Your browser is old and dusty. Try Google Chrome!

Details for slr0608

ORF slr0608
Accession NP_443063.1
Symbol hisIE
Category Aromatic amino acid family
Definition histidine biosynthesis bifunctional protein HisIE
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -262 -248 10.816 0.057
NP_441061.1_2 Reverse -255 -269 2.2612 0.178
NP_441061.1_2 Reverse -111 -125 1.27789 0.192
NP_440795.1_7 Forward -262 -255 14.6904 0.0123
NP_440795.1_7 Reverse -255 -262 14.6904 0.0123
NP_440795.1_7 Forward -118 -111 14.6904 0.0123
NP_440795.1_7 Reverse -111 -118 14.6904 0.0123
NP_441418.1_6 Reverse -254 -273 -1.08219 0.012
NP_441418.1_6 Reverse -110 -129 -21.1417 0.139
NP_441418.1_6 Forward -119 -100 -28.8115 0.211
NP_441418.1_6 Reverse -277 -296 -30.0898 0.256
NP_442291.1_5 Reverse -109 -125 -2.79306 0.226
NP_441453.1_1 Forward -270 -252 21.4545 0.0264
NP_441453.1_4 Reverse -254 -262 16.539 0.00633
NP_441453.1_4 Reverse -110 -118 16.539 0.00633
NP_441453.1_4 Forward -263 -255 16.539 0.00633
NP_441453.1_4 Forward -119 -111 16.539 0.00633
NP_441453.1_4 Forward -250 -242 5.42762 0.135
NP_442151.1_6 Forward -263 -249 14.6509 0.0321
NP_442151.1_6 Reverse -110 -124 10.816 0.114
NP_442151.1_6 Reverse -254 -268 9.14437 0.157
NP_442151.1_6 Forward -119 -105 7.66941 0.192
NP_441818.1_1 Forward -249 -238 11.0712 0.203
NP_441818.1_1 Reverse -111 -122 9.20294 0.25
NP_440226.1_1 Reverse -110 -129 9.43923 0.0726
NP_440226.1_1 Forward -263 -244 6.68596 0.122
NP_440226.1_1 Forward -119 -100 3.34271 0.229
NP_441630.1_3 Reverse -246 -265 9.83255 0.0942
NP_441630.1_3 Reverse -282 -301 0.294447 0.281
NP_441630.1_3 Reverse -102 -121 -0.885524 0.29
NP_441342.1_2 Reverse -250 -264 13.1759 0.174
NP_442623.1_1 Reverse -296 -315 -17.7985 0.292
NP_442744.1_8 Reverse -254 -273 -6.68705 0.297
NP_442655.1_10 Reverse -251 -270 -10.1286 0.22
NP_442173.1_1 Forward -262 -254 15.4574 0.00633
NP_442173.1_1 Forward -118 -110 15.4574 0.00633
NP_442173.1_1 Reverse -255 -263 15.4574 0.00633
NP_442173.1_1 Reverse -111 -119 15.4574 0.00633
NP_442173.1_1 Forward -249 -241 8.18089 0.111
NP_442752.1_4 Forward -263 -256 13.8055 0.0199
NP_442752.1_4 Reverse -254 -261 13.8055 0.0199
NP_442752.1_4 Forward -119 -112 13.8055 0.0199
NP_442752.1_4 Reverse -110 -117 13.8055 0.0199
NP_443027.1_4 Forward -121 -111 16.2046 0.0437
NP_443027.1_4 Forward -265 -255 14.828 0.0437
NP_443027.1_4 Forward -288 -278 11.4848 0.105
NP_443027.1_4 Reverse -108 -118 5.87989 0.294
NP_441812.1_3 Reverse -109 -123 16.8142 0.0639
NP_441812.1_3 Reverse -253 -267 8.06273 0.254
NP_442975.1_10 Reverse -106 -120 19.0751 0.00482
NP_442975.1_10 Forward -267 -253 14.0603 0.0459
NP_442975.1_10 Forward -123 -109 12.192 0.0477
NP_441225.1_7 Forward -64 -45 15.3391 0.18
NP_440784.1_7 Forward -262 -255 15.9687 0.0123
NP_440784.1_7 Reverse -255 -262 15.9687 0.0123
NP_440784.1_7 Forward -118 -111 15.9687 0.0123
NP_440784.1_7 Reverse -111 -118 15.9687 0.0123
NP_442909.1_7 Forward -262 -248 10.5204 0.136
NP_442909.1_7 Reverse -111 -125 5.21053 0.296
NP_440061.1_9 Forward -265 -251 8.25877 0.177
NP_440061.1_9 Reverse -369 -383 5.1122 0.294
NP_442074.1_5 Forward -307 -288 14.0608 0.29
NP_442062.1_8 Reverse -254 -264 19.4496 0.000558
NP_442062.1_8 Forward -119 -109 19.4496 0.000558
NP_442062.1_8 Forward -263 -253 17.3846 0.00193
NP_442062.1_8 Reverse -110 -120 10.3048 0.0493
NP_442062.1_8 Forward -250 -240 2.7333 0.297
NP_441859.1_3 Reverse -253 -272 3.04693 0.25
NP_441859.1_3 Forward -120 -101 2.85027 0.254
NP_441859.1_3 Forward -264 -245 2.06362 0.267
NP_441043.1_3 Reverse -240 -259 14.9458 0.274
NP_440304.1_4 Forward -121 -111 19.9412 0.00364
