952 0.11
NP_440915.1_6 Forward -190 -176 0.982901 0.148
NP_441866.1_3 Reverse -281 -294 14.6706 0.177
NP_440695.1_5 Reverse -177 -196 -2.16383 0.296
NP_440677.1_1 Forward -195 -176 10.7175 0.163
NP_442386.1_9 Reverse -176 -185 13.8639 0.0289
NP_442386.1_9 Forward -187 -178 13.8639 0.0289
NP_442386.1_9 Forward -106 -97 11.209 0.0993
NP_441340.1_5 Forward -185 -178 15.6737 0.0124
NP_441340.1_5 Reverse -178 -185 15.6737 0.0124
NP_442484.1_2 Reverse -166 -185 2.0644 0.226
NP_440194.1_3 Reverse -167 -186 4.03102 0.271
NP_442240.1_1 Forward -194 -175 2.85027 0.299
NP_440586.1_8 Forward -185 -178 13.2151 0.026
NP_440586.1_8 Reverse -178 -185 13.2151 0.026
NP_440586.1_8 Reverse -48 -55 7.02027 0.279
NP_442251.1_6 Forward -185 -178 15.2804 0.0124
NP_442251.1_6 Reverse -178 -185 15.2804 0.0124
NP_440684.1_9 Forward -192 -178 10.4227 0.198
NP_441262.1_3 Reverse -177 -184 14.7888 0.0223
NP_441262.1_3 Forward -186 -179 14.7888 0.0223
NP_443051.1_1 Reverse -176 -185 10.4228 0.00754
NP_443051.1_1 Forward -187 -178 10.4228 0.00754
NP_439984.1_3 Forward -193 -179 20.2551 0.0437
NP_440408.1_7 Reverse -177 -196 8.16093 0.282
NP_440439.1_1 Forward -189 -176 1.9859 0.138
NP_440372.1_2 Forward -185 -178 16.3621 0.0124
NP_440372.1_2 Reverse -178 -185 16.3621 0.0124
NP_440819.1_5 Reverse -285 -293 7.68924 0.266
NP_441803.1_2 Forward -191 -172 5.211 0.17
NP_441572.1_7 Reverse -171 -190 4.81767 0.0925
NP_440267.1_1 Reverse -51 -67 18.0548 0.295
NP_442384.1_10 Reverse -177 -190 18.9972 0.00338
NP_442384.1_10 Forward -186 -173 2.08423 0.237
NP_441877.1_7 Forward -191 -172 -0.39464 0.284
NP_442790.1_4 Forward -195 -176 -0.885524 0.0987
NP_442262.1_10 Forward -185 -178 14.1988 0.0123
NP_442262.1_10 Reverse -178 -185 14.1988 0.0123
NP_441689.1_5 Reverse -175 -185 5.87944 0.197
NP_441689.1_5 Forward -188 -178 5.78111 0.197
NP_440344.1_10 Reverse -170 -187 0.432165 0.0358
NP_440531.1_6 Reverse -169 -188 11.5042 0.0574
NP_440531.1_6 Forward -38 -19 -3.3438 0.265
NP_440189.1_10 Reverse -270 -289 3.44104 0.279
NP_440562.1_3 Forward -185 -168 6.72535 0.15
NP_441965.1_10 Reverse -174 -190 19.8231 0.0179
NP_442693.1_7 Reverse -176 -195 8.06259 0.275
NP_440297.1_9 Reverse -178 -188 -0.118297 0.282
NP_440297.1_9 Forward -185 -175 -0.216628 0.282
NP_441592.1_4 Reverse -177 -196 5.50599 0.133
NP_442129.1_9 Forward -84 -65 13.9455 0.284
NP_440999.1_9 Reverse -173 -187 10.816 0.049
NP_440999.1_9 Forward -190 -176 7.07942 0.0912
NP_440888.1_2 Forward -186 -172 18.1901 0.00261
NP_440888.1_2 Reverse -177 -191 11.5037 0.0657
NP_440888.1_2 Reverse -96 -110 7.47213 0.194
NP_440600.1_4 Forward -194 -176 -4.30741 0.257
