Your browser is old and dusty. Try Google Chrome!

Details for slr0613

ORF slr0613
Accession NP_439901.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -172 -186 4.52282 0.147
NP_441061.1_2 Forward -96 -82 1.86788 0.181
NP_441061.1_2 Reverse -178 -192 0.88457 0.197
NP_441061.1_2 Reverse -297 -311 -0.197071 0.223
NP_440795.1_7 Forward -96 -89 14.6904 0.0123
NP_440795.1_7 Reverse -89 -96 14.6904 0.0123
NP_440795.1_7 Reverse -172 -179 10.2655 0.154
NP_441418.1_6 Forward -97 -78 -19.4701 0.0888
NP_441418.1_6 Reverse -88 -107 -30.2865 0.267
NP_441480.1_2 Reverse -22 -41 15.7324 0.182
NP_442291.1_5 Reverse -87 -103 6.54838 0.0694
NP_441453.1_4 Reverse -88 -96 16.539 0.00633
NP_441453.1_4 Forward -97 -89 16.539 0.00633
NP_441453.1_7 Forward -167 -160 11.6422 0.298
NP_441960.1_3 Reverse -67 -86 13.8918 0.243
NP_442151.1_6 Reverse -177 -191 11.0127 0.109
NP_442151.1_6 Forward -97 -83 9.5377 0.145
NP_442151.1_6 Reverse -88 -102 8.75105 0.164
NP_441818.1_1 Reverse -172 -183 14.7094 0.0449
NP_441818.1_1 Forward -96 -85 9.69459 0.232
NP_440226.1_1 Reverse -88 -107 11.7008 0.0509
NP_441342.1_2 Forward -101 -87 10.226 0.209
NP_440150.1_2 Reverse -173 -192 4.32522 0.281
NP_440150.1_2 Forward -95 -76 4.22689 0.281
NP_442744.1_9 Forward -103 -89 12.1566 0.288
NP_442173.1_1 Forward -96 -88 15.4574 0.00633
NP_442173.1_1 Reverse -89 -97 15.4574 0.00633
NP_442752.1_4 Forward -97 -90 13.8055 0.0199
NP_442752.1_4 Reverse -88 -95 13.8055 0.0199
NP_442752.1_4 Reverse -67 -74 9.47889 0.109
NP_443027.1_4 Reverse -86 -96 14.828 0.0437
NP_441812.1_3 Forward -98 -84 9.14437 0.245
NP_442975.1_10 Reverse -84 -98 22.615 0.000219
NP_442975.1_10 Forward -101 -87 1.47397 0.297
NP_440784.1_7 Forward -96 -89 15.9687 0.0123
NP_440784.1_7 Reverse -89 -96 15.9687 0.0123
NP_442909.1_7 Reverse -89 -103 8.94708 0.161
NP_440061.1_9 Reverse -86 -100 8.25877 0.177
NP_441145.1_1 Reverse -167 -186 6.4893 0.254
NP_441476.1_5 Forward -191 -172 3.53937 0.184
NP_440878.1_9 Reverse -78 -97 4.22769 0.174
NP_442062.1_8 Forward -97 -87 19.4496 0.000558
NP_442062.1_8 Reverse -88 -98 17.3846 0.00193
NP_442062.1_8 Reverse -177 -187 3.12662 0.285
NP_441802.1_1 Forward -112 -93 10.0292 0.197
NP_440304.1_4 Forward -188 -178 14.0414 0.051
NP_440304.1_4 Reverse -86 -96 10.8948 0.051
NP_440304.1_4 Forward -80 -70 2.24165 0.299
NP_440304.1_4 Forward -99 -89 1.84832 0.299
NP_442242.1_4 Forward -96 -89 14.3954 0.0124
NP_442242.1_4 Reverse -89 -96 14.3954 0.0124
NP_440044.1_8 Forward -185 -166 3.6377 0.126
NP_441781.1_7 Reverse -171 -190 5.99764 0.186
NP_441581.1_6 Forward -96 -77 9.58335 0.291
NP_441581.1_10 Reverse -369 -388 11.2092 0.299
NP_442207.1_4 Reverse -72 -91 5.80098 0.285
NP_440916.1_1 Forward -156 -142 12.291 0.206
NP_441619.1_8 Forward -103 -89 7.86545 0.275
NP_441208.1_9 Forward -100 -86 5.40779 0.267
NP_441594.1_6 Reverse -106 -125 4.71934 0.214
NP_441594.1_6 Forward -189 -170 2.94938 0.239
NP_442276.1_2 Reverse -155 -174 3.04771 0.299
NP_442110.1_7 Forward -97 -83 2.85119 0.222
NP_442110.1_7 Reverse -171 -185 2.5562 0.222
NP_441083.1_5 Reverse -88 -98 20.3345 0.00053
NP_441083.1_5 Forward -97 -87 11.3864 0.0159
NP_441083.1_5 Reverse -32 -42 5.38824 0.12
NP_441083.1_5 Forward -340 -330 -0.314959 0.265
NP_441083.1_5 Forward -41 -31 -0.708283 0.276
NP_441738.1_2 Forward -95 -88 15.28 0.0102
NP_441738.1_2 Reverse -90 -97 15.28 0.0102
NP_441558.1_5 Reverse -86 -105 6.98095 0.198
NP_440209.1_1 Reverse -88 -96 18.1123 0.00295
NP_440209.1_1 Forward -97 -89 18.1123 0.00295
NP_440209.1_1 Forward -340 -332 2.1827 0.254
NP_442889.1_1 Reverse -171 -190 -4.13045 0.152
NP_442889.1_8 Reverse -85 -99 22.615 0.00144
NP_441713.1_1 Forward -192 -173 -13.8652 0.257
NP_441770.1_10 Reverse -300 -319 11.6025 0.227
NP_440178.1_7 Reverse -31 -50 -2.85214 0.0423
NP_440178.1_7 Reverse -87 -106 -20.8467 0.201
NP_442570.1_3 Reverse -169 -188 -1.86883 0.212
NP_441716.1_1 Forward -97 -83 6.09611 0.207
NP_441716.1_1 Reverse -331 -345 4.52282 0.255
NP_441716.1_1 Reverse -177 -191 2.65453 0.298
NP_441716.1_2 Forward -153 -134 1.15446 0.255
NP_441327.1_4 Forward -104 -90 17.1092 0.282
NP_441598.1_1 Forward -177 -158 6.88262 0.295
NP_442111.1_4 Forward -98 -84 10.7177 0.0518
NP_442111.1_4 Reverse -176 -190 3.8345 0.229
NP_441624.1_7 Reverse -303 -317 11.111 0.213
NP_441163.1_1 Reverse -80 -97 5.24966 0.277
NP_440906.1_5 Forward -96 -89 15.8704 0.0124
NP_440906.1_5 Reverse -89 -96 15.8704 0.0124
NP_440747.1_10 Forward -100 -88 14.887 0.00223
NP_440747.1_10 Reverse -85 -97 -2.02597 0.0196
NP_440747.1_10 Reverse -328 -340 -2.71429 0.0639
NP_441486.1_1 Reverse -85 -99 22.5174 0.00162
NP_441486.1_1 Forward -100 -86 11.3077 0.0164
NP_441486.1_1 Forward -183 -169 3.8345 0.0534
NP_441486.1_1 Reverse -168 -182 -0.197071 0.15
NP_440403.1_4 Reverse -79 -98 -9.63698 0.279
NP_440842.1_10 Reverse -246 -260 2.06454 0.278
NP_440842.1_10 Forward -285 -271 1.96621 0.281
NP_441014.1_10 Forward -98 -79 4.91521 0.194
NP_442848.1_1 Reverse -82 -96 6.98109 0.0791