NP_440304.1_4 Forward -265 -255 10.8948 0.051
NP_440304.1_4 Reverse -252 -262 1.84832 0.299
NP_440304.1_4 Reverse -108 -118 1.84832 0.299
NP_442242.1_4 Forward -262 -255 14.3954 0.0124
NP_442242.1_4 Reverse -255 -262 14.3954 0.0124
NP_442242.1_4 Forward -118 -111 14.3954 0.0124
NP_442242.1_4 Reverse -111 -118 14.3954 0.0124
NP_442242.1_4 Forward -285 -278 10.0689 0.174
NP_440044.1_8 Reverse -111 -130 5.01433 0.106
NP_439918.1_2 Reverse -242 -261 -3.04881 0.251
NP_439918.1_3 Reverse -274 -293 7.17762 0.264
NP_439918.1_3 Reverse -251 -270 3.24438 0.266
NP_441619.1_8 Reverse -248 -262 17.9935 0.061
NP_440307.1_6 Reverse -161 -180 19.6656 0.0985
NP_441208.1_9 Reverse -251 -265 5.40779 0.267
NP_441594.1_6 Forward -272 -253 1.76941 0.262
NP_440370.1_10 Forward -272 -253 7.37428 0.258
NP_442110.1_7 Reverse -110 -124 10.3243 0.0684
NP_442110.1_7 Reverse -254 -268 3.53951 0.21
NP_442110.1_7 Reverse -45 -59 -0.197071 0.276
NP_441925.1_4 Reverse -364 -383 -17.1108 0.288
NP_440856.1_4 Forward -126 -107 -3.04881 0.226
NP_441083.1_2 Reverse -319 -336 15.8694 0.284
NP_441083.1_5 Forward -263 -253 20.3345 0.00053
NP_441083.1_5 Forward -119 -109 11.3864 0.0159
NP_441083.1_5 Reverse -254 -264 11.3864 0.0159
NP_441083.1_5 Reverse -110 -120 11.2881 0.0159
NP_441083.1_5 Forward -286 -276 -1.10161 0.295
NP_442827.1_8 Reverse -246 -265 3.24359 0.149
NP_442827.1_8 Reverse -102 -121 -0.197979 0.222
NP_442827.1_8 Forward -127 -108 -0.886293 0.236
NP_441434.1_7 Forward -261 -247 2.85119 0.268
NP_440109.1_8 Reverse -30 -49 8.06259 0.29
NP_441738.1_2 Forward -261 -254 15.28 0.0102
NP_441738.1_2 Reverse -256 -263 15.28 0.0102
NP_441738.1_2 Forward -117 -110 15.28 0.0102
NP_441738.1_2 Reverse -112 -119 15.28 0.0102
NP_441558.1_5 Forward -121 -102 5.99764 0.232
NP_441558.1_5 Forward -265 -246 4.22769 0.286
NP_441558.1_5 Reverse -222 -241 3.93269 0.294
NP_440209.1_1 Reverse -254 -262 18.1123 0.00295
NP_440209.1_1 Reverse -110 -118 18.1123 0.00295
NP_440209.1_1 Forward -263 -255 18.1123 0.00295
NP_440209.1_1 Forward -119 -111 18.1123 0.00295
NP_442765.1_4 Forward -71 -52 13.1758 0.244
NP_442889.1_8 Forward -266 -252 13.5686 0.0588
NP_442889.1_8 Reverse -107 -121 9.6354 0.0952
NP_440447.1_1 Forward -268 -250 4.83737 0.222
NP_441713.1_1 Forward -269 -250 -6.39206 0.118
NP_441713.1_1 Reverse -6 -25 -9.44032 0.175
NP_441713.1_1 Reverse -104 -123 -12.7836 0.248
NP_440178.1_7 Reverse -109 -128 -2.95047 0.0423
NP_441716.1_1 Reverse -254 -268 12.9793 0.0689
NP_441716.1_1 Reverse -110 -124 4.42448 0.256
NP_442111.1_4 Reverse -253 -267 19.6658 0.00373
NP_442111.1_4 Forward -120 -106 6.48943 0.123
NP_442111.1_4 Forward -234 -220 2.06454 0.291
NP_441163.1_1 Reverse -282 -299 9.37954 0.226
NP_440906.1_5 Forward -262 -255 15.8704 0.0124
NP_440906.1_5 Reverse -255 -262 15.8704 0.0124
NP_440906.1_5 Forward -118 -111 15.8704 0.0124
NP_440906.1_5 Reverse -111 -118 15.8704 0.0124
NP_440906.1_5 Reverse -278 -285 9.47889 0.116
NP_440747.1_10 Reverse -251 -263 14.887 0.00223
NP_440747.1_10 Forward -266 -254 7.70879 0.00236
NP_440747.1_10 Reverse -107 -119 5.34885 0.0141
NP_440747.1_10 Forward -122 -110 -1.92764 0.0192
NP_440747.1_10 Reverse -221 -233 -12.2524 0.254
NP_441130.1_4 Forward -89 -70 9.83255 0.231
NP_441486.1_1 Forward -266 -252 13.7659 0.00763
NP_441486.1_1 Forward -122 -108 13.1759 0.00897
NP_441486.1_1 Reverse -251 -265 11.3077 0.0164
NP_441486.1_1 Reverse -107 -121 3.24451 0.0638
NP_440944.1_2 Forward -347 -328 -2.95047 0.282
NP_442634.1_4 Reverse -252 -266 -1.67204 0.149
NP_442634.1_4 Reverse -108 -122 -2.06536 0.149
NP_441265.1_3 Forward -269 -255 3.14618 0.181
NP_440403.1_10 Forward -272 -253 2.65439 0.279