NP_442948.1_2 Reverse -336 -355 4.03102 0.274
NP_441543.1_2 Forward -185 -176 16.9127 0.00359
NP_441543.1_2 Reverse -178 -187 16.9127 0.00359
NP_442845.1_2 Reverse -171 -185 13.9626 0.088
NP_442845.1_2 Forward -192 -178 7.47274 0.195
NP_442845.1_2 Forward -111 -97 6.88276 0.201
NP_441319.1_5 Forward -185 -166 9.43923 0.27
NP_442710.1_7 Reverse -63 -82 -4.33945 0.272
NP_441469.1_8 Forward -187 -178 6.48957 0.227
NP_441469.1_8 Reverse -176 -185 6.48957 0.227
NP_443064.1_6 Forward -186 -176 12.5669 0.0796
NP_443064.1_6 Reverse -177 -187 12.5669 0.0796
NP_442578.1_7 Forward -185 -178 14.5921 0.026
NP_442578.1_7 Reverse -178 -185 14.5921 0.026
NP_441462.1_2 Forward -186 -176 11.5831 0.00406
NP_441462.1_2 Reverse -177 -187 11.5831 0.00406
NP_441621.1_7 Reverse -175 -189 -2.85201 0.188
NP_443062.1_1 Forward -186 -168 5.6207 0.224
NP_443062.1_1 Reverse -177 -195 5.5232 0.227
NP_443062.1_1 Reverse -96 -114 4.35311 0.264
NP_443062.1_6 Forward -194 -175 6.88262 0.179
NP_440519.1_8 Reverse -162 -178 0.845183 0.298
NP_442204.1_1 Forward -190 -179 1.7303 0.266
NP_440516.1_8 Forward -186 -177 16.9127 0.00442
NP_440516.1_8 Reverse -177 -186 16.9127 0.00442
NP_442428.1_5 Forward -185 -178 15.8704 0.0124
NP_442428.1_5 Reverse -178 -185 15.8704 0.0124
NP_442428.1_5 Forward -104 -97 4.66067 0.244
NP_440673.1_2 Reverse -167 -186 16.9256 0.0543
NP_440673.1_3 Forward -184 -177 12.4288 0.0426
NP_440673.1_3 Reverse -179 -186 12.4288 0.0426
NP_441052.1_2 Forward -186 -176 19.9412 0.00106
NP_441052.1_2 Reverse -177 -187 19.9412 0.00106
NP_441052.1_2 Reverse -96 -106 5.78156 0.103
NP_442219.1_9 Forward -185 -176 17.7976 0.00718
NP_442219.1_9 Reverse -178 -187 17.7976 0.00718
NP_442219.1_9 Reverse -97 -106 5.70292 0.135
NP_440436.1_4 Forward -185 -176 17.2072 0.00233
NP_440436.1_4 Reverse -178 -187 17.2072 0.00233
NP_440436.1_4 Reverse -97 -106 10.029 0.0863
NP_441884.1_9 Forward -189 -170 -14.2585 0.138
NP_441884.1_9 Reverse -174 -193 -15.6352 0.138
NP_440314.1_9 Forward -185 -166 -5.99873 0.225
NP_440314.1_9 Reverse -178 -197 -9.73531 0.276
NP_441086.1_3 Forward -73 -54 13.2486 0.117
NP_441719.1_4 Forward -185 -178 16.3621 0.0124
NP_441719.1_4 Reverse -178 -185 16.3621 0.0124
NP_441733.1_10 Reverse -174 -187 10.344 0.106
NP_442694.1_4 Forward -100 -91 11.8978 0.277
NP_442206.1_10 Reverse -177 -192 6.76473 0.178
NP_443054.1_2 Forward -188 -174 10.3243 0.0761
NP_441851.1_10 Forward -187 -177 15.8113 0.00552
NP_441851.1_10 Reverse -176 -186 15.8113 0.00552
NP_441555.1_2 Reverse -49 -68 10.5514 0.299
NP_442856.1_7 Reverse -168 -187 1.57275 0.17
NP_441668.1_4 Forward -196 -177 1.86774 0.209
NP_442515.1_1 Forward -187 -173 13.2743 0.0278
