Your browser is old and dusty. Try Google Chrome!

Details for slr0612

ORF slr0612
Accession NP_439900.1
Symbol
Category Aminoacyl tRNA synthetases and tRNA modification
Definition probable pseudouridine synthase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442151.1_6 Forward -179 -165 7.47274 0.197
NP_441098.1_3 Forward -377 -358 -2.6737 0.28
NP_442287.1_1 Forward -55 -45 14.0409 0.266
NP_442752.1_4 Forward -305 -298 12.1338 0.0546
NP_442752.1_4 Reverse -45 -52 12.1338 0.0546
NP_442752.1_4 Forward -292 -285 4.26735 0.293
NP_443027.1_4 Forward -294 -284 7.05986 0.248
NP_441675.1_4 Reverse -147 -166 5.80098 0.236
NP_440061.1_9 Forward -56 -42 6.88214 0.228
NP_440061.1_9 Reverse -43 -57 5.40719 0.286
NP_440878.1_9 Reverse -263 -282 -3.3438 0.292
NP_440761.1_4 Reverse -95 -114 -14.1602 0.257
NP_440916.1_1 Forward -154 -140 12.586 0.206
NP_442602.1_3 Reverse -339 -358 12.1925 0.0537
NP_439918.1_2 Forward -333 -314 4.81767 0.163
NP_439918.1_2 Forward -357 -338 -4.22878 0.272
NP_439923.1_5 Forward -186 -167 9.0459 0.173
NP_441594.1_6 Reverse -213 -232 0.0977854 0.293
NP_442726.1_7 Reverse -260 -278 -1.25915 0.293
NP_441083.1_5 Reverse -332 -342 1.94665 0.197
NP_442827.1_8 Forward -144 -125 -2.36125 0.274
NP_441738.1_2 Reverse -334 -341 8.29857 0.176
NP_440209.1_1 Reverse -283 -291 2.08437 0.286
NP_440655.1_9 Forward -311 -292 16.9124 0.237
NP_442136.1_4 Forward -290 -271 21.1397 0.0628
NP_440447.1_5 Reverse -81 -91 15.713 0.277
NP_442675.1_1 Forward -358 -339 10.1275 0.164
NP_441770.1_10 Forward -270 -251 7.96426 0.29
NP_442570.1_3 Forward -359 -340 -7.08038 0.265
NP_440331.1_5 Forward -239 -220 -8.26035 0.101
NP_441624.1_7 Forward -114 -100 6.29277 0.286
NP_440343.1_1 Forward -222 -203 12.5858 0.218
NP_440343.1_1 Reverse -139 -158 11.1109 0.218
NP_440343.1_3 Reverse -326 -344 12.2114 0.132
NP_441854.1_10 Reverse -334 -353 2.45773 0.282
NP_440944.1_2 Forward -304 -285 -1.18052 0.259
NP_442634.1_2 Reverse -141 -160 2.85105 0.285
NP_442634.1_4 Forward -347 -333 -3.147 0.161
NP_442634.1_4 Forward -329 -315 -4.62196 0.211
NP_440403.1_4 Reverse -274 -293 -8.16202 0.251
NP_440842.1_6 Reverse -307 -326 17.8948 0.12
NP_442848.1_4 Reverse -264 -278 13.6676 0.241
NP_442848.1_5 Forward -257 -239 0.412472 0.276
NP_443018.1_3 Forward -398 -391 10.2655 0.107
NP_441634.1_8 Forward -56 -42 1.86788 0.178
NP_441634.1_8 Forward -233 -219 -3.44199 0.295
NP_440376.1_1 Reverse -45 -54 9.93116 0.0331
NP_440376.1_1 Forward -283 -274 -0.000272808 0.285
NP_442191.1_4 Reverse -36 -50 13.1262 0.164
NP_442191.1_4 Forward -350 -336 12.3505 0.215
NP_441846.1_10 Forward -315 -296 -13.3736 0.204