NP_441014.1_10 Reverse -253 -272 5.30853 0.188
NP_442848.1_1 Forward -125 -111 -2.26202 0.263
NP_441012.1_4 Forward -267 -254 7.19745 0.272
NP_443018.1_3 Forward -262 -255 14.8871 0.0123
NP_443018.1_3 Reverse -255 -262 14.8871 0.0123
NP_443018.1_3 Forward -118 -111 14.8871 0.0123
NP_443018.1_3 Reverse -111 -118 14.8871 0.0123
NP_443018.1_3 Forward -249 -242 8.8889 0.136
NP_441316.1_7 Forward -265 -250 3.42148 0.141
NP_441634.1_8 Reverse -258 -272 8.65272 0.114
NP_441634.1_8 Reverse -252 -266 -3.147 0.295
NP_440376.1_1 Forward -263 -254 19.4693 0.000692
NP_440376.1_1 Reverse -254 -263 19.4693 0.000692
NP_440376.1_1 Forward -119 -110 19.4693 0.000692
NP_440376.1_1 Reverse -110 -119 19.4693 0.000692
NP_441588.1_4 Forward -261 -251 15.9097 0.0369
NP_441588.1_4 Forward -117 -107 14.238 0.0773
NP_442730.1_6 Forward -122 -103 22.1239 0.0999
NP_442687.1_7 Forward -264 -254 15.8113 0.0125
NP_442687.1_7 Reverse -109 -119 15.8113 0.0125
NP_442687.1_7 Forward -120 -110 9.02648 0.0994
NP_442687.1_7 Reverse -253 -263 8.92815 0.0994
NP_442687.1_7 Reverse -223 -233 4.10993 0.266
NP_442485.1_3 Forward -274 -255 -0.295539 0.252
NP_442485.1_3 Reverse -252 -271 -5.31042 0.289
NP_441846.1_10 Forward -72 -53 -3.14714 0.134
NP_441846.1_10 Forward -77 -58 -13.0786 0.197
NP_441013.1_2 Forward -193 -175 -2.43913 0.282
NP_441422.1_7 Forward -265 -248 -3.50107 0.235
NP_441422.1_7 Reverse -108 -125 -5.27103 0.247
NP_440741.1_4 Reverse -254 -273 15.9291 0.159
NP_440533.1_9 Reverse -254 -273 16.5191 0.0669
NP_440667.1_2 Forward -325 -306 -0.0988766 0.209
NP_442658.1_1 Reverse -108 -118 15.9091 0.00966
NP_442658.1_1 Forward -265 -255 15.9091 0.00966
NP_442658.1_1 Forward -121 -111 13.0576 0.04
NP_442658.1_1 Reverse -288 -298 9.02601 0.169
NP_442658.1_1 Reverse -252 -262 6.76441 0.214
NP_442658.1_1 Forward -200 -190 5.58445 0.262
NP_441855.2_4 Forward -271 -252 9.42666 0.278
NP_440662.1_3 Reverse -268 -287 14.6508 0.151
NP_442782.1_2 Reverse -110 -124 2.06454 0.278
NP_442782.1_2 Reverse -254 -268 0.982901 0.282
NP_442205.1_9 Forward -125 -109 9.30165 0.102
NP_440656.1_8 Forward -274 -255 -5.40875 0.216
NP_440656.1_8 Forward -261 -242 -7.67036 0.262
NP_441414.1_9 Forward -119 -100 3.04771 0.0606
NP_441414.1_9 Forward -263 -244 -2.26216 0.112
NP_440607.1_8 Reverse -187 -206 1.57275 0.264
NP_441487.1_9 Reverse -109 -128 5.01433 0.14
NP_442653.1_8 Forward -309 -292 14.0018 0.23
NP_442937.1_5 Reverse -249 -268 11.7008 0.132
NP_442937.1_5 Reverse -105 -124 11.5042 0.136
NP_441958.1_5 Forward -120 -110 21.2195 0.000805
NP_441958.1_5 Forward -264 -254 12.2714 0.00183
NP_441958.1_5 Reverse -253 -263 12.2714 0.00183
NP_441958.1_5 Reverse -109 -119 12.2714 0.00183
NP_440203.1_5 Reverse -91 -101 10.8943 0.209
NP_442025.1_4 Reverse -30 -49 14.8474 0.272
NP_439905.1_1 Forward -262 -249 8.86907 0.228
NP_439905.1_1 Forward -298 -285 8.47575 0.234
NP_443001.1_7 Reverse -242 -261 4.42435 0.279
NP_440984.1_7 Reverse -249 -263 11.0127 0.122
NP_440984.1_7 Reverse -105 -119 7.76774 0.163
NP_440984.1_7 Reverse -285 -299 6.88276 0.195
NP_439990.1_5 Forward -268 -255 11.3273 0.128
NP_439990.1_5 Reverse -249 -262 7.6891 0.186
NP_442911.1_2 Forward -273 -254 7.07928 0.0267
NP_442911.1_2 Reverse -244 -263 1.96607 0.0549
NP_442911.1_2 Reverse -100 -119 1.76941 0.0563
NP_441580.1_6 Forward -274 -255 -5.70374 0.235
NP_440153.1_5 Reverse -111 -125 2.85119 0.219
NP_440858.1_1 Reverse -295 -314 -0.39387 0.246
NP_442064.1_1 Reverse -105 -124 -11.8003 0.262
NP_442064.1_4 Reverse -58 -77 6.78348 0.246
NP_440200.1_3 Forward -316 -297 11.2092 0.201
NP_443055.1_3 Forward -307 -288 16.1836 0.0801
NP_443055.1_6 Reverse -290 -308 8.57317 0.142