NP_442515.1_1 Reverse -176 -190 11.111 0.0428
NP_441349.1_10 Forward -196 -177 -5.70374 0.21
NP_441409.1_6 Reverse -171 -190 -7.4737 0.151
NP_441409.1_6 Forward -192 -173 -9.44032 0.184
NP_440432.1_9 Forward -185 -170 6.76473 0.0455
NP_442843.1_1 Reverse -282 -301 -9.53865 0.266
NP_439960.1_10 Forward -193 -175 1.98577 0.189
NP_440474.1_8 Forward -185 -171 6.58715 0.222
NP_441124.1_5 Reverse -7 -17 12.4352 0.221
NP_440431.1_3 Reverse -176 -195 -7.37537 0.204
NP_440431.1_3 Reverse -95 -114 -11.0136 0.28
NP_442450.1_5 Reverse -94 -104 4.99491 0.271
NP_440588.1_2 Forward -195 -176 -2.0655 0.16
NP_442237.1_2 Forward -334 -315 17.425 0.193
NP_442038.1_1 Forward -135 -116 3.44104 0.269
NP_441570.1_1 Forward -186 -168 -8.83064 0.122
NP_440078.1_10 Reverse -177 -196 2.65439 0.269
NP_441078.1_4 Forward -186 -177 19.6659 0.0007
NP_441078.1_4 Reverse -177 -186 19.6659 0.0007
NP_442729.1_8 Reverse -173 -186 10.049 0.125
NP_441663.1_8 Forward -192 -173 8.55425 0.0906
NP_440526.1_3 Forward -185 -174 20.0193 0.0113
NP_440526.1_3 Reverse -178 -189 8.02298 0.126
NP_441432.1_8 Reverse -176 -185 16.8143 0.00595
NP_441432.1_8 Forward -187 -178 16.8143 0.00595
NP_441333.1_1 Forward -75 -65 13.0198 0.217
NP_442320.1_8 Reverse -171 -185 14.1593 0.0138
NP_442320.1_8 Forward -111 -97 -4.32697 0.159
NP_442344.1_7 Forward -185 -166 -7.27704 0.18
NP_442344.1_7 Reverse -178 -197 -9.34199 0.249
NP_441732.1_2 Forward -190 -174 -6.7263 0.0495
NP_440760.1_1 Reverse -229 -248 -12.0953 0.091
NP_440760.1_1 Forward -186 -167 -15.4385 0.147
NP_440760.1_1 Reverse -177 -196 -22.8133 0.271
NP_440199.1_10 Reverse -308 -318 13.1564 0.111
NP_440199.1_10 Reverse -174 -184 7.35486 0.231
NP_440578.1_10 Forward -298 -279 16.6174 0.246
NP_440913.1_1 Forward -188 -170 11.2289 0.168
NP_440913.1_1 Forward -107 -89 6.70565 0.221
NP_442489.1_7 Forward -186 -177 20.1576 0.000695
NP_442489.1_7 Reverse -177 -186 20.1576 0.000695
NP_440559.1_1 Forward -185 -176 17.4043 0.00658
NP_440559.1_1 Reverse -178 -187 17.4043 0.00658
NP_441659.2_8 Forward -186 -176 18.1713 0.00133
NP_441659.2_8 Reverse -177 -187 18.1713 0.00133
NP_441092.1_3 Reverse -179 -198 4.22769 0.183
NP_442913.1_10 Reverse -168 -187 8.94757 0.0464
NP_440779.1_5 Forward -186 -169 -15.0058 0.3
NP_442346.1_5 Forward -187 -177 16.6963 0.00248
NP_442346.1_5 Reverse -176 -186 16.6963 0.00248
NP_440352.1_5 Reverse -277 -296 11.4877 0.257
NP_440545.1_3 Reverse -173 -190 -2.41943 0.184
NP_440459.1_2 Forward -188 -171 10.3636 0.2
NP_440010.1_10 Reverse -165 -184 3.73603 0.25
NP_442137.1_8 Forward -116 -98 21.3363 0.0758
NP_442603.1_7 Reverse -177 -191 13.6669 0.0819