NP_442848.1_1 Reverse -171 -185 1.67122 0.216
NP_442848.1_1 Forward -103 -89 -0.787057 0.263
NP_442848.1_1 Forward -186 -172 -3.63866 0.268
NP_442848.1_5 Forward -187 -169 -2.93078 0.289
NP_443018.1_3 Forward -96 -89 14.8871 0.0123
NP_443018.1_3 Reverse -89 -96 14.8871 0.0123
NP_443018.1_3 Reverse -178 -185 10.7572 0.0907
NP_443018.1_3 Forward -185 -178 4.56234 0.241
NP_441634.1_8 Forward -99 -85 5.1128 0.114
NP_441634.1_8 Reverse -372 -386 0.786239 0.217
NP_441634.1_8 Reverse -329 -343 -2.95034 0.295
NP_441182.1_3 Forward -190 -172 12.0155 0.292
NP_440376.1_1 Forward -97 -88 19.4693 0.000692
NP_440376.1_1 Reverse -88 -97 19.4693 0.000692
NP_440376.1_1 Reverse -32 -41 4.32629 0.163
NP_441588.1_4 Reverse -90 -100 15.9097 0.0369
NP_441588.1_4 Forward -95 -85 6.96153 0.178
NP_443065.1_6 Reverse -167 -186 0.786102 0.253
NP_442687.1_7 Reverse -87 -97 15.8113 0.0125
NP_442687.1_7 Forward -341 -331 14.3364 0.0329
NP_442687.1_7 Forward -98 -88 8.92815 0.0994
NP_442191.1_4 Forward -96 -82 15.9379 0.0454
NP_442530.1_2 Reverse -144 -154 14.533 0.203
NP_441422.1_3 Forward -345 -326 14.0324 0.289
NP_441763.1_10 Reverse -77 -96 11.11 0.143
NP_442658.1_1 Reverse -86 -96 15.9091 0.00966
NP_442658.1_1 Forward -188 -178 15.2208 0.0156
NP_442658.1_1 Forward -99 -89 6.76441 0.214
NP_442198.1_7 Reverse -174 -193 8.4551 0.292
NP_441855.2_4 Forward -332 -313 13.3793 0.172
NP_440662.1_7 Forward -274 -255 15.6341 0.187
NP_441414.1_9 Reverse -88 -107 6.19431 0.0416
NP_441487.1_9 Reverse -31 -50 0.982764 0.212
NP_442937.1_5 Forward -102 -83 18.1907 0.0272
NP_441958.1_5 Forward -98 -88 12.2714 0.00183
NP_441958.1_5 Reverse -87 -97 12.2714 0.00183
NP_441958.1_5 Reverse -31 -41 -1.00328 0.227
NP_440203.1_5 Reverse -180 -190 13.6475 0.112
NP_440984.1_7 Forward -102 -88 7.57108 0.166
NP_440984.1_7 Reverse -242 -256 6.09611 0.227
NP_439990.1_5 Reverse -83 -96 10.049 0.128
NP_442376.1_2 Reverse -172 -191 4.22769 0.202
NP_442376.1_2 Forward -345 -326 -3.44213 0.202
NP_442690.1_1 Forward -157 -138 -13.9635 0.268
NP_442911.1_2 Forward -107 -88 7.47261 0.0245
NP_441580.1_6 Reverse -77 -96 -8.55534 0.263
NP_440153.1_5 Reverse -33 -47 1.76955 0.245
NP_440153.1_5 Forward -96 -82 0.786239 0.289
NP_443055.1_6 Forward -105 -87 4.63995 0.181
NP_443055.1_6 Forward -84 -66 1.00172 0.237
NP_440934.1_2 Forward -136 -117 4.62101 0.239
NP_441099.1_5 Forward -196 -177 -10.7186 0.261
NP_442002.1_9 Reverse -87 -94 10.7572 0.185
NP_441294.1_7 Reverse -84 -98 15.9698 0.0176
NP_441646.1_1 Forward -193 -174 2.55606 0.218
NP_441646.1_1 Forward -318 -299 -0.295539 0.26
NP_442438.1_10 Reverse -83 -97 8.25939 0.0795
NP_442438.1_10 Reverse -166 -180 1.96621 0.188
NP_441000.1_6 Forward -98 -84 -3.44199 0.221
NP_441000.1_6 Reverse -87 -101 -5.21195 0.266
NP_440147.1_4 Forward -99 -86 10.049 0.0355
NP_440147.1_4 Reverse -86 -99 3.46087 0.187
NP_440147.1_4 Forward -260 -247 0.510939 0.252
NP_441175.1_7 Reverse -88 -107 7.27595 0.237
NP_441550.1_8 Forward -99 -89 14.6309 0.0132
NP_441550.1_8 Reverse -86 -96 6.0761 0.214
NP_441916.1_7 Forward -97 -87 18.4663 0.00144
NP_441916.1_7 Reverse -88 -98 10.3048 0.0261
NP_441916.1_7 Forward -180 -170 5.09324 0.146
NP_441916.1_10 Forward -188 -169 2.94938 0.236
NP_440206.1_4 Forward -179 -160 -1.27961 0.29
NP_441041.1_1 Forward -192 -173 7.37428 0.267
NP_441041.1_4 Reverse -171 -190 -0.4922 0.0958
NP_441041.1_4 Forward -97 -78 -4.6221 0.14
NP_441041.1_7 Reverse -85 -97 10.916 0.0864
NP_441041.1_7 Forward -51 -39 9.06962 0.124
NP_442396.1_5 Forward -101 -88 12.2123 0.0913
NP_442396.1_5 Forward -328 -315 7.09911 0.215
NP_440569.1_10 Forward -49 -30 6.15881 0.236
NP_440569.1_10 Reverse -137 -156 3.38954 0.278
NP_442004.1_6 Reverse -171 -185 5.21113 0.195
NP_441725.1_5 Reverse -178 -188 14.6313 0.0247
NP_441725.1_5 Forward -96 -86 11.2881 0.0247
NP_441725.1_5 Reverse -332 -342 5.48657 0.115
NP_441725.1_5 Reverse -89 -99 2.04498 0.115
NP_439966.1_7 Reverse -86 -96 18.4657 0.00473
NP_439966.1_7 Forward -99 -89 7.25606 0.15
NP_439966.1_9 Reverse -86 -95 0.983037 0.253
NP_442941.1_3 Forward -96 -86 11.4848 0.0116
NP_442941.1_3 Reverse -89 -99 11.0914 0.0116
NP_442941.1_3 Reverse -172 -182 8.23984 0.0381
NP_442941.1_3 Forward -339 -329 -0.314959 0.256
NP_440289.1_2 Reverse -85 -98 21.3571 0.00262
NP_440289.1_2 Reverse -382 -395 -3.12731 0.265
NP_440260.1_8 Reverse -72 -90 -7.55234 0.295
NP_442281.1_1 Reverse -83 -97 11.602 0.0447
NP_442281.1_1 Forward -102 -88 9.93039 0.0648
NP_442281.1_1 Reverse -277 -291 2.16228 0.276
NP_440177.1_9 Forward -105 -86 14.0608 0.219
NP_442256.1_2 Forward -258 -240 -8.73231 0.235
NP_440437.1_1 Reverse -82 -101 6.88262 0.072
NP_440647.1_9 Forward -251 -233 4.6407 0.236
NP_442012.1_1 Reverse -171 -190 3.44104 0.18
NP_442012.1_5 Forward -318 -299 10.1275 0.252
NP_442982.1_5 Reverse -78 -97 -2.85214 0.289
NP_441644.1_6 Reverse -88 -98 17.3841 0.00127
NP_441644.1_6 Forward -97 -87 10.1076 0.0628
NP_441644.1_6 Reverse -177 -187 7.35439 0.129
NP_442215.1_2 Forward -99 -83 7.63002 0.0678