NP_441846.1_10 Forward -351 -332 -23.1083 0.277
NP_440691.1_10 Reverse -263 -282 7.37428 0.286
NP_442321.1_4 Reverse -315 -334 2.0644 0.255
NP_442321.1_4 Reverse -264 -283 -9.34199 0.298
NP_441165.1_5 Reverse -249 -268 13.9625 0.251
NP_441754.1_2 Reverse -222 -241 11.2092 0.25
NP_439905.1_1 Reverse -223 -236 6.90245 0.272
NP_440984.1_7 Forward -59 -45 5.70279 0.245
NP_441377.1_4 Reverse -131 -148 14.1002 0.19
NP_441097.1_2 Forward -349 -332 7.31533 0.245
NP_439990.1_5 Reverse -82 -95 5.42749 0.295
NP_442376.1_2 Forward -141 -122 -5.9004 0.286
NP_442690.1_1 Forward -86 -67 -14.1602 0.269
NP_440993.1_2 Forward -273 -257 2.32015 0.268
NP_440993.1_4 Forward -55 -38 5.54538 0.262
NP_442002.1_9 Reverse -347 -354 11.1505 0.185
NP_442002.1_9 Forward -293 -286 10.7572 0.185
NP_442438.1_10 Reverse -200 -214 2.94952 0.168
NP_442431.1_10 Forward -142 -124 1.19912 0.259
NP_441000.1_6 Reverse -282 -296 -3.54032 0.224
NP_440484.1_1 Forward -325 -306 11.2084 0.208
NP_441041.1_4 Forward -142 -123 -6.58872 0.169
NP_442996.1_1 Reverse -14 -33 5.1084 0.247
NP_442004.1_1 Forward -143 -124 21.9027 0.0499
NP_441725.1_4 Reverse -126 -140 3.24392 0.279
NP_441725.1_5 Reverse -297 -307 -1.10161 0.288
NP_439966.1_7 Forward -56 -46 8.14104 0.14
NP_439966.1_7 Reverse -281 -291 6.56775 0.177
NP_440260.1_8 Reverse -257 -275 -4.11075 0.264
NP_441334.1_7 Reverse -257 -276 -15.1435 0.275
NP_440437.1_1 Forward -263 -244 -3.63879 0.242
NP_441860.1_1 Forward -120 -106 15.9372 0.276
NP_440375.1_6 Reverse -308 -327 16.7157 0.128
NP_443030.1_4 Forward -289 -270 2.3594 0.209
NP_443049.1_6 Forward -293 -283 12.812 0.231
NP_442215.1_2 Reverse -271 -287 1.43517 0.134
NP_442215.1_2 Forward -181 -165 1.23851 0.138
NP_442554.1_8 Reverse -46 -56 3.32329 0.23
NP_441762.1_7 Forward -293 -281 -5.27089 0.195
NP_442313.1_3 Forward -350 -331 11.5042 0.224
NP_442476.1_6 Forward -53 -39 0.687908 0.247
NP_442016.1_10 Forward -248 -229 5.70265 0.277
NP_440895.1_10 Forward -48 -31 -5.66436 0.29
NP_443009.1_5 Forward -55 -44 5.36805 0.206
NP_443009.1_5 Forward -215 -204 3.40144 0.296
NP_442406.1_9 Forward -358 -339 4.52268 0.271
NP_440279.1_2 Forward -184 -165 4.62101 0.298
NP_439939.1_1 Reverse -338 -357 18.4848 0.167
NP_441826.1_5 Forward -267 -248 7.37428 0.221
NP_441637.1_9 Forward -82 -64 4.24738 0.245
NP_442427.1_8 Forward -366 -347 6.09597 0.249
NP_442808.1_1 Reverse -282 -292 7.94438 0.0634
NP_442808.1_1 Forward -55 -45 4.10949 0.207
NP_442542.1_2 Reverse -251 -264 14.4739 0.114
NP_440558.1_2 Reverse -270 -289 1.17943 0.183
NP_440111.2_2 Forward -147 -128 -4.32711 0.291
NP_441878.1_4 Forward -341 -322 7.57094 0.219
NP_441878.1_6 Forward -283 -273 -6.60814 0.193