NP_440827.1_3 Forward -274 -255 15.3391 0.175
NP_440138.1_1 Forward -299 -281 7.19654 0.227
NP_441348.1_3 Forward -238 -219 15.5357 0.135
NP_441099.1_5 Forward -273 -254 -9.24366 0.216
NP_441099.1_5 Reverse -14 -33 -10.6203 0.258
NP_442002.1_1 Forward -76 -58 -9.91228 0.287
NP_442002.1_9 Forward -264 -257 10.7572 0.185
NP_442002.1_9 Reverse -109 -116 10.7572 0.185
NP_440809.1_9 Forward -128 -110 2.28076 0.118
NP_440809.1_9 Forward -272 -254 -7.65067 0.225
NP_440809.1_9 Reverse -101 -119 -7.749 0.225
NP_441294.1_7 Forward -88 -74 10.1145 0.207
NP_441646.1_1 Reverse -103 -122 3.93269 0.204
NP_442438.1_10 Forward -268 -254 10.816 0.0484
NP_442438.1_10 Forward -291 -277 8.16106 0.0812
NP_442438.1_10 Forward -124 -110 3.44117 0.162
NP_441000.1_6 Reverse -109 -123 2.75286 0.127
NP_441000.1_6 Reverse -11 -25 -0.393733 0.204
NP_441000.1_6 Forward -120 -106 -3.63866 0.225
NP_440147.1_4 Reverse -108 -121 12.0157 0.0326
NP_440147.1_4 Reverse -252 -265 10.049 0.0355
NP_440147.1_4 Forward -265 -252 3.46087 0.187
NP_440147.1_4 Reverse -10 -23 2.77255 0.202
NP_440147.1_4 Forward -121 -108 2.47756 0.208
NP_441550.1_8 Reverse -252 -262 14.6309 0.0132
NP_441550.1_8 Forward -121 -111 13.0576 0.0273
NP_441550.1_8 Reverse -108 -118 8.3377 0.124
NP_441550.1_8 Forward -265 -255 6.0761 0.214
NP_441916.1_7 Reverse -110 -120 18.9579 0.00144
NP_441916.1_7 Reverse -254 -264 18.4663 0.00144
NP_441916.1_7 Forward -119 -109 18.4663 0.00144
NP_441916.1_7 Forward -263 -253 10.3048 0.0261
NP_441916.1_10 Forward -61 -42 3.14605 0.236
NP_441041.1_4 Reverse -254 -273 6.78429 0.042
NP_441041.1_4 Reverse -110 -129 0.294447 0.0892
NP_441041.1_7 Reverse -107 -119 9.55551 0.109
NP_441041.1_7 Forward -266 -254 7.61196 0.162
NP_442396.1_5 Reverse -250 -263 21.1604 0.00421
NP_442396.1_5 Reverse -106 -119 9.95071 0.128
NP_443063.1_8 Forward -52 -33 21.3373 0.0853
NP_442004.1_6 Reverse -110 -124 10.6193 0.14
NP_442004.1_6 Forward -263 -249 7.66941 0.157
NP_441725.1_5 Reverse -255 -265 11.2881 0.0247
NP_441725.1_5 Reverse -111 -121 11.1898 0.0247
NP_441725.1_5 Forward -262 -252 2.04498 0.115
NP_441725.1_5 Forward -118 -108 2.04498 0.115
NP_439966.1_7 Forward -265 -255 18.4657 0.00473
NP_439966.1_7 Forward -121 -111 14.8275 0.0177
NP_439966.1_7 Reverse -108 -118 9.91099 0.0968
NP_439966.1_7 Reverse -252 -262 7.25606 0.15
NP_439966.1_9 Forward -265 -256 0.983037 0.253
NP_439966.1_9 Reverse -108 -117 0.884706 0.253
NP_442941.1_3 Reverse -111 -121 19.9412 0.00262
NP_442941.1_3 Reverse -255 -265 11.4848 0.0116
NP_442941.1_3 Forward -262 -252 11.0914 0.0116
NP_442941.1_3 Forward -118 -108 2.63497 0.14
NP_442941.1_3 Forward -285 -275 -1.29827 0.297
NP_440289.1_2 Forward -266 -253 11.819 0.0171
NP_440289.1_2 Forward -122 -109 -2.73398 0.262
NP_440289.1_2 Reverse -107 -120 -3.71729 0.267
NP_440983.1_5 Reverse -167 -186 0.392778 0.214
NP_440260.1_8 Reverse -245 -263 -4.8974 0.273
NP_442281.1_1 Forward -268 -254 11.7003 0.0438
NP_442281.1_1 Forward -124 -110 7.3738 0.102
NP_442281.1_1 Reverse -249 -263 6.98048 0.111
NP_442281.1_1 Forward -255 -241 4.22722 0.203
NP_442281.1_1 Reverse -105 -119 4.03056 0.21
NP_442256.1_2 Reverse -108 -126 -6.4707 0.214
NP_440437.1_1 Forward -269 -250 -0.590531 0.183
NP_440647.1_9 Reverse -108 -126 6.60732 0.219
NP_440498.1_1 Forward -128 -110 -2.3408 0.241
NP_441644.1_6 Reverse -110 -120 19.0557 0.000803
NP_441644.1_6 Forward -263 -253 17.3841 0.00127
NP_441644.1_6 Reverse -254 -264 10.1076 0.0628
NP_441644.1_6 Forward -119 -109 10.1076 0.0628
NP_441644.1_6 Forward -250 -240 8.3377 0.103
NP_441644.1_6 Forward -286 -276 7.45273 0.124
NP_441644.1_6 Forward -299 -289 3.32285 0.288