NP_442603.1_7 Forward -186 -172 10.3237 0.129
NP_441888.1_7 Forward -191 -177 3.44117 0.225
NP_441833.1_4 Forward -185 -178 15.9687 0.0124
NP_441833.1_4 Reverse -178 -185 15.9687 0.0124
NP_441329.1_6 Reverse -314 -333 -3.29489 0.3
NP_440912.1_3 Forward -147 -128 11.0117 0.254
NP_442699.1_8 Reverse -279 -298 -3.04881 0.218
NP_442162.1_9 Forward -185 -178 16.2637 0.0124
NP_442162.1_9 Reverse -178 -185 16.2637 0.0124
NP_442199.1_7 Forward -38 -19 3.04693 0.253
NP_442140.1_3 Forward -185 -175 13.5497 0.0542
NP_442140.1_3 Reverse -178 -188 10.3048 0.0902
NP_440875.1_9 Forward -184 -174 8.66404 0.233
NP_440875.1_9 Reverse -179 -189 8.37203 0.233
NP_441813.1_5 Forward -188 -178 18.1713 0.00743
NP_441813.1_5 Reverse -175 -185 8.73149 0.0367
NP_442028.1_1 Forward -77 -64 7.70113 0.289
NP_440590.1_4 Forward -185 -172 11.3273 0.0209
NP_440590.1_4 Reverse -178 -191 -4.01229 0.257
NP_440567.1_1 Forward -185 -171 17.4042 0.0153
NP_440567.1_1 Reverse -178 -192 3.8345 0.135
NP_442497.1_10 Forward -185 -176 10.4228 0.0087
NP_442497.1_10 Reverse -178 -187 10.4228 0.0087
NP_440821.1_4 Reverse -175 -185 17.9746 0.00497
NP_440821.1_4 Forward -188 -178 9.41981 0.0286
NP_440227.1_2 Forward -160 -144 7.53169 0.295
NP_441239.1_9 Reverse -175 -187 7.11881 0.169
NP_441239.1_9 Forward -188 -176 5.25052 0.223
NP_441727.1_3 Reverse -170 -189 5.11266 0.256
NP_441541.1_1 Reverse -49 -67 -1.14392 0.237
NP_441541.1_1 Forward -144 -126 -4.00868 0.271
NP_441541.1_1 Forward -74 -56 -4.58163 0.279
NP_441541.1_1 Forward -77 -59 -5.25007 0.299
NP_440212.1_9 Forward -85 -66 3.63672 0.214
NP_440949.1_7 Forward -194 -175 15.4366 0.162
NP_440546.1_4 Forward -105 -95 11.5973 0.0774
NP_440546.1_4 Forward -186 -176 10.046 0.109
NP_440546.1_4 Reverse -177 -187 10.046 0.109
NP_440462.1_6 Reverse -175 -185 10.3048 0.0396
NP_440462.1_6 Forward -188 -178 9.61647 0.0429
NP_440868.1_4 Forward -190 -178 17.0502 0.0124
NP_440868.1_4 Reverse -173 -185 9.47875 0.0482
NP_440868.1_8 Reverse -173 -192 5.99764 0.103
NP_441848.1_4 Reverse -280 -296 11.3703 0.224
NP_439948.1_2 Reverse -317 -335 13.3709 0.27
NP_441843.2_9 Forward -184 -166 15.2579 0.16
NP_442039.1_4 Forward -185 -178 15.1821 0.0124
NP_442039.1_4 Reverse -178 -185 15.1821 0.0124
NP_442696.1_2 Forward -187 -169 16.7354 0.0955
NP_442837.1_3 Forward -185 -178 15.7721 0.0124
NP_442837.1_3 Reverse -178 -185 15.7721 0.0124
NP_442053.1_1 Forward -186 -177 18.3876 0.0007
NP_442053.1_1 Reverse -177 -186 18.3876 0.0007
NP_440505.1_3 Forward -188 -178 18.3679 0.00213
NP_440505.1_3 Reverse -175 -185 16.598 0.00683
NP_441959.1_8 Forward -396 -383 9.38413 0.286
NP_442844.1_5 Forward -330 -311 5.80018 0.26