NP_441036.1_8 Reverse -44 -54 5.97822 0.246
NP_441557.1_8 Forward -53 -43 15.7125 0.18
NP_442066.2_9 Forward -58 -45 8.27909 0.188
NP_441458.1_8 Forward -36 -17 3.44544 0.273
NP_442830.1_5 Reverse -272 -286 2.06395 0.277
NP_441549.1_9 Forward -58 -40 -10.1089 0.269
NP_441549.1_9 Reverse -244 -262 -10.4039 0.278
NP_442347.1_2 Reverse -284 -293 13.1761 0.056
NP_442594.1_8 Forward -323 -304 7.17762 0.214
NP_442594.1_8 Forward -308 -289 2.65439 0.294
NP_441633.1_3 Reverse -281 -294 -6.47056 0.253
NP_442998.1_5 Reverse -346 -356 15.5163 0.149
NP_442998.1_5 Reverse -50 -60 11.6814 0.179
NP_442998.1_5 Reverse -143 -153 11.1898 0.191
NP_442998.1_10 Reverse -285 -292 5.93897 0.206
NP_440731.1_2 Reverse -158 -177 9.63589 0.275
NP_440899.1_8 Forward -71 -52 -7.96535 0.246
NP_440899.1_8 Forward -70 -51 -10.227 0.277
NP_441559.1_8 Reverse -269 -283 4.81781 0.108
NP_441559.1_8 Reverse -40 -54 -1.96703 0.188
NP_440915.1_6 Reverse -41 -55 -1.47537 0.236
NP_441464.1_1 Reverse -314 -333 7.86593 0.261
NP_441464.1_1 Reverse -332 -351 7.47261 0.261
NP_441199.1_3 Reverse -336 -354 0.21581 0.231
NP_442386.1_5 Forward -266 -247 5.2102 0.263
NP_442386.1_9 Forward -55 -46 5.80084 0.237
NP_440570.1_5 Forward -343 -324 -0.000545616 0.259
NP_441750.1_1 Forward -327 -308 -6.1954 0.231
NP_442791.1_9 Reverse -340 -359 13.2733 0.237
NP_440168.1_9 Reverse -272 -291 5.80098 0.227
NP_441254.1_1 Forward -123 -110 11.0318 0.295
NP_440586.1_8 Forward -291 -284 12.6251 0.0546
NP_440586.1_8 Forward -398 -391 9.08521 0.178
NP_440027.1_3 Forward -54 -36 9.45814 0.184
NP_440027.1_3 Forward -269 -251 3.36165 0.273
NP_443051.1_5 Reverse -372 -391 12.0942 0.202
NP_442294.1_3 Forward -16 -2 13.7653 0.252
NP_443039.1_7 Reverse -313 -327 7.47213 0.19
NP_440439.1_1 Reverse -42 -55 1.49425 0.153
NP_441181.1_3 Forward -58 -39 15.8307 0.201
NP_440819.1_5 Reverse -156 -164 7.8859 0.266
NP_440819.1_5 Reverse -142 -150 7.59091 0.272
NP_442887.1_5 Forward -68 -49 -10.3253 0.264
NP_442887.1_5 Reverse -168 -187 -12.4886 0.281
NP_442384.1_10 Forward -54 -41 4.8375 0.145
NP_442790.1_4 Reverse -274 -293 -11.3086 0.224
NP_442790.1_4 Forward -301 -282 -11.6036 0.231
NP_442262.1_10 Forward -398 -391 9.18389 0.211
NP_440297.1_9 Reverse -274 -284 3.81494 0.26
NP_440297.1_9 Reverse -297 -307 -0.216628 0.282
NP_441896.1_5 Reverse -105 -112 15.3787 0.268
NP_440888.1_2 Forward -54 -40 13.9619 0.022
NP_440491.1_1 Reverse -35 -54 9.25599 0.218
NP_442033.1_10 Reverse -271 -290 -7.27704 0.186
NP_441543.1_2 Forward -291 -282 4.0313 0.293
NP_442578.1_7 Forward -291 -284 12.6255 0.0418
NP_440220.1_4 Forward -68 -49 -2.16459 0.266
NP_442822.1_1 Reverse -272 -291 17.7974 0.00511