NP_442215.1_2 Reverse -252 -268 6.64671 0.0702
NP_442215.1_2 Forward -265 -249 -4.56302 0.235
NP_442177.1_5 Forward -185 -171 8.06273 0.288
NP_442029.1_6 Reverse -249 -268 16.5191 0.0986
NP_442029.1_6 Reverse -272 -291 2.94938 0.286
NP_440253.1_2 Reverse -254 -272 2.67408 0.133
NP_440253.1_2 Forward -119 -101 -1.25915 0.236
NP_440929.1_8 Forward -263 -254 19.2726 0.000701
NP_440929.1_8 Reverse -254 -263 19.2726 0.000701
NP_440929.1_8 Forward -119 -110 19.2726 0.000701
NP_440929.1_8 Reverse -110 -119 19.2726 0.000701
NP_442933.1_10 Forward -263 -254 17.601 0.00325
NP_442933.1_10 Reverse -254 -263 17.601 0.00325
NP_442933.1_10 Forward -119 -110 17.601 0.00325
NP_442933.1_10 Reverse -110 -119 17.601 0.00325
NP_442933.1_10 Reverse -277 -286 4.52295 0.24
NP_442933.1_10 Forward -286 -277 4.22796 0.267
NP_441751.2_8 Forward -262 -248 5.30946 0.0448
NP_441751.2_8 Reverse -255 -269 -1.77037 0.13
NP_441751.2_8 Reverse -225 -239 -2.16369 0.132
NP_441751.2_8 Reverse -111 -125 -3.04867 0.134
NP_441751.2_8 Reverse -52 -66 -5.50694 0.214
NP_442926.1_5 Reverse -105 -124 12.4059 0.19
NP_442554.1_8 Reverse -111 -121 16.9913 0.0065
NP_442554.1_8 Forward -262 -252 15.3197 0.00882
NP_442554.1_8 Reverse -255 -265 13.8447 0.0145
NP_442554.1_8 Forward -118 -108 13.2547 0.0187
NP_441762.1_7 Forward -120 -108 10.2654 0.0142
NP_441762.1_7 Forward -264 -252 9.57708 0.0142
NP_441762.1_7 Reverse -253 -265 2.89058 0.0676
NP_441762.1_7 Reverse -109 -121 2.20226 0.0676
NP_442142.1_4 Forward -266 -253 17.1282 0.0264
NP_442142.1_4 Forward -122 -109 8.2785 0.118
NP_442142.1_4 Reverse -251 -264 5.52525 0.188
NP_442142.1_4 Reverse -107 -120 5.23026 0.197
NP_442292.1_1 Forward -262 -253 18.486 0.00229
NP_442292.1_1 Reverse -111 -120 17.5026 0.00435
NP_442292.1_1 Reverse -255 -264 9.63616 0.0183
NP_442292.1_1 Forward -118 -109 9.63616 0.0183
NP_442476.1_6 Forward -262 -248 2.85119 0.171
NP_440895.1_6 Reverse -248 -261 10.7374 0.202
NP_443009.1_2 Forward -261 -242 0.884433 0.216
NP_443009.1_5 Forward -120 -109 19.626 0.00102
NP_443009.1_5 Reverse -253 -264 18.3477 0.00265
NP_443009.1_5 Reverse -276 -287 10.6779 0.0767
NP_443009.1_5 Reverse -109 -120 7.82632 0.118
NP_443009.1_5 Reverse -389 -400 6.64635 0.154
NP_443009.1_5 Reverse -289 -300 3.40144 0.296
NP_442408.2_1 Reverse -110 -129 -1.67217 0.241
NP_440947.1_9 Reverse -113 -132 8.84924 0.285
NP_441715.1_4 Reverse -255 -265 16.303 0.0117
NP_441715.1_4 Reverse -111 -121 14.238 0.0295
NP_441715.1_4 Forward -118 -108 9.41981 0.097
NP_441715.1_4 Forward -262 -252 7.94484 0.107
NP_440730.1_4 Reverse -22 -41 2.26107 0.237
NP_440730.1_10 Reverse -51 -70 17.4032 0.164
NP_441198.1_8 Forward -121 -111 13.2713 0.108
NP_440379.1_5 Forward -272 -253 0.982764 0.164
NP_440464.1_10 Forward -262 -252 13.0082 0.169
NP_441468.1_1 Forward -262 -255 15.8704 0.0124
NP_441468.1_1 Reverse -255 -262 15.8704 0.0124
NP_441468.1_1 Forward -118 -111 15.8704 0.0124
NP_441468.1_1 Reverse -111 -118 15.8704 0.0124
NP_441020.2_6 Forward -121 -104 9.28195 0.176
NP_441020.2_6 Reverse -108 -125 8.10198 0.209
NP_441020.2_6 Forward -62 -45 7.70866 0.222
NP_441015.1_10 Forward -76 -57 1.27776 0.16
NP_441015.1_10 Reverse -249 -268 -4.13045 0.199
NP_441015.1_10 Forward -124 -105 -5.31042 0.221
NP_441673.1_1 Forward -263 -254 20.8459 0.000698
NP_441673.1_1 Reverse -254 -263 20.8459 0.000698
NP_441673.1_1 Forward -119 -110 20.8459 0.000698
NP_441673.1_1 Reverse -110 -119 20.8459 0.000698
NP_441826.1_2 Forward -269 -255 3.93283 0.105
NP_441330.1_1 Forward -124 -105 -11.7019 0.183
NP_442868.1_6 Reverse -252 -262 9.81313 0.038
NP_442868.1_6 Forward -121 -111 1.06167 0.205
NP_442868.1_6 Forward -265 -255 0.963343 0.205