NP_440914.1_1 Forward -186 -176 17.5935 0.000537
NP_440914.1_1 Reverse -177 -187 17.5935 0.000537
NP_440914.1_1 Forward -105 -95 8.41992 0.191
NP_441011.1_8 Forward -185 -176 8.25953 0.144
NP_441011.1_8 Reverse -178 -187 8.25953 0.144
NP_442533.1_6 Forward -186 -177 17.2076 0.00137
NP_442533.1_6 Reverse -177 -186 17.2076 0.00137
NP_442533.1_6 Reverse -96 -105 4.91628 0.165
NP_441482.1_7 Forward -192 -178 -2.85201 0.1
NP_439944.1_9 Forward -185 -175 19.1546 0.00329
NP_439944.1_9 Reverse -178 -188 10.5014 0.0887
NP_442203.1_3 Reverse -62 -81 4.98163 0.268
NP_442203.1_3 Forward -397 -378 3.25897 0.291
NP_442269.1_10 Forward -301 -282 1.86774 0.282
NP_441697.1_5 Reverse -343 -362 2.14815 0.178
NP_441697.1_5 Forward -81 -62 -1.57604 0.206
NP_441697.1_5 Reverse -131 -150 -9.02441 0.268
NP_441028.1_6 Forward -293 -283 10.1076 0.21
NP_440116.1_8 Forward -185 -166 -8.85033 0.261
NP_441527.1_4 Reverse -318 -337 -0.907597 0.146
NP_441527.1_4 Reverse -312 -331 -5.87318 0.21
NP_441527.1_4 Reverse -275 -294 -9.50187 0.259
NP_441527.1_4 Reverse -22 -41 -11.8892 0.284
NP_440115.1_6 Forward -189 -179 16.008 0.0325
NP_440115.1_6 Reverse -174 -184 9.81313 0.115
NP_440007.1_9 Forward -190 -176 5.01447 0.266
NP_440007.1_9 Reverse -201 -215 0.589577 0.294
NP_441347.1_5 Forward -192 -178 13.1753 0.238
NP_440608.1_6 Forward -185 -166 8.25844 0.238
NP_441972.1_5 Forward -185 -166 -7.57203 0.25
NP_441106.1_1 Forward -187 -178 9.63616 0.0311
NP_441106.1_1 Reverse -176 -185 9.63616 0.0311
NP_440480.1_8 Reverse -220 -233 19.2922 0.29
NP_441186.1_4 Forward -65 -55 15.0242 0.274
NP_441286.1_1 Forward -187 -175 21.6718 0.00196
NP_441286.1_1 Reverse -176 -188 12.9203 0.00815
NP_442674.1_3 Forward -194 -175 3.24359 0.294
NP_440670.1_8 Forward -186 -177 18.3876 0.000699
NP_440670.1_8 Reverse -177 -186 18.3876 0.000699
NP_440886.1_7 Forward -187 -177 7.94438 0.0805
NP_440886.1_7 Reverse -176 -186 7.94438 0.0805
NP_442614.1_2 Forward -186 -172 14.3559 0.102
NP_442614.1_2 Reverse -177 -191 9.83269 0.242
NP_442072.1_9 Forward -187 -169 -19.942 0.204
NP_440907.2_8 Forward -185 -175 10.8943 0.0969
NP_442264.1_2 Forward -196 -179 5.64371 0.274
NP_439967.1_1 Reverse -274 -292 10.2456 0.276
NP_440841.1_4 Reverse -94 -113 2.26107 0.109
NP_441463.1_3 Forward -196 -177 -8.45701 0.27
NP_441626.1_2 Forward -185 -178 15.7721 0.0124
NP_441626.1_2 Reverse -178 -185 15.7721 0.0124
NP_442365.1_7 Reverse -173 -192 -5.99873 0.284
NP_440107.1_2 Forward -191 -172 6.98095 0.299
NP_442794.1_1 Forward -190 -178 10.1671 0.0721
NP_442615.1_1 Reverse -168 -186 2.57575 0.066
NP_442615.1_1 Forward -195 -177 -1.45582 0.128