NP_440519.1_8 Forward -305 -289 3.30346 0.247
NP_442204.1_1 Forward -349 -338 9.9901 0.0736
NP_441351.1_8 Reverse -137 -156 -0.197208 0.296
NP_440516.1_6 Reverse -274 -288 12.487 0.196
NP_440516.1_8 Forward -292 -283 0.786375 0.133
NP_440618.1_3 Forward -229 -210 20.649 0.0636
NP_440673.1_3 Reverse -285 -292 10.1672 0.149
NP_440673.1_3 Forward -134 -127 8.20058 0.234
NP_440673.1_7 Reverse -248 -267 1.37609 0.251
NP_440436.1_4 Reverse -297 -306 6.78414 0.147
NP_442412.1_5 Forward -324 -305 2.55606 0.294
NP_442577.1_9 Forward -118 -104 19.3701 0.146
NP_441719.1_4 Forward -291 -284 3.77569 0.285
NP_441004.1_1 Forward -339 -320 -14.7502 0.27
NP_441004.1_2 Reverse -338 -357 -0.983855 0.259
NP_442366.1_3 Forward -110 -92 -2.53746 0.229
NP_442873.1_9 Forward -64 -45 3.63691 0.289
NP_440296.1_10 Forward -308 -289 -3.54046 0.209
NP_440328.1_5 Forward -334 -315 17.0107 0.179
NP_443054.1_2 Forward -233 -219 1.47456 0.245
NP_441966.1_7 Reverse -314 -333 -0.984623 0.268
NP_441851.1_10 Forward -306 -296 4.79825 0.247
NP_440347.1_10 Forward -332 -313 17.0107 0.289
NP_442709.1_4 Reverse -101 -120 9.90773 0.161
NP_442689.1_8 Forward -82 -65 -7.92597 0.292
NP_441409.1_6 Reverse -228 -247 -8.85033 0.176
NP_442843.1_1 Reverse -46 -65 -2.65548 0.209
NP_442843.1_1 Forward -291 -272 -10.227 0.277
NP_440954.1_1 Forward -345 -326 -6.09707 0.289
NP_440483.1_1 Reverse -40 -59 -7.17871 0.258
NP_440078.1_4 Reverse -256 -275 9.93088 0.27
NP_441078.1_4 Reverse -45 -54 -2.06522 0.295
NP_441078.1_4 Forward -54 -45 -2.06522 0.295
NP_442729.1_4 Reverse -222 -241 17.7965 0.117
NP_442348.1_2 Forward -358 -349 11.8978 0.225
NP_442348.1_2 Forward -283 -274 10.6195 0.259
NP_442348.1_2 Reverse -380 -389 7.57121 0.28
NP_442348.1_2 Reverse -111 -120 7.57121 0.28
NP_442348.1_2 Forward -341 -332 7.37455 0.28
NP_442443.1_1 Forward -347 -328 -3.14714 0.264
NP_440526.1_3 Reverse -297 -308 5.36805 0.249
NP_442447.1_1 Reverse -6 -25 9.0459 0.258
NP_442815.1_1 Forward -356 -337 15.5357 0.109
NP_441057.1_3 Forward -365 -346 -10.227 0.214
NP_439900.1_2 Forward -342 -324 22.1436 0.026
NP_439900.1_3 Forward -142 -128 19.4691 0.111
NP_442751.1_2 Reverse -272 -291 2.45694 0.29
NP_442489.1_7 Reverse -45 -54 -1.57357 0.213
NP_441800.1_10 Reverse -45 -64 0.196116 0.293
NP_442346.1_1 Forward -357 -338 14.1591 0.27
NP_442346.1_5 Forward -306 -296 4.89658 0.269
NP_440545.1_3 Forward -309 -292 -5.07437 0.24
NP_440025.1_5 Reverse -249 -268 17.109 0.18
NP_440831.1_1 Forward -282 -263 16.4207 0.198
NP_440831.1_1 Forward -333 -314 10.5209 0.277
NP_440459.1_2 Forward -360 -343 7.70866 0.283
NP_441502.1_3 Forward -216 -197 5.40766 0.289