NP_442868.1_6 Reverse -108 -118 0.865012 0.205
NP_441612.1_2 Forward -263 -253 8.54929 0.21
NP_442227.1_2 Reverse -47 -66 -0.688862 0.257
NP_442361.1_3 Forward -332 -319 9.06573 0.283
NP_442808.1_1 Forward -264 -254 18.4657 0.00201
NP_442808.1_1 Reverse -109 -119 18.4657 0.00201
NP_442808.1_1 Forward -120 -110 8.73102 0.0481
NP_442808.1_1 Reverse -253 -263 8.63269 0.0481
NP_442808.1_1 Reverse -223 -233 3.32285 0.244
NP_442808.1_1 Reverse -263 -273 1.5529 0.282
NP_440145.1_3 Forward -129 -110 -5.40875 0.267
NP_442050.1_5 Forward -121 -111 18.0724 0.00365
NP_442050.1_5 Forward -265 -255 9.12434 0.193
NP_442050.1_5 Reverse -252 -262 7.64939 0.243
NP_441114.1_3 Forward -297 -288 14.5527 0.193
NP_440558.1_2 Forward -272 -253 5.01433 0.147
NP_441878.1_6 Forward -120 -110 10.5014 0.0176
NP_441878.1_6 Forward -264 -254 10.4031 0.0176
NP_441878.1_6 Reverse -253 -263 10.4031 0.0176
NP_441878.1_6 Reverse -109 -119 10.4031 0.0176
NP_441878.1_6 Reverse -223 -233 1.25834 0.108
NP_441878.1_6 Reverse -289 -299 -7.49312 0.231
NP_441878.1_6 Forward -234 -224 -7.59145 0.245
NP_441036.1_8 Forward -264 -254 17.7779 0.000554
NP_441036.1_8 Reverse -109 -119 17.7779 0.000554
NP_441036.1_8 Forward -120 -110 15.713 0.00724
NP_441036.1_8 Reverse -253 -263 8.33817 0.174
NP_441557.1_5 Forward -263 -254 19.9609 0.000699
NP_441557.1_5 Reverse -254 -263 19.9609 0.000699
NP_441557.1_5 Forward -119 -110 19.9609 0.000699
NP_441557.1_5 Reverse -110 -119 19.9609 0.000699
NP_441557.1_5 Reverse -277 -286 -0.885252 0.26
NP_441445.1_1 Forward -272 -253 14.1591 0.0527
NP_441445.1_1 Forward -128 -109 11.6025 0.0821
NP_441445.1_1 Reverse -101 -120 5.211 0.175
NP_441445.1_1 Reverse -245 -264 1.0811 0.262
NP_442066.2_9 Reverse -250 -263 11.1307 0.154
NP_442419.1_2 Reverse -105 -124 -3.04881 0.249
NP_440738.1_3 Reverse -309 -328 9.63589 0.241
NP_442241.1_5 Reverse -29 -48 16.3215 0.115
NP_441308.1_8 Forward -121 -111 13.353 0.218
NP_441308.1_8 Forward -265 -255 10.1081 0.22
NP_440101.1_10 Forward -368 -349 10.5209 0.148
NP_441458.1_10 Reverse -245 -264 10.8159 0.123
NP_442183.1_1 Reverse -110 -124 14.2576 0.0347
NP_442183.1_1 Reverse -254 -268 9.93102 0.0903
NP_442183.1_1 Forward -263 -249 9.2427 0.0999
NP_442183.1_1 Forward -60 -46 4.71948 0.25
NP_442183.1_9 Forward -386 -376 9.41981 0.296
NP_441407.1_5 Forward -129 -110 4.62101 0.245
NP_442397.1_9 Forward -263 -244 14.3558 0.185
NP_441574.1_1 Reverse -277 -296 -6.68705 0.277
NP_441574.1_1 Reverse -242 -261 -7.86702 0.297
NP_442170.1_5 Reverse -110 -129 11.2092 0.0527
NP_442347.1_2 Forward -262 -253 12.4878 0.056
NP_442347.1_2 Reverse -255 -264 11.1111 0.056
NP_442347.1_2 Forward -118 -109 11.1111 0.056
NP_442347.1_2 Reverse -111 -120 3.34298 0.284
NP_442645.1_2 Forward -127 -108 -3.93378 0.0525
NP_442645.1_2 Reverse -246 -265 -5.31042 0.0661
NP_441037.1_4 Reverse -108 -118 14.7245 0.028
NP_441037.1_4 Reverse -252 -262 7.9999 0.237
NP_441037.1_4 Forward -121 -111 7.31769 0.237
NP_441037.1_4 Forward -265 -255 7.02532 0.237
NP_441633.1_3 Reverse -252 -265 8.47575 0.0377
NP_441633.1_3 Reverse -108 -121 3.26421 0.0709
NP_441633.1_3 Reverse -49 -62 -2.73398 0.177
NP_441633.1_3 Forward -265 -252 -3.71729 0.177
NP_441633.1_3 Reverse -369 -382 -4.01229 0.179
NP_441633.1_3 Forward -121 -108 -5.78224 0.236
NP_441633.1_7 Forward -299 -280 17.7974 0.0777
NP_440136.1_2 Forward -262 -255 15.9687 0.0123
NP_440136.1_2 Reverse -255 -262 15.9687 0.0123
NP_440136.1_2 Forward -118 -111 15.9687 0.0123
NP_440136.1_2 Reverse -111 -118 15.9687 0.0123
NP_442998.1_10 Forward -261 -254 15.5754 0.0102
NP_442998.1_10 Reverse -256 -263 15.5754 0.0102