NP_442215.1_2 Forward -218 -202 -2.39974 0.197
NP_442215.1_2 Reverse -175 -191 -5.34967 0.249
NP_442215.1_2 Reverse -79 -95 -6.03799 0.263
NP_442029.1_6 Forward -102 -83 6.78429 0.233
NP_440253.1_2 Forward -97 -79 11.6222 0.031
NP_440253.1_2 Reverse -88 -106 9.75391 0.0449
NP_440929.1_8 Forward -97 -88 19.2726 0.000701
NP_440929.1_8 Reverse -88 -97 19.2726 0.000701
NP_440929.1_8 Forward -41 -32 3.93297 0.197
NP_442933.1_10 Forward -97 -88 17.601 0.00325
NP_442933.1_10 Reverse -88 -97 17.601 0.00325
NP_441751.2_8 Forward -96 -82 -4.13031 0.163
NP_441751.2_8 Forward -339 -325 -4.91696 0.187
NP_441751.2_8 Reverse -172 -186 -5.11362 0.194
NP_441751.2_8 Reverse -178 -192 -5.70361 0.231
NP_442926.1_5 Reverse -166 -185 10.0761 0.264
NP_442554.1_8 Reverse -89 -99 15.3197 0.00882
NP_442554.1_8 Forward -96 -86 13.8447 0.0145
NP_442554.1_8 Reverse -178 -188 6.66654 0.111
NP_441762.1_7 Reverse -87 -99 9.57708 0.0142
NP_441762.1_7 Forward -98 -86 2.89058 0.0676
NP_441762.1_7 Forward -187 -175 -6.15587 0.276
NP_442142.1_1 Forward -284 -265 12.1925 0.259
NP_442142.1_4 Reverse -85 -98 15.85 0.0264
NP_442142.1_4 Forward -100 -87 5.52525 0.188
NP_442292.1_1 Reverse -89 -98 18.486 0.00229
NP_442292.1_1 Forward -96 -87 9.63616 0.0183
NP_442292.1_1 Reverse -172 -181 -0.295266 0.24
NP_440919.1_1 Reverse -110 -129 -8.06369 0.286
NP_442476.1_9 Reverse -193 -212 12.9791 0.297
NP_440895.1_6 Reverse -325 -338 10.934 0.202
NP_442381.1_8 Reverse -85 -104 -6.39206 0.16
NP_441711.1_4 Forward -106 -87 3.53937 0.241
NP_443009.1_5 Forward -98 -87 18.3477 0.00265
NP_443009.1_5 Forward -181 -170 6.35136 0.165
NP_441715.1_4 Forward -96 -86 16.303 0.0117
NP_441715.1_4 Reverse -89 -99 7.94484 0.107
NP_441198.1_5 Reverse -90 -103 13.3917 0.206
NP_441198.1_8 Forward -188 -178 13.2713 0.108
NP_440379.1_5 Forward -195 -176 -9.93197 0.27
NP_440464.1_10 Reverse -89 -99 13.0082 0.169
NP_441468.1_1 Forward -96 -89 15.8704 0.0124
NP_441468.1_1 Reverse -89 -96 15.8704 0.0124
NP_441468.1_1 Forward -185 -178 4.07068 0.263
NP_441020.2_6 Reverse -86 -103 7.70866 0.222
NP_441673.1_1 Forward -97 -88 20.8459 0.000698
NP_441673.1_1 Reverse -88 -97 20.8459 0.000698
NP_441673.1_1 Reverse -249 -258 -8.06341 0.254
NP_441673.1_1 Reverse -171 -180 -8.06341 0.254
NP_441731.1_3 Reverse -323 -342 -6.68705 0.296
NP_440265.1_4 Reverse -166 -185 20.0738 0.287
NP_441826.1_2 Reverse -82 -96 11.6026 0.0356
NP_441826.1_2 Reverse -171 -185 6.09611 0.0946
NP_441826.1_2 Reverse -109 -123 1.86788 0.14
NP_441826.1_2 Forward -346 -332 -2.06536 0.264
NP_441826.1_2 Forward -192 -178 -3.63866 0.286
NP_441826.1_2 Forward -186 -172 -3.83532 0.288
NP_441826.1_5 Forward -323 -304 8.06259 0.221
NP_441637.1_9 Reverse -217 -235 -3.42244 0.296
NP_441764.1_8 Forward -160 -150 12.1721 0.284
NP_441764.1_8 Forward -110 -100 11.1193 0.287
NP_442868.1_6 Forward -99 -89 9.81313 0.038
NP_442868.1_6 Forward -182 -172 7.55152 0.0746
NP_442868.1_6 Forward -188 -178 3.81494 0.192
NP_442868.1_6 Forward -342 -332 3.42162 0.199
NP_442868.1_6 Forward -132 -122 2.63497 0.205
NP_442868.1_6 Reverse -86 -96 0.963343 0.205
NP_442868.1_6 Reverse -329 -339 -0.314959 0.284
NP_441056.1_1 Reverse -171 -190 -5.80207 0.265
NP_441612.1_2 Reverse -88 -98 8.54929 0.21
NP_442559.1_3 Reverse -105 -124 8.84924 0.285
NP_442427.1_8 Forward -106 -87 7.37428 0.215
NP_442427.1_8 Forward -139 -120 5.30933 0.27
NP_442808.1_1 Reverse -87 -97 18.4657 0.00201
NP_442808.1_1 Forward -98 -88 8.63269 0.0481
NP_442808.1_1 Forward -384 -374 3.12618 0.248
NP_441101.1_10 Reverse -327 -346 1.86774 0.173
NP_440145.1_3 Reverse -71 -90 -4.22878 0.226
NP_442542.1_2 Forward -188 -175 8.67241 0.152
NP_442542.1_2 Forward -313 -300 8.08242 0.163
NP_442542.1_2 Reverse -113 -126 6.1158 0.234
NP_442542.1_2 Forward -342 -329 5.72248 0.253
NP_442050.1_5 Reverse -86 -96 9.12434 0.193
NP_442050.1_5 Forward -99 -89 7.64939 0.243
NP_442342.1_9 Forward -70 -54 2.02515 0.294
NP_440342.1_2 Forward -180 -161 8.35759 0.28
NP_441114.1_3 Reverse -179 -188 7.57121 0.231
NP_440558.1_2 Forward -189 -170 8.25926 0.113
NP_440558.1_2 Reverse -174 -193 5.89931 0.137
NP_440558.1_2 Reverse -293 -312 -0.885524 0.205
NP_440558.1_2 Forward -309 -290 -7.27704 0.291
NP_441878.1_6 Forward -98 -88 10.4031 0.0176
NP_441878.1_6 Reverse -87 -97 10.4031 0.0176
NP_441878.1_6 Forward -187 -177 2.33998 0.0405
NP_441878.1_6 Forward -118 -108 -0.0199663 0.163
NP_441878.1_6 Forward -259 -249 -0.118297 0.167
NP_441036.1_8 Reverse -87 -97 17.7779 0.000554
NP_441036.1_8 Reverse -170 -180 15.2213 0.0116
NP_441036.1_8 Forward -98 -88 8.33817 0.174
NP_442650.1_2 Forward -130 -116 2.45787 0.271
NP_441557.1_5 Forward -97 -88 19.9609 0.000699
NP_441557.1_5 Reverse -88 -97 19.9609 0.000699
NP_441557.1_5 Forward -180 -171 -0.68859 0.229
NP_441445.1_1 Reverse -322 -341 2.3594 0.235
NP_441445.1_1 Reverse -168 -187 2.26107 0.238
NP_441445.1_1 Reverse -293 -312 -0.4922 0.294
NP_442066.2_4 Reverse -177 -196 4.12936 0.11
NP_442066.2_4 Forward -124 -105 -0.0988766 0.172