NP_443026.1_5 Reverse -375 -394 -2.26216 0.283
NP_442943.1_1 Reverse -67 -82 12.0061 0.16
NP_440875.1_9 Reverse -320 -330 10.7081 0.201
NP_440875.1_9 Forward -52 -42 6.81464 0.297
NP_441813.1_5 Forward -294 -284 -0.0199663 0.227
NP_441813.1_5 Reverse -281 -291 -0.0199663 0.227
NP_440594.1_5 Forward -120 -101 4.22689 0.293
NP_441239.1_9 Forward -263 -251 10.8554 0.0714
NP_442193.1_1 Forward -357 -339 9.16393 0.255
NP_441541.1_5 Reverse -96 -115 12.6841 0.276
NP_440833.1_6 Forward -393 -379 6.58715 0.299
NP_440949.1_6 Reverse -217 -236 11.3075 0.217
NP_441617.1_6 Forward -166 -147 15.8307 0.0665
NP_440546.1_4 Reverse -45 -55 7.13728 0.257
NP_440462.1_6 Forward -294 -284 4.3066 0.205
NP_442592.1_1 Forward -359 -340 9.63589 0.234
NP_440868.1_4 Reverse -279 -291 2.39892 0.156
NP_440812.1_7 Forward -101 -82 15.9282 0.148
NP_442402.1_4 Forward -161 -142 -10.031 0.296
NP_440036.1_1 Reverse -321 -340 11.1109 0.238
NP_442923.1_6 Reverse -15 -29 14.3354 0.199
NP_442039.1_4 Reverse -260 -267 8.69224 0.172
NP_442039.1_7 Reverse -139 -149 11.9764 0.257
NP_441811.1_8 Forward -142 -128 15.2409 0.162
NP_442837.1_3 Reverse -284 -291 9.87221 0.106
NP_440160.1_2 Forward -56 -37 -8.45701 0.286
NP_442053.1_1 Reverse -283 -292 4.42462 0.249
NP_440505.1_3 Forward -285 -275 8.04317 0.147
NP_440505.1_3 Reverse -43 -53 4.50326 0.284
NP_441102.1_2 Reverse -104 -123 6.4893 0.298
NP_441203.1_1 Reverse -284 -303 -15.2418 0.22
NP_440914.1_1 Reverse -45 -55 8.02955 0.211
NP_440724.1_1 Reverse -40 -59 8.75091 0.225
NP_442533.1_6 Forward -54 -45 13.8644 0.0178
NP_442541.1_10 Reverse -222 -236 3.14559 0.254
NP_442541.1_10 Forward -55 -41 2.8506 0.254
NP_442541.1_10 Reverse -312 -326 0.687325 0.3
NP_440263.1_5 Forward -163 -149 14.0609 0.262
NP_440263.1_5 Forward -70 -56 8.25939 0.294
NP_442322.1_4 Forward -57 -40 -0.748498 0.225
NP_443016.1_1 Forward -356 -337 -5.31042 0.245
NP_442293.1_6 Reverse -100 -119 15.5357 0.266
NP_442203.1_3 Forward -28 -9 3.06757 0.291
NP_441028.1_6 Forward -163 -153 4.89613 0.275
NP_441028.1_6 Forward -151 -141 4.7978 0.277
NP_440007.1_9 Reverse -133 -147 0.786239 0.29
NP_441680.1_4 Reverse -128 -147 0.786102 0.246
NP_441680.1_4 Reverse -30 -49 -0.000545616 0.246
NP_441680.1_4 Reverse -129 -148 -1.08219 0.256
NP_443045.1_5 Forward -345 -332 14.4343 0.271
NP_441930.1_2 Forward -283 -273 14.9263 0.19
NP_440886.1_7 Forward -293 -283 6.27276 0.134
NP_440886.1_7 Forward -55 -45 3.71617 0.267
NP_442072.1_9 Reverse -251 -269 -22.4003 0.234
NP_441753.1_10 Reverse -36 -55 4.22769 0.2
NP_441463.1_2 Reverse -105 -123 4.6956 0.177
NP_441836.1_2 Reverse -39 -58 2.3594 0.174
NP_441993.1_1 Reverse -253 -272 9.06107 0.136