NP_441962.1_4 Reverse -172 -191 -1.57384 0.124
NP_441962.1_4 Forward -191 -172 -11.0136 0.236
NP_440387.1_1 Reverse -177 -193 4.77842 0.0388
NP_441431.1_2 Forward -189 -175 6.88214 0.257
NP_441836.1_2 Reverse -171 -190 4.32602 0.145
NP_441836.1_2 Forward -192 -173 -3.73712 0.244
NP_441993.1_1 Reverse -171 -190 1.94669 0.267
NP_440114.1_10 Forward -105 -91 12.6843 0.0754
NP_440114.1_10 Forward -186 -172 9.14437 0.183
NP_441720.1_2 Reverse -201 -220 12.6833 0.213
NP_441237.1_9 Forward -185 -175 14.9263 0.0242
NP_440457.1_1 Forward -190 -178 0.530633 0.25
NP_440142.1_7 Reverse -22 -41 9.0459 0.214
NP_442130.1_8 Reverse -204 -223 17.5015 0.125
NP_442509.1_9 Forward -186 -176 8.14104 0.192
NP_442509.1_9 Reverse -177 -187 8.14104 0.192
NP_441496.1_1 Forward -302 -288 13.667 0.278
NP_440554.1_4 Reverse -178 -188 8.92815 0.0646
NP_440554.1_4 Forward -185 -175 6.37155 0.123
NP_441885.1_5 Forward -186 -176 20.9245 0.000538
NP_441885.1_5 Reverse -177 -187 20.9245 0.000538
NP_441885.1_5 Reverse -96 -106 -1.69159 0.277
NP_440478.1_10 Reverse -175 -189 7.47274 0.262
NP_442703.1_1 Reverse -56 -75 7.20922 0.266
NP_442341.1_7 Forward -187 -173 16.6175 0.0172
NP_442341.1_7 Reverse -176 -190 5.50613 0.154
NP_441173.1_9 Forward -66 -58 11.8187 0.222
NP_440409.1_1 Reverse -169 -188 0.687771 0.209
NP_440191.1_6 Forward -135 -121 13.3805 0.294
NP_440423.1_6 Reverse -169 -188 -5.21209 0.131
NP_443000.1_7 Forward -188 -178 19.9412 0.00223
NP_443000.1_7 Reverse -175 -185 10.4031 0.0345
NP_440552.1_8 Forward -75 -58 19.055 0.0307
NP_441842.1_1 Forward -184 -171 11.6217 0.248
NP_441842.1_10 Reverse -170 -184 11.996 0.113
NP_440275.1_3 Reverse -175 -185 17.6796 0.0102
NP_440275.1_3 Forward -188 -178 15.123 0.0182
NP_440091.1_1 Reverse -173 -185 10.7571 0.0429
NP_443060.1_5 Reverse -169 -188 13.47 0.109
NP_441397.1_8 Reverse -284 -297 14.672 0.188
NP_443010.1_10 Reverse -174 -191 2.57753 0.273
NP_442451.1_2 Reverse -169 -188 -1.86883 0.179
NP_441207.1_7 Reverse -61 -75 8.28727 0.29
NP_441105.1_3 Forward -197 -178 10.2259 0.0425
NP_440216.1_1 Forward -186 -172 0.0979218 0.0284
NP_440216.1_1 Reverse -177 -191 -0.590395 0.0284
NP_440216.1_9 Reverse -282 -291 8.65285 0.286
NP_440216.1_9 Reverse -283 -292 7.27622 0.286
NP_440172.1_1 Forward -186 -176 15.0247 0.00945
NP_440172.1_1 Reverse -177 -187 15.0247 0.00945
NP_440167.1_3 Reverse -167 -186 8.75091 0.273
NP_442015.1_10 Forward -190 -177 11.3273 0.0372
NP_441226.1_7 Forward -185 -178 14.4934 0.0123
NP_441226.1_7 Reverse -178 -185 14.4934 0.0123
NP_441226.1_7 Reverse -97 -104 11.2485 0.0971
NP_441111.1_7 Forward -185 -177 18.7023 0.00294
NP_441111.1_7 Reverse -178 -186 18.7023 0.00294