NP_441308.1_8 Reverse -86 -96 10.1081 0.22
NP_440101.1_3 Reverse -166 -185 2.85105 0.244
NP_440101.1_10 Reverse -171 -190 2.85105 0.245
NP_441458.1_10 Reverse -79 -98 5.40766 0.216
NP_442183.1_1 Forward -97 -83 11.996 0.0648
NP_442183.1_1 Reverse -88 -102 8.25939 0.119
NP_442397.1_9 Reverse -171 -190 9.53756 0.246
NP_440595.1_8 Reverse -247 -266 9.53756 0.271
NP_440595.1_8 Reverse -69 -88 8.55425 0.286
NP_442347.1_2 Reverse -89 -98 12.4878 0.056
NP_442347.1_2 Forward -96 -87 11.1111 0.056
NP_442645.1_2 Forward -105 -86 -3.04881 0.0487
NP_442645.1_2 Forward -188 -169 -8.35868 0.126
NP_442645.1_2 Reverse -169 -188 -16.4218 0.233
NP_442645.1_2 Reverse -294 -313 -17.6018 0.259
NP_441037.1_4 Forward -188 -178 7.9999 0.237
NP_441037.1_4 Forward -99 -89 7.9999 0.237
NP_441037.1_4 Reverse -86 -96 7.02532 0.237
NP_440563.1_4 Forward -90 -77 18.4072 0.181
NP_441633.1_3 Forward -99 -86 8.47575 0.0377
NP_441633.1_3 Reverse -86 -99 -3.71729 0.177
NP_441633.1_3 Reverse -265 -278 -5.58558 0.236
NP_441633.1_3 Reverse -329 -342 -6.66722 0.265
NP_440136.1_2 Forward -96 -89 15.9687 0.0123
NP_440136.1_2 Reverse -89 -96 15.9687 0.0123
NP_440136.1_2 Reverse -172 -179 4.26735 0.218
NP_442590.1_10 Reverse -171 -190 5.80098 0.258
NP_442998.1_5 Reverse -144 -154 8.53483 0.261
NP_442998.1_10 Forward -95 -88 15.5754 0.0102
NP_442998.1_10 Reverse -90 -97 15.5754 0.0102
NP_440299.1_1 Forward -101 -88 13.0967 0.0319
NP_440299.1_1 Reverse -84 -97 11.9167 0.0427
NP_441799.1_1 Forward -101 -87 16.1252 0.0153
NP_440640.1_6 Reverse -54 -73 5.99764 0.202
NP_442334.1_2 Forward -196 -179 -6.746 0.264
NP_440256.1_1 Forward -100 -81 0.786102 0.0805
NP_441957.1_1 Forward -194 -175 9.63589 0.175
NP_441559.1_8 Reverse -83 -97 3.24451 0.143
NP_441559.1_8 Reverse -173 -187 -7.2769 0.289
NP_441559.1_8 Forward -191 -177 -7.76856 0.299
NP_440915.1_6 Reverse -84 -98 6.3911 0.0826
NP_440915.1_6 Forward -315 -301 5.1128 0.0935
NP_440915.1_6 Forward -190 -176 3.24451 0.104
NP_440915.1_6 Reverse -63 -77 -0.492064 0.197
NP_440717.1_3 Forward -73 -59 17.4035 0.17
NP_442866.1_1 Reverse -172 -191 -0.4922 0.193
NP_440748.1_5 Forward -381 -362 -2.16383 0.271
NP_441464.1_8 Reverse -88 -102 3.93283 0.283
NP_440787.1_5 Forward -105 -91 12.0943 0.256
NP_442993.1_1 Forward -97 -81 11.4649 0.0141
NP_442386.1_9 Reverse -87 -96 15.7322 0.0144
NP_442386.1_9 Forward -98 -89 13.8639 0.0289
NP_442386.1_9 Reverse -295 -304 6.39082 0.219
NP_442386.1_9 Reverse -170 -179 5.70251 0.241
NP_442386.1_9 Reverse -176 -185 4.81753 0.282
NP_441340.1_5 Forward -96 -89 15.6737 0.0124
NP_441340.1_5 Reverse -89 -96 15.6737 0.0124
NP_441340.1_5 Reverse -178 -185 3.97235 0.274
NP_441340.1_9 Forward -109 -99 7.48397 0.256
NP_441947.1_10 Reverse -175 -193 -0.374176 0.276
NP_442791.1_5 Reverse -170 -189 3.24438 0.21
NP_441248.1_10 Forward -106 -96 14.6181 0.282
NP_440161.1_3 Reverse -230 -249 7.37428 0.299
NP_440586.1_8 Forward -96 -89 13.2151 0.026
NP_440586.1_8 Reverse -89 -96 13.2151 0.026
NP_442251.1_6 Forward -96 -89 15.2804 0.0124
NP_442251.1_6 Reverse -89 -96 15.2804 0.0124
NP_442251.1_6 Reverse -332 -339 8.69224 0.199
NP_440684.1_9 Forward -103 -89 11.8976 0.168
NP_441262.1_3 Reverse -88 -95 14.7888 0.0223
NP_441262.1_3 Forward -97 -90 14.7888 0.0223
NP_440027.1_3 Forward -186 -168 7.09821 0.214
NP_440027.1_3 Reverse -78 -96 1.69003 0.299
NP_443051.1_1 Reverse -87 -96 10.4228 0.00754
NP_443051.1_1 Forward -98 -89 10.4228 0.00754
NP_439984.1_3 Forward -104 -90 14.0603 0.202
NP_439937.1_9 Reverse -176 -193 -11.8598 0.267
NP_441595.1_3 Forward -315 -305 17.2863 0.202
NP_440408.1_7 Reverse -247 -266 6.98095 0.295
NP_440439.1_1 Reverse -85 -98 1.19926 0.159
NP_439943.1_1 Forward -90 -71 -12.2919 0.296
NP_440372.1_2 Forward -96 -89 16.3621 0.0124
NP_440372.1_2 Reverse -89 -96 16.3621 0.0124
NP_440316.1_10 Forward -187 -177 16.6963 0.153
NP_440316.1_10 Reverse -58 -68 7.15819 0.251
NP_441803.1_2 Forward -102 -83 1.96607 0.222
NP_439977.1_5 Reverse -171 -190 3.24438 0.16
NP_442384.1_10 Reverse -88 -101 8.77074 0.0608
NP_442384.1_10 Forward -97 -84 8.37742 0.0656
NP_441018.1_7 Reverse -167 -186 6.29264 0.294
NP_442262.1_10 Forward -96 -89 14.1988 0.0123
NP_442262.1_10 Reverse -89 -96 14.1988 0.0123
NP_442262.1_10 Reverse -178 -185 9.87221 0.164
NP_441689.1_5 Reverse -86 -96 8.53436 0.132
NP_441689.1_5 Forward -99 -89 5.78111 0.197
NP_442244.1_6 Reverse -171 -190 -1.08219 0.291
NP_440163.1_10 Reverse -85 -95 15.2213 0.0762
NP_440344.1_10 Reverse -81 -98 12.9202 0.006
NP_440344.1_10 Forward -138 -121 -13.5308 0.287
NP_440282.1_2 Forward -90 -71 16.5191 0.0769
NP_440531.1_8 Reverse -73 -92 2.45773 0.298
NP_441335.1_4 Forward -316 -297 9.93088 0.26
NP_441965.1_3 Reverse -327 -346 -1.27885 0.283
NP_441965.1_10 Forward -259 -243 7.43336 0.148
NP_441965.1_10 Reverse -85 -101 2.41848 0.288
NP_441640.1_8 Forward -96 -77 11.2092 0.0852
NP_440297.1_9 Forward -96 -86 9.32148 0.0917
NP_440297.1_9 Reverse -178 -188 7.25653 0.136