NP_441993.1_1 Forward -357 -338 3.40855 0.235
NP_440935.1_6 Forward -108 -91 6.64108 0.267
NP_442090.1_3 Reverse -9 -28 18.3425 0.0585
NP_440766.1_4 Reverse -34 -48 0.392915 0.286
NP_441237.1_6 Forward -357 -340 6.13536 0.204
NP_440457.1_1 Reverse -41 -53 7.90546 0.101
NP_440457.1_1 Forward -345 -333 0.825626 0.25
NP_440457.1_1 Forward -309 -297 -1.04266 0.289
NP_442940.1_2 Reverse -222 -241 -0.4922 0.296
NP_440801.1_8 Reverse -340 -359 6.39097 0.166
NP_440801.1_10 Forward -309 -290 6.29264 0.289
NP_442784.1_3 Forward -255 -236 11.6025 0.293
NP_442514.1_5 Forward -62 -43 -6.3928 0.265
NP_441440.1_1 Reverse -247 -266 9.83255 0.284
NP_441885.1_5 Reverse -45 -55 -0.806614 0.228
NP_441173.1_9 Reverse -309 -317 12.9004 0.206
NP_441173.1_9 Forward -99 -91 11.8187 0.222
NP_441173.1_9 Forward -149 -141 10.9338 0.242
NP_441173.1_9 Forward -58 -50 10.9338 0.242
NP_442275.1_1 Reverse -338 -357 -0.0988766 0.295
NP_439962.1_4 Forward -49 -30 3.04771 0.195
NP_440149.1_8 Forward -357 -338 -6.58872 0.255
NP_441105.1_3 Forward -338 -319 -7.67036 0.258
NP_440216.1_1 Forward -54 -40 5.60446 0.0191
NP_440216.1_9 Forward -397 -388 15.9293 0.128
NP_440216.1_9 Forward -398 -389 6.78456 0.289
NP_441226.1_7 Forward -53 -46 8.29857 0.205
NP_440416.1_9 Forward -61 -42 -20.2567 0.283
NP_442154.1_1 Forward -359 -341 -17.4838 0.257
NP_442564.1_10 Reverse -136 -150 11.7993 0.244
NP_440988.1_2 Reverse -332 -350 15.8504 0.131
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGCCATGGAAAAATATCCCCTACTTGGTAAATTAATTGAACGGGAATTTGCCCAGGCGGGGGATTTGGAACAGGCCCTGGAATTGGTAGAACAGGGGGATGGTATCCGGCGATCAAGGGAATTGGCCGCGAACCAAGCGCAACTGGCCCGGCAACATCTGAGTGTGCTGGAAATGTCCGCTCCGAGAGAATCTCTGTTGGAATTAGTTGATTATGTGCTTGGTCGTCTCCATTAGGTTTTCCCGTAGATTTTTTCCCAGCGGGCTTGATTGCGTTGAATAAAACTCCCCAAACCATTGTTTTTTACAAACCCTACGGAGTTCTGTGTCAATTTACCGATAATTCTGCCCATCCCCGGCCGACGTTGAAGGATTATATTAATTTGCCAGATTTATATCCC

CDS

GTGGGGCGTTTGGATCAAGATAGCGAAGGACTATTGCTGCTCACCAGCAACGGTAAACTTCAGCATCGTTTGGCCCACCGGGAGTTTGCCCACCAACGTACTTATTTTGCCCAAGTAGAAGGCTCTCCAACGGACGAAGACCTAGAACCCCTGCGGCGGGGCATAACTTTCGCGGATTACCCTACCAGACCGGCGATCGCCAAAATTATCACTGAACCAGATTTTCCCCCCAGAAATCCTCCCATTCGTTATCGAGCCTCCATTCCCACCAGTTGGTTAAGCATTACCCTAACGGAGGGGCGCAATCGTCAGGTACGTCGAATGACAGCGGCAGTGGGCTTCCCTACCCTACGATTGGTGCGGGTGCAAATACAGGTTACTGGTCGCTCTCCCCAACAGGGCAAAGGTAAGTCAGCAGCAACTTGGTGCTTAACCCTAGAAGGTTTGAGTCCGGGGCAATGGCGACCCCTGACCCCTTGGGAAGAAAATTTTTGCCAGCAACTCTTAACGGGAAATCCCAATGGTCCCTGGCAGAAAAAATTTGGCGATCGCCGTTGA

Protein

MGRLDQDSEGLLLLTSNGKLQHRLAHREFAHQRTYFAQVEGSPTDEDLEPLRRGITFADYPTRPAIAKIITEPDFPPRNPPIRYRASIPTSWLSITLTEGRNRQVRRMTAAVGFPTLRLVRVQIQVTGRSPQQGKGKSAATWCLTLEGLSPGQWRPLTPWEENFCQQLLTGNPNGPWQKKFGDRR