NP_441766.1_2 Forward -186 -177 17.5026 0.00297
NP_441766.1_2 Reverse -177 -186 17.5026 0.00297
NP_442969.1_4 Reverse -184 -203 14.1591 0.274
NP_440416.1_1 Forward -186 -167 -13.9635 0.284
NP_443052.1_8 Reverse -167 -186 0.982764 0.0618
NP_442116.1_6 Reverse -13 -30 6.06813 0.287
NP_440261.1_5 Forward -185 -172 8.37742 0.0263
NP_440261.1_5 Reverse -178 -191 6.80412 0.0316
NP_440261.1_5 Reverse -22 -35 -12.3704 0.284
NP_440988.1_10 Reverse -175 -189 15.2578 0.125
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGTAATTATAATTAGATAGAGTTCTAGTCATCTTTCCACATAAATAGTACCATCTTTATCGGTTGTAATTCTTCTCTTTATTCATATCCATTGATAGAGCTGTAATTTTTTCCCTGGCTCTATTGTAGAAGCACTATTGTACTATCCAATCAGGAAGTTTGCGTTATCTCCGTTCCTTTAAGGATTGGAATCGGCTCTCATTCTAATGATCCTGGCGATCGCCACTAGAGCCAATCATATTATTTCAACAACAAATTATTATGGTATTTAATAACTAATATAGGTGATTGATCTAGGGATGGCGTTTTGTATCCAATTACACAGTTTATTATTTTTTACAAAGATTCATGGCTCAACTTAGGCCCTCTGGACCTTTGCTAATAGATTTTCATACTCCTC

CDS

ATGTCTGAACCGAAACCAAGCCAGCCTAATTTTTCCCATTTGGAGGAAGCGGACTACACCGGGAGAATGCGACAGCACGATCGCCTCTTTGGATTGCTGGCCATTGCCGCCGGGTTAATTTTCCTGCAAGGGTACATGATTGCGCCCTTGATTCCCCGTTTAGCAGAAATTTTTGACGTATCTGCTCAGGAAATTGGCTTCATTGTGCCCGCCTACATGTTGGCCTATGCCCTAGCGGCGCTTTTTTATGGCATTTTGTCGGACCGTTTTGGCCGTTGGCCCGTCATCCAAATTTCAATCATAGTATTTATTACCTGTACCGCTTTAACTGCTACTGCTCAAACTGCAGCTCAGATGACCTTTTGGCGATTACTGACAGGACTTGGGGCCAGCGGCGTGATTCCCCTCACCTTTGCCCTCATTGGCGACATGTTTCCCTACAACCAACGGGGGGCAAAATTAGGGCTGGTGTTTGCGGCGATGGAGGGGGGCATGGCTGCCGGTTCCGCCGGGGGGGCAATTTTAGAACCCTTTCTTGGTTGGCAATTGTTGTTTATTGGCACTGCCACTGCGCCCGTGATTGTGCTCTGGCGACTGCGACGCTACGGGGCTTTGTTCGATGCCCCCAAAGCAACCAAGATCCCTGCCCTGGCAACGGTGTTTGCTGGCTATTGGGCCGTACTGTCTAATTTTCGTGGCATGCGCACCTATGGCTACGTGCTTTGCAATGGTATTTACCACTCTGGAGTGTACACTTGGCTTGGCCTTTACCTGTCCCAACGCTACGAAATGGATACCCTTAGCATTGGCCTCAATATTCTAGGTTATGGTGTCCCAGGACTGATTTTTAGCCCATTAATCGGTAAAGCAGTGGATCGTTGGGGACGACGCTGGTTAATTCCTCCCGGTTTGGCTATGGCGGCGATCGCCGGTTTGACTATGGTTCCTTTTATTCCCCCCCTCGCCGTTACCATGGCAATTCTGGTCATGTCCCTGGGCTACGACCTGACTCAACCTTTGTTTGTGGGCATTGTGACCGATTTGGCGGAAGAAGATACTTTGGGGCAAACCATGGGGCTAAAGGTGTTTACTTTATTCACCGGCTTTGGGATTGGCAGTTGGTTGTTTGGGGAAGTGCTCCATTGGGGTTTTGAAGTGGCACTGGTGGCTTTTGGCGTCATGCAATTGCTGTCGGCGATCGCCGCCATTCCCCTCTTTTGGAATGAAAAACCCAGCCCCATCAATGTCAGTGCCTGA

Protein

MSEPKPSQPNFSHLEEADYTGRMRQHDRLFGLLAIAAGLIFLQGYMIAPLIPRLAEIFDVSAQEIGFIVPAYMLAYALAALFYGILSDRFGRWPVIQISIIVFITCTALTATAQTAAQMTFWRLLTGLGASGVIPLTFALIGDMFPYNQRGAKLGLVFAAMEGGMAAGSAGGAILEPFLGWQLLFIGTATAPVIVLWRLRRYGALFDAPKATKIPALATVFAGYWAVLSNFRGMRTYGYVLCNGIYHSGVYTWLGLYLSQRYEMDTLSIGLNILGYGVPGLIFSPLIGKAVDRWGRRWLIPPGLAMAAIAGLTMVPFIPPLAVTMAILVMSLGYDLTQPLFVGIVTDLAEEDTLGQTMGLKVFTLFTGFGIGSWLFGEVLHWGFEVALVAFGVMQLLSAIAAIPLFWNEKPSPINVSA