NP_442998.1_10 Forward -117 -110 15.5754 0.0102
NP_442998.1_10 Reverse -112 -119 15.5754 0.0102
NP_440899.1_1 Forward -319 -300 14.4581 0.11
NP_440299.1_1 Forward -267 -254 20.1765 0.00128
NP_440299.1_1 Reverse -250 -263 12.9984 0.0319
NP_440299.1_1 Reverse -106 -119 10.9334 0.0529
NP_440299.1_1 Reverse -273 -286 10.1468 0.0597
NP_440299.1_1 Forward -290 -277 3.36198 0.247
NP_440299.1_1 Reverse -220 -233 3.26365 0.251
NP_441799.1_1 Reverse -250 -264 18.3868 0.0085
NP_441799.1_1 Forward -123 -109 17.5018 0.011
NP_441799.1_1 Reverse -106 -120 13.2736 0.0337
NP_441799.1_1 Reverse -8 -22 4.22722 0.261
NP_441799.1_1 Forward -267 -253 4.03056 0.269
NP_442802.1_6 Forward -120 -101 1.67108 0.204
NP_441007.1_10 Reverse -249 -262 10.5407 0.0656
NP_441007.1_10 Forward -124 -111 3.46087 0.182
NP_442201.1_10 Reverse -99 -118 3.73603 0.0961
NP_442333.2_5 Forward -261 -242 -7.4737 0.232
NP_440256.1_1 Reverse -251 -270 0.491109 0.0829
NP_440256.1_1 Reverse -238 -257 -3.04881 0.126
NP_440256.1_1 Forward -122 -103 -3.14714 0.127
NP_440256.1_1 Reverse -9 -28 -3.24547 0.129
NP_440256.1_1 Reverse -107 -126 -4.52377 0.158
NP_442961.1_7 Forward -33 -14 14.5524 0.194
NP_441559.1_8 Forward -268 -254 11.996 0.0574
NP_441559.1_8 Reverse -259 -273 2.5562 0.143
NP_441559.1_8 Forward -193 -179 0.786239 0.161
NP_441559.1_8 Reverse -105 -119 -6.39192 0.277
NP_440915.1_6 Forward -267 -253 5.70279 0.0879
NP_440915.1_6 Reverse -106 -120 4.81781 0.0953
NP_440915.1_6 Forward -37 -23 -3.147 0.29
NP_441296.1_9 Reverse -361 -374 18.5049 0.0931
NP_442785.1_7 Forward -121 -107 9.73436 0.244
NP_441704.1_8 Forward -274 -255 7.07848 0.249
NP_442031.1_5 Reverse -318 -337 7.7676 0.23
NP_441464.1_4 Forward -393 -374 15.3391 0.266
NP_441464.1_8 Forward -263 -249 5.21113 0.26
NP_441464.1_8 Forward -119 -105 4.91614 0.26
NP_440702.1_2 Forward -388 -369 -6.49039 0.26
NP_440695.1_5 Reverse -110 -129 8.75091 0.15
NP_441199.1_6 Forward -267 -248 10.2259 0.0781
NP_441199.1_6 Forward -123 -104 -1.67217 0.296
NP_442993.1_1 Reverse -110 -126 -1.90808 0.103
NP_442993.1_1 Reverse -254 -270 -7.61128 0.146
NP_442993.1_1 Forward -119 -103 -8.0046 0.151
NP_442993.1_1 Forward -263 -247 -10.4629 0.22
NP_442386.1_9 Reverse -109 -118 15.7322 0.0144
NP_442386.1_9 Forward -264 -255 15.7322 0.0144
NP_442386.1_9 Reverse -253 -262 13.8639 0.0289
NP_442386.1_9 Forward -120 -111 6.39082 0.219
NP_441340.1_5 Forward -262 -255 15.6737 0.0124
NP_441340.1_5 Reverse -255 -262 15.6737 0.0124
NP_441340.1_5 Forward -118 -111 15.6737 0.0124
NP_441340.1_5 Reverse -111 -118 15.6737 0.0124
NP_441340.1_5 Reverse -242 -249 4.07068 0.239
NP_442484.1_2 Reverse -243 -262 5.211 0.172
NP_441776.1_5 Forward -243 -224 9.93088 0.291
NP_440161.1_3 Forward -121 -102 15.5357 0.113
NP_440586.1_8 Forward -262 -255 13.2151 0.026
NP_440586.1_8 Forward -118 -111 13.2151 0.026
NP_440586.1_8 Reverse -255 -262 13.2151 0.026
NP_440586.1_8 Reverse -111 -118 13.2151 0.026
NP_440586.1_8 Forward -285 -278 9.3802 0.156
NP_442251.1_6 Forward -262 -255 15.2804 0.0124
NP_442251.1_6 Reverse -255 -262 15.2804 0.0124
NP_442251.1_6 Forward -118 -111 15.2804 0.0124
NP_442251.1_6 Reverse -111 -118 15.2804 0.0124
NP_442959.1_7 Reverse -297 -316 -1.08219 0.247
NP_440684.1_9 Reverse -248 -262 19.4691 0.0271
NP_441262.1_3 Reverse -254 -261 14.7888 0.0223
NP_441262.1_3 Reverse -110 -117 14.7888 0.0223
NP_441262.1_3 Forward -263 -256 14.7888 0.0223
NP_441262.1_3 Forward -119 -112 14.7888 0.0223
NP_441262.1_3 Reverse -241 -248 5.15232 0.265
NP_440027.1_3 Forward -332 -314 5.72158 0.237
NP_440027.1_3 Forward -273 -255 4.83661 0.25
NP_443051.1_1 Forward -120 -111 19.5676 0.00335
NP_443051.1_1 Reverse -253 -262 10.4228 0.00754