NP_440297.1_9 Reverse -89 -99 -0.118297 0.282
NP_441896.1_3 Reverse -79 -98 1.37609 0.217
NP_441896.1_3 Forward -285 -266 0.491109 0.225
NP_440999.1_9 Reverse -84 -98 14.1593 0.0277
NP_440888.1_2 Forward -97 -83 18.1901 0.00261
NP_440888.1_2 Reverse -302 -316 10.8154 0.0842
NP_440888.1_2 Reverse -88 -102 8.06211 0.172
NP_440888.1_2 Forward -305 -291 7.66879 0.186
NP_440888.1_2 Reverse -171 -185 5.50552 0.276
NP_440600.1_4 Forward -105 -87 -7.35568 0.291
NP_441748.1_3 Forward -264 -245 13.193 0.247
NP_442033.1_10 Reverse -175 -194 -0.295539 0.118
NP_442033.1_10 Forward -385 -366 -8.752 0.206
NP_442033.1_10 Reverse -76 -95 -11.5053 0.254
NP_442077.1_9 Reverse -143 -162 3.53937 0.141
NP_441917.1_1 Forward -222 -203 12.3892 0.134
NP_441543.1_2 Forward -96 -87 18.486 0.00236
NP_441543.1_2 Reverse -89 -98 16.9127 0.00359
NP_441543.1_3 Forward -77 -63 8.94708 0.239
NP_442845.1_2 Forward -186 -172 5.30946 0.237
NP_442845.1_2 Forward -103 -89 3.24451 0.298
NP_441834.1_10 Forward -96 -77 4.12936 0.26
NP_441551.1_5 Reverse -173 -189 7.62932 0.243
NP_441918.1_7 Reverse -87 -106 5.99764 0.262
NP_441469.1_8 Reverse -87 -96 16.126 0.00797
NP_441469.1_8 Forward -187 -178 9.63616 0.227
NP_441469.1_8 Forward -131 -122 8.75118 0.227
NP_441469.1_8 Forward -98 -89 6.48957 0.227
NP_443064.1_6 Reverse -88 -98 12.5669 0.0796
NP_443064.1_9 Reverse -261 -280 14.9458 0.266
NP_442578.1_7 Forward -96 -89 14.5921 0.026
NP_442578.1_7 Reverse -89 -96 14.5921 0.026
NP_442286.1_1 Reverse -88 -107 10.4225 0.214
NP_441462.1_2 Forward -97 -87 11.5831 0.00406
NP_441462.1_2 Reverse -88 -98 11.5831 0.00406
NP_441462.1_2 Forward -180 -170 -0.708283 0.245
NP_441621.1_7 Reverse -175 -189 -4.22864 0.214
NP_443062.1_6 Forward -105 -86 1.67108 0.271
NP_440349.1_3 Forward -96 -77 16.7149 0.155
NP_442204.1_1 Reverse -84 -95 0.353664 0.281
NP_442204.1_5 Reverse -78 -97 6.68596 0.142
NP_440544.1_5 Reverse -153 -160 13.8024 0.28
NP_440516.1_2 Reverse -82 -100 2.0841 0.18
NP_440516.1_8 Forward -97 -88 16.9127 0.00442
NP_440516.1_8 Reverse -88 -97 16.9127 0.00442
NP_440516.1_8 Reverse -331 -340 -0.295266 0.232
NP_440516.1_8 Forward -186 -177 -0.491928 0.262
NP_441785.1_1 Forward -97 -83 14.9684 0.148
NP_442846.1_2 Reverse -168 -187 3.44104 0.264
NP_442428.1_5 Forward -96 -89 15.8704 0.0124
NP_442428.1_5 Reverse -89 -96 15.8704 0.0124
NP_442428.1_5 Forward -185 -178 4.46401 0.267
NP_441443.1_1 Reverse -65 -84 11.7992 0.0707
NP_440673.1_2 Reverse -167 -186 9.90183 0.228
NP_440673.1_3 Forward -95 -88 12.4288 0.0426
NP_440673.1_3 Reverse -90 -97 12.4288 0.0426
NP_440673.1_3 Reverse -333 -340 10.4622 0.139
NP_440673.1_3 Forward -260 -253 8.98723 0.203
NP_440673.1_3 Reverse -179 -186 8.98723 0.203
NP_440673.1_7 Forward -191 -172 4.03102 0.189
NP_441052.1_2 Reverse -88 -98 19.9412 0.00106
NP_441052.1_2 Forward -97 -87 10.5014 0.0285
NP_441052.1_2 Forward -256 -246 5.87989 0.0998
NP_441052.1_2 Forward -340 -330 1.455 0.244
NP_442219.1_8 Reverse -71 -90 16.9607 0.0758
NP_442219.1_9 Reverse -89 -98 17.7976 0.00718
NP_442219.1_9 Forward -96 -87 8.35786 0.0681
NP_440592.1_2 Forward -228 -209 1.27776 0.271
NP_440436.1_4 Forward -96 -87 18.1905 0.00233
NP_440436.1_4 Reverse -89 -98 17.2072 0.00233
NP_440436.1_4 Reverse -178 -187 9.73406 0.0871
NP_440436.1_4 Forward -339 -330 4.42421 0.265
NP_440436.1_4 Forward -179 -170 4.42421 0.265
NP_441884.1_9 Forward -345 -326 -20.8467 0.211
NP_441884.1_9 Forward -259 -240 -21.1417 0.229
NP_441884.1_9 Forward -189 -170 -22.125 0.275
NP_441884.1_9 Reverse -85 -104 -24.19 0.284
NP_442907.1_9 Forward -186 -167 3.6377 0.171
NP_441719.1_2 Forward -100 -86 13.2523 0.286
NP_441719.1_4 Forward -96 -89 16.3621 0.0124
NP_441719.1_4 Reverse -89 -96 16.3621 0.0124
NP_441733.1_10 Forward -100 -87 7.09911 0.156
NP_441004.1_1 Reverse -76 -95 -8.55534 0.2
NP_441004.1_1 Forward -192 -173 -14.4552 0.268
NP_441004.1_1 Reverse -368 -387 -14.7502 0.27
NP_441004.1_2 Reverse -342 -361 2.85105 0.212
NP_441004.1_2 Reverse -71 -90 -0.4922 0.259
NP_441004.1_4 Forward -189 -179 10.2065 0.254
NP_441004.1_5 Reverse -370 -384 9.73436 0.248
NP_442366.1_3 Forward -98 -80 7.09898 0.0766
NP_442366.1_3 Reverse -87 -105 -5.09406 0.281
NP_442366.1_5 Forward -100 -90 15.4175 0.0374
NP_441437.1_1 Reverse -178 -197 9.14423 0.264
NP_442873.1_3 Reverse -176 -195 5.2102 0.261
NP_440296.1_1 Forward -318 -299 9.0459 0.29
NP_440296.1_4 Forward -372 -353 16.2148 0.243
NP_442854.1_6 Forward -186 -167 2.0644 0.279
NP_443054.1_2 Forward -133 -119 4.22782 0.24
NP_443054.1_2 Forward -99 -85 3.24451 0.24
NP_443054.1_2 Reverse -300 -314 2.2612 0.245
NP_443054.1_2 Reverse -86 -100 1.86788 0.245
NP_443054.1_2 Forward -126 -112 -0.492064 0.295
NP_440864.1_9 Reverse -49 -68 -5.99873 0.252
NP_441851.1_10 Reverse -87 -97 16.008 0.00552
NP_441851.1_10 Forward -98 -88 15.8113 0.00552
NP_441851.1_10 Forward -181 -171 5.78156 0.2
NP_442208.1_5 Reverse -67 -86 -6.78538 0.269
NP_442011.1_1 Reverse -330 -349 -0.590531 0.268
NP_441668.1_4 Forward -107 -88 19.764 0.0435
NP_442515.1_1 Reverse -87 -101 3.34284 0.12
NP_442515.1_1 Reverse -272 -286 1.57289 0.155
NP_442515.1_1 Forward -259 -245 -3.04867 0.285
NP_442515.1_1 Forward -98 -84 -4.91696 0.298
NP_441396.1_5 Forward -286 -277 8.25953 0.224
NP_440593.1_3 Reverse -179 -198 0.982764 0.19
NP_440593.1_3 Reverse -172 -191 -3.54046 0.236
NP_440463.1_8 Reverse -231 -250 7.40308 0.264
NP_441349.1_10 Reverse -78 -97 -5.21209 0.194
NP_441349.1_10 Forward -107 -88 -6.98204 0.239
NP_441349.1_10 Forward -88 -69 -9.24366 0.287
NP_441409.1_6 Reverse -82 -101 -15.0452 0.275
NP_440432.1_9 Reverse -89 -104 6.17475 0.0477
NP_439960.1_6 Reverse -296 -315 9.0459 0.245
NP_442944.1_9 Reverse -322 -341 15.4374 0.266
NP_441596.1_1 Reverse -87 -106 11.5042 0.294
NP_441124.1_5 Reverse -144 -154 12.4352 0.221
NP_442450.1_5 Reverse -86 -96 9.32148 0.115
NP_442450.1_5 Forward -99 -89 7.55152 0.13
NP_440588.1_2 Reverse -79 -98 -1.18052 0.155
NP_439950.1_1 Reverse -5 -14 12.2911 0.287
NP_440195.1_4 Reverse -76 -95 8.55425 0.207
NP_440040.1_3 Reverse -141 -151 18.3679 0.201
NP_442006.1_2 Reverse -159 -176 -17.2674 0.271
NP_442006.1_3 Forward -192 -174 -7.06068 0.298
NP_440483.1_1 Forward -354 -335 -2.36049 0.208
NP_442243.1_1 Forward -169 -151 2.08335 0.204
NP_441570.1_1 Forward -186 -168 -8.14232 0.104
NP_441570.1_1 Forward -97 -79 -16.2055 0.24
NP_441570.1_1 Reverse -88 -106 -16.6971 0.252
NP_441078.1_4 Forward -97 -88 19.6659 0.0007
NP_441078.1_4 Reverse -88 -97 19.6659 0.0007
NP_441078.1_4 Forward -186 -177 -1.57357 0.266
NP_442729.1_8 Reverse -84 -97 8.18076 0.125
NP_441539.1_1 Forward -158 -144 13.5686 0.284
NP_440526.1_3 Reverse -178 -189 8.61296 0.118
NP_440526.1_3 Forward -339 -328 4.58141 0.267
NP_440526.1_3 Forward -96 -85 1.92649 0.267
NP_440526.1_3 Reverse -89 -100 1.04151 0.267
NP_441432.1_8 Forward -98 -89 16.8143 0.00595
NP_441432.1_8 Reverse -87 -96 8.25953 0.0755
NP_441432.1_8 Forward -187 -178 6.5879 0.112
NP_442320.1_8 Reverse -82 -96 6.29277 0.029
NP_442320.1_8 Forward -103 -89 3.73617 0.0578
NP_442320.1_8 Forward -186 -172 -5.11362 0.206
NP_441732.1_2 Reverse -84 -100 -6.7263 0.0495
NP_441732.1_2 Forward -190 -174 -15.0844 0.145
NP_441732.1_2 Reverse -243 -259 -16.5594 0.174
NP_440313.1_1 Forward -119 -100 17.699 0.162
NP_442003.1_4 Forward -96 -77 9.3409 0.3
NP_440760.1_1 Reverse -88 -107 -13.1769 0.0989
NP_440760.1_1 Forward -258 -239 -22.8133 0.271
NP_442797.1_7 Reverse -170 -188 -1.65248 0.299
NP_440199.1_10 Reverse -85 -95 14.533 0.0861
NP_441945.1_10 Reverse -231 -250 7.96426 0.282
NP_442353.1_4 Reverse -82 -101 5.70185 0.183
NP_440713.1_3 Forward -246 -227 0.982764 0.28
NP_440713.1_6 Forward -230 -211 18.6823 0.0334
NP_442489.1_7 Forward -97 -88 20.1576 0.000695
NP_442489.1_7 Reverse -88 -97 20.1576 0.000695
NP_442489.1_7 Forward -186 -177 -1.57357 0.213
NP_442489.1_7 Reverse -331 -340 -1.6719 0.235
NP_442489.1_7 Forward -258 -249 -2.06522 0.288
NP_442489.1_7 Reverse -177 -186 -2.06522 0.288
NP_440559.1_1 Reverse -89 -98 17.4043 0.00658
NP_440559.1_1 Forward -96 -87 8.75118 0.0586
NP_440559.1_1 Forward -339 -330 4.71961 0.217
NP_441659.2_8 Reverse -88 -98 18.1713 0.00133
NP_441659.2_8 Forward -97 -87 11.9764 0.0147
NP_441022.1_1 Reverse -147 -156 15.9587 0.163
NP_441022.1_1 Forward -106 -97 11.0666 0.284
NP_441040.1_2 Forward -99 -80 -5.80207 0.181
NP_441040.1_2 Reverse -169 -188 -16.2252 0.294
NP_442776.1_1 Forward -74 -55 4.12936 0.278
NP_440779.1_5 Forward -176 -159 -5.95935 0.157
NP_442346.1_5 Forward -98 -88 16.6963 0.00248
NP_442346.1_5 Forward -341 -331 10.0098 0.11
NP_442346.1_5 Reverse -87 -97 9.02648 0.118
NP_442346.1_5 Forward -187 -177 5.97822 0.219
NP_440545.1_3 Reverse -173 -190 6.13536 0.0568
NP_440545.1_3 Forward -101 -84 0.727158 0.133
NP_440545.1_3 Forward -190 -173 -2.71443 0.191
NP_440545.1_3 Reverse -65 -82 -5.56602 0.253
NP_440831.1_3 Reverse -240 -259 9.29946 0.202
NP_440459.1_8 Forward -94 -76 9.85225 0.258
NP_441653.1_2 Reverse -320 -339 10.8738 0.119
NP_440010.1_10 Reverse -328 -347 3.73603 0.25
NP_442551.1_4 Reverse -175 -190 -2.18338 0.256
NP_441888.1_7 Reverse -83 -97 2.5562 0.225
NP_441833.1_4 Forward -96 -89 15.9687 0.0124
NP_441833.1_4 Reverse -89 -96 15.9687 0.0124
NP_442162.1_9 Forward -96 -89 16.2637 0.0124
NP_442162.1_9 Reverse -89 -96 16.2637 0.0124
NP_440671.1_4 Reverse -82 -96 17.2075 0.0227
NP_440671.1_4 Forward -186 -172 6.48943 0.245
NP_442045.1_5 Forward -189 -170 5.70265 0.205
NP_442140.1_3 Reverse -89 -99 12.2714 0.0632
NP_442140.1_3 Forward -96 -86 8.33817 0.119
NP_442140.1_3 Forward -185 -175 4.69992 0.238
NP_440875.1_9 Forward -95 -85 8.37203 0.233
NP_441813.1_5 Reverse -86 -96 17.188 0.00979
NP_441813.1_5 Forward -99 -89 8.63316 0.0367
NP_440594.1_6 Forward -389 -370 8.35677 0.233
NP_439901.1_3 Forward -162 -143 17.9384 0.131
NP_440590.1_4 Forward -96 -83 15.0639 0.0106
NP_440590.1_4 Reverse -172 -185 1.69091 0.115
NP_440590.1_4 Reverse -89 -102 0.707601 0.144
NP_440567.1_1 Reverse -332 -346 0.0979218 0.256
NP_440567.1_1 Forward -179 -165 -0.295402 0.276
NP_442497.1_10 Forward -96 -87 10.4228 0.0087
NP_442497.1_10 Reverse -89 -98 10.4228 0.0087
NP_442497.1_10 Reverse -178 -187 0.196389 0.208
NP_440821.1_4 Reverse -86 -96 19.0562 0.00399
NP_440821.1_4 Forward -99 -89 9.41981 0.0286
NP_440821.1_4 Forward -188 -178 0.0783647 0.205
NP_441239.1_9 Reverse -86 -98 13.3137 0.037
NP_441239.1_9 Forward -99 -87 5.93884 0.202
NP_440706.1_1 Forward -101 -82 -4.42544 0.262
NP_440665.1_1 Forward -359 -340 -15.9302 0.275
NP_442105.1_9 Forward -250 -236 19.5939 0.0752
NP_442270.1_9 Reverse -77 -96 -0.0988766 0.142
NP_441017.1_6 Reverse -84 -98 16.4202 0.0651
NP_441617.1_6 Forward -104 -85 -2.75381 0.258
NP_442052.1_8 Reverse -80 -90 13.648 0.253
NP_442052.1_8 Forward -188 -178 12.7631 0.253
NP_440546.1_4 Forward -97 -87 11.8882 0.0679
NP_440546.1_4 Reverse -88 -98 10.046 0.109
NP_440462.1_6 Reverse -86 -96 15.418 0.0142
NP_440462.1_6 Forward -99 -89 1.35667 0.294
NP_441184.1_3 Reverse -169 -188 2.16274 0.296
NP_440868.1_4 Forward -101 -89 5.84051 0.0879
NP_440868.1_4 Reverse -84 -96 1.7106 0.174
NP_442402.1_4 Forward -264 -245 4.32522 0.147
NP_442402.1_10 Forward -255 -245 14.3359 0.18
NP_440696.1_3 Reverse -167 -185 8.86894 0.15
NP_442039.1_4 Forward -96 -89 15.1821 0.0124
NP_442039.1_4 Reverse -89 -96 15.1821 0.0124
NP_442039.1_7 Forward -115 -105 15.3197 0.211
NP_442039.1_7 Forward -184 -174 13.2547 0.211
NP_441811.1_1 Forward -257 -238 7.17762 0.28
NP_442679.1_1 Forward -64 -45 3.53937 0.147
NP_440825.1_7 Reverse -89 -99 12.9096 0.152
NP_442837.1_3 Forward -96 -89 15.7721 0.0124
NP_442837.1_3 Reverse -89 -96 15.7721 0.0124
NP_442053.1_1 Forward -97 -88 18.3876 0.0007
NP_442053.1_1 Reverse -88 -97 18.3876 0.0007
NP_442053.1_1 Forward -41 -32 4.0313 0.27
NP_440505.1_3 Reverse -86 -96 13.8447 0.0247
NP_440505.1_3 Forward -99 -89 9.22315 0.122
NP_440505.1_3 Reverse -329 -339 5.5849 0.222
NP_441252.1_6 Reverse -36 -43 11.6422 0.288
NP_441203.1_1 Forward -96 -77 -19.9617 0.297
NP_440914.1_1 Reverse -88 -98 17.5935 0.000537
NP_440914.1_1 Forward -186 -176 13.2019 0.0378
NP_440914.1_1 Forward -97 -87 8.6151 0.186
NP_440914.1_1 Reverse -296 -306 7.24882 0.242
NP_441011.1_8 Forward -96 -87 16.9127 0.00602
NP_441011.1_8 Reverse -89 -98 8.25953 0.144
NP_441011.1_8 Forward -179 -170 5.21127 0.278
NP_442533.1_6 Forward -97 -88 17.2076 0.00137
NP_442533.1_6 Reverse -88 -97 17.2076 0.00137
NP_442533.1_6 Forward -180 -171 5.11294 0.155
NP_442541.1_10 Forward -186 -172 2.35894 0.262
NP_442232.1_3 Reverse -169 -188 -9.34199 0.25
NP_442229.1_1 Forward -99 -85 8.25877 0.184
NP_442535.1_9 Reverse -79 -97 5.42735 0.159
NP_441482.1_7 Reverse -82 -96 0.786239 0.0554
NP_441482.1_7 Forward -103 -89 -3.04867 0.106
NP_439944.1_9 Reverse -89 -99 10.5014 0.0887
NP_439944.1_9 Forward -96 -86 10.3048 0.0887
NP_441028.1_6 Forward -73 -63 4.01116 0.278
NP_440116.1_8 Forward -96 -77 0.58944 0.0958
NP_441527.1_7 Reverse -37 -56 11.7983 0.282
NP_440115.1_6 Forward -189 -179 7.45319 0.147
NP_440115.1_6 Forward -343 -333 6.96153 0.166
NP_440007.1_9 Reverse -84 -98 4.03116 0.267
NP_440007.1_9 Forward -190 -176 2.45787 0.281
NP_440007.1_9 Reverse -305 -319 0.392915 0.298
NP_441961.1_4 Reverse -169 -188 4.42435 0.276
NP_441972.1_5 Forward -185 -166 -3.24547 0.199
NP_441972.1_5 Forward -257 -238 -4.81876 0.211
NP_441106.1_1 Reverse -87 -96 18.191 0.0028
NP_441106.1_1 Forward -98 -89 9.63616 0.0311
NP_441286.1_1 Forward -98 -86 14.4936 0.00418
NP_441286.1_1 Reverse -330 -342 3.67722 0.0467
NP_441286.1_1 Reverse -87 -99 3.38223 0.0467
NP_441286.1_1 Reverse -176 -188 -4.68091 0.168
NP_441286.1_1 Forward -42 -30 -5.17256 0.192
NP_440670.1_8 Forward -97 -88 18.3876 0.000699
NP_440670.1_8 Reverse -88 -97 18.3876 0.000699
NP_440670.1_8 Reverse -331 -340 3.93297 0.212
NP_440670.1_8 Forward -41 -32 3.14632 0.296
NP_441930.1_2 Forward -187 -177 13.5497 0.24
NP_441930.1_2 Forward -312 -302 11.1898 0.298
NP_440886.1_4 Reverse -73 -92 14.5524 0.228
NP_440886.1_7 Reverse -87 -97 17.7774 0.0011
NP_440886.1_7 Forward -98 -88 7.94438 0.0805
NP_442072.1_9 Forward -98 -80 -15.3205 0.177
NP_442072.1_9 Reverse -87 -105 -22.2037 0.225
NP_442213.1_6 Reverse -366 -385 6.19431 0.265
NP_441753.1_10 Forward -349 -330 4.32602 0.198
NP_442963.1_3 Reverse -335 -353 13.2938 0.273
NP_440907.2_8 Forward -96 -86 7.84605 0.117
NP_440907.2_8 Reverse -89 -99 7.64939 0.117
NP_442264.1_2 Forward -196 -179 6.23369 0.265
NP_441626.1_2 Forward -96 -89 15.7721 0.0124
NP_441626.1_2 Reverse -89 -96 15.7721 0.0124
NP_442794.1_1 Forward -101 -89 9.38042 0.0795
NP_442615.1_1 Reverse -79 -97 1.59244 0.0829
NP_442615.1_1 Forward -106 -88 -2.53746 0.145
NP_441962.1_4 Reverse -172 -191 2.45773 0.102
NP_441962.1_4 Reverse -297 -316 -4.03212 0.156
NP_440387.1_1 Reverse -88 -104 13.3332 0.00865
NP_440387.1_1 Forward -97 -81 6.25339 0.0282
NP_440387.1_1 Forward -180 -164 -5.34967 0.227
NP_440387.1_1 Reverse -171 -187 -6.52964 0.292
NP_441431.1_2 Reverse -85 -99 9.24208 0.19
NP_441836.1_1 Forward -197 -178 15.4927 0.147
NP_441993.1_1 Reverse -109 -128 0.777198 0.292
NP_440114.1_10 Reverse -88 -102 5.80112 0.292
NP_440114.1_10 Reverse -331 -345 5.70279 0.296
NP_440114.1_10 Forward -97 -83 5.70279 0.296
NP_440293.1_3 Forward -194 -175 -0.787193 0.238
NP_440293.1_3 Forward -313 -294 -5.60541 0.28
NP_440766.1_4 Reverse -84 -98 8.55439 0.0871
NP_440766.1_5 Forward -112 -100 6.79636 0.292
NP_441237.1_9 Reverse -89 -99 14.828 0.0242
NP_441237.1_9 Reverse -178 -188 14.1397 0.0488
NP_441237.1_9 Reverse -332 -342 9.7148 0.272
NP_439910.1_2 Reverse -80 -97 -3.8944 0.0691
NP_439910.1_2 Forward -105 -88 -13.7275 0.162
NP_442867.1_8 Reverse -234 -253 10.8159 0.206
NP_440457.1_1 Reverse -84 -96 7.02048 0.105
NP_440457.1_1 Forward -190 -178 4.16888 0.171
NP_440457.1_1 Reverse -63 -75 0.333971 0.25
NP_440801.1_8 Forward -91 -72 -1.86883 0.283
NP_440473.1_9 Forward -351 -332 -6.29373 0.228
NP_442509.1_9 Forward -97 -87 16.2041 0.00739
NP_442509.1_9 Reverse -88 -98 8.14104 0.192
NP_442509.1_9 Reverse -331 -341 5.97777 0.298
NP_441489.1_3 Forward -165 -151 9.94278 0.232
NP_442514.1_5 Forward -176 -157 -8.75273 0.29
NP_440554.1_4 Forward -96 -86 14.6313 0.02
NP_441845.1_6 Reverse -76 -94 -1.84914 0.299
NP_441885.1_5 Reverse -88 -98 20.9245 0.000538
NP_441885.1_5 Forward -97 -87 11.4848 0.00668
NP_441885.1_5 Reverse -32 -42 -0.609952 0.215
NP_441885.1_5 Forward -180 -170 -1.59326 0.273
NP_442341.1_7 Forward -98 -84 19.7641 0.00702
NP_442341.1_7 Reverse -87 -101 7.66941 0.0994
NP_442341.1_7 Forward -259 -245 2.65453 0.249
NP_442341.1_9 Reverse -86 -100 7.07881 0.204
NP_441173.1_9 Forward -151 -143 9.85212 0.275
NP_440191.1_4 Reverse -236 -246 13.2451 0.282
NP_443000.1_7 Forward -99 -89 10.3048 0.0345
NP_443000.1_7 Reverse -86 -96 8.73149 0.0437
NP_440507.2_3 Reverse -79 -98 9.04509 0.236
NP_440275.1_3 Reverse -86 -96 8.4365 0.0602
NP_440275.1_3 Forward -99 -89 8.04317 0.0602
NP_440275.1_3 Reverse -329 -339 2.43831 0.268
NP_440091.1_1 Reverse -84 -96 10.7571 0.0429
NP_440091.1_1 Forward -101 -89 -0.452677 0.273
NP_440091.1_8 Forward -347 -328 23.1072 0.00568
NP_441902.1_3 Forward -164 -154 15.4111 0.201
NP_441359.1_5 Reverse -299 -318 5.89931 0.188
NP_442451.1_2 Reverse -169 -188 -7.96535 0.241
NP_442753.1_6 Reverse -299 -318 4.32522 0.298
NP_439962.1_4 Reverse -274 -293 8.94757 0.134
NP_440175.1_4 Reverse -22 -41 -14.4552 0.277
NP_442495.1_4 Reverse -58 -68 16.7946 0.0771
NP_440149.1_8 Reverse -88 -107 -2.55715 0.172
NP_440149.1_8 Forward -97 -78 -2.75381 0.175
NP_440216.1_1 Forward -97 -83 -1.47537 0.0328
NP_440216.1_1 Reverse -88 -102 -2.75368 0.0574
NP_440172.1_1 Reverse -88 -98 15.0247 0.00945
NP_440172.1_1 Forward -186 -176 10.0098 0.0572
NP_440172.1_1 Forward -97 -87 8.73149 0.0586
NP_440172.1_1 Reverse -331 -341 4.69992 0.171
NP_440172.1_1 Forward -41 -31 2.04498 0.286
NP_441064.1_4 Reverse -184 -203 7.66927 0.276
NP_442371.1_1 Forward -109 -99 11.8776 0.273
NP_442015.1_10 Reverse -84 -97 10.639 0.0391
NP_442015.1_10 Forward -101 -88 1.49425 0.204
NP_442015.1_10 Reverse -117 -130 -0.37404 0.264
NP_441226.1_7 Forward -96 -89 14.4934 0.0123
NP_441226.1_7 Reverse -89 -96 14.4934 0.0123
NP_441111.1_7 Forward -96 -88 18.7023 0.00294
NP_441111.1_7 Reverse -89 -97 18.7023 0.00294
NP_441111.1_7 Reverse -172 -180 -0.472234 0.131
NP_441766.1_2 Forward -97 -88 17.5026 0.00297
NP_441766.1_2 Reverse -88 -97 17.5026 0.00297
NP_440416.1_9 Forward -187 -168 -19.8634 0.279
NP_443052.1_9 Forward -384 -365 -5.9004 0.274
NP_441135.1_4 Reverse -81 -100 1.67108 0.284
NP_442154.1_1 Reverse -239 -257 -16.4021 0.239
NP_442226.1_8 Forward -153 -143 15.123 0.214
NP_440261.1_5 Reverse -178 -191 -3.02898 0.108
NP_440261.1_5 Forward -96 -83 -12.3704 0.284
NP_440988.1_10 Forward -188 -174 9.54584 0.202
NP_440988.1_10 Reverse -175 -189 9.54584 0.202
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCATTCGTTATCGAGCCTCCATTCCCACCAGTTGGTTAAGCATTACCCTAACGGAGGGGCGCAATCGTCAGGTACGTCGAATGACAGCGGCAGTGGGCTTCCCTACCCTACGATTGGTGCGGGTGCAAATACAGGTTACTGGTCGCTCTCCCCAACAGGGCAAAGGTAAGTCAGCAGCAACTTGGTGCTTAACCCTAGAAGGTTTGAGTCCGGGGCAATGGCGACCCCTGACCCCTTGGGAAGAAAATTTTTGCCAGCAACTCTTAACGGGAAATCCCAATGGTCCCTGGCAGAAAAAATTTGGCGATCGCCGTTGATCAAGGCTCCCTCCCCCCAGGGCATTAAAATAGGAACAGTTGCCGAACTCCCTATCAAGCCGAATCATTAATCATCCCGTTT

CDS

ATGTCCTATCTAATCGCTGTGGTAGCCAACCGCATTGCCGCCGAAGAAGCTTATACAACCTTGGAACAGGCAGGATTTGCCCAAAAGAATTTGACTATCATTGGCACAGGTTATAAAACCGCTGACGAATTTGGCTTGGTGGACCCGAAAAAACAAGCTATCAAAAGGGCAAAGCTCATGGCCATCTGGTTAGTACCCTTTGGTTTCGCTGCCGGTTATTGCTTTAACCTCATCACTGGCTTGAGCACCTTAGATTGGGCTGGAGACCCCGGTAACCACATTGTGGGCGGCCTCCTAGGGGCGATCGGTGGAACCATGGGGAGTTTCTTTGTCGGTGGGGGCGTGGGCTTAAGCTTTGGCAGTGGGGACAGTTTGCCCTATCGAAACCTTTTGCAAGCGGGGAAATATTTGGTAGTGGTGGCCGGTGGTGAACTGCAAAAACAACGGGCAACCAATTTACTCCGGCCCCTCAATCCTGAATATCTCCAGGGTTATACCGCCCCCGATGAAGCTTTTGTTTGA

Protein

MSYLIAVVANRIAAEEAYTTLEQAGFAQKNLTIIGTGYKTADEFGLVDPKKQAIKRAKLMAIWLVPFGFAAGYCFNLITGLSTLDWAGDPGNHIVGGLLGAIGGTMGSFFVGGGVGLSFGSGDSLPYRNLLQAGKYLVVVAGGELQKQRATNLLRPLNPEYLQGYTAPDEAFV