NP_443051.1_1 Reverse -109 -118 10.4228 0.00754
NP_443051.1_1 Forward -264 -255 10.4228 0.00754
NP_439984.1_2 Reverse -143 -156 12.3107 0.252
NP_439937.1_9 Reverse -253 -270 -8.61494 0.176
NP_439937.1_9 Reverse -23 -40 -14.2198 0.287
NP_439937.1_9 Forward -120 -103 -16.2847 0.287
NP_440408.1_7 Forward -78 -59 8.94757 0.265
NP_440439.1_1 Forward -122 -109 18.5055 0.0105
NP_440439.1_1 Forward -266 -253 8.37742 0.0537
NP_440439.1_1 Reverse -107 -120 1.00259 0.164
NP_439943.1_4 Forward -388 -369 6.19431 0.275
NP_440372.1_2 Forward -262 -255 16.3621 0.0124
NP_440372.1_2 Reverse -255 -262 16.3621 0.0124
NP_440372.1_2 Forward -118 -111 16.3621 0.0124
NP_440372.1_2 Reverse -111 -118 16.3621 0.0124
NP_440372.1_2 Reverse -242 -249 4.07068 0.262
NP_441181.1_6 Reverse -278 -296 3.3624 0.283
NP_439977.1_5 Forward -269 -250 -3.3438 0.299
NP_440139.1_1 Reverse -248 -267 0.981987 0.275
NP_441572.1_7 Forward -269 -250 -3.3438 0.209
NP_442384.1_10 Forward -263 -250 15.8506 0.00946
NP_442384.1_10 Reverse -254 -267 15.7522 0.00946
NP_442384.1_10 Reverse -110 -123 8.08242 0.0692
NP_442384.1_10 Forward -119 -106 7.09911 0.0875
NP_442384.1_10 Forward -286 -273 4.14919 0.167
NP_442384.1_10 Reverse -277 -290 1.39592 0.26
NP_442384.1_10 Forward -233 -220 1.10092 0.268
NP_440364.1_3 Reverse -180 -199 16.4207 0.241
NP_441877.1_7 Forward -268 -249 1.47364 0.242
NP_441877.1_7 Forward -333 -314 -0.197979 0.281
NP_441018.1_7 Reverse -250 -269 11.9958 0.173
NP_441018.1_7 Reverse -144 -163 6.68596 0.283
NP_442790.1_4 Reverse -245 -264 0.687771 0.0876
NP_442790.1_4 Reverse -101 -120 -6.88371 0.147
NP_442262.1_10 Forward -262 -255 14.1988 0.0123
NP_442262.1_10 Reverse -255 -262 14.1988 0.0123
NP_442262.1_10 Forward -118 -111 14.1988 0.0123
NP_442262.1_10 Reverse -111 -118 14.1988 0.0123
NP_442262.1_10 Forward -249 -242 11.4455 0.102
NP_441689.1_5 Forward -121 -111 17.8758 0.0158
NP_441689.1_5 Forward -265 -255 8.53436 0.132
NP_441689.1_5 Forward -252 -242 8.04271 0.166
NP_441689.1_5 Reverse -252 -262 5.78111 0.197
NP_440163.1_10 Forward -266 -256 16.303 0.0762
NP_440163.1_10 Forward -289 -279 8.63316 0.266
NP_440344.1_10 Forward -270 -253 19.9017 0.00187
NP_440344.1_10 Reverse -103 -120 -0.649475 0.0444
NP_440344.1_10 Forward -126 -109 -9.79426 0.156
NP_440344.1_10 Reverse -247 -264 -11.6625 0.223
NP_440531.1_6 Forward -271 -252 0.491109 0.191
NP_440531.1_6 Reverse -262 -281 -4.32711 0.279
NP_442910.1_1 Forward -270 -251 -5.40875 0.254
NP_440562.1_3 Reverse -291 -308 5.54538 0.159
NP_441965.1_10 Forward -266 -250 5.86006 0.196
NP_442529.1_4 Reverse -101 -120 10.5209 0.227
NP_440297.1_9 Reverse -255 -265 9.32148 0.0917
NP_440297.1_9 Reverse -111 -121 9.22315 0.0917
NP_440297.1_9 Forward -262 -252 -0.118297 0.282
NP_440297.1_9 Forward -118 -108 -0.118297 0.282
NP_441592.1_4 Forward -263 -244 -1.57384 0.254
NP_441592.1_4 Forward -25 -6 -3.24547 0.279
NP_441896.1_3 Reverse -362 -381 0.196116 0.23
NP_440894.1_10 Forward -310 -291 2.85105 0.281
NP_440999.1_9 Forward -267 -253 13.1759 0.0329
NP_440999.1_9 Reverse -47 -61 -3.54032 0.296
NP_440888.1_2 Reverse -254 -268 15.9285 0.00837
NP_440888.1_2 Reverse -110 -124 14.1586 0.02
NP_440888.1_2 Forward -119 -105 8.16044 0.171
NP_440888.1_2 Forward -263 -249 7.96378 0.175
NP_440888.1_2 Reverse -353 -367 5.30886 0.284
NP_441771.1_4 Forward -203 -184 -2.75381 0.292
NP_440600.1_4 Reverse -102 -120 -7.94566 0.294
NP_440491.1_1 Forward -266 -247 11.3026 0.173
NP_440052.1_5 Forward -274 -255 -4.81876 0.268
NP_442948.1_2 Reverse -253 -272 3.83436 0.282
NP_442033.1_10 Forward -298 -279 -8.94866 0.21
NP_442033.1_10 Forward -235 -216 -10.3253 0.233
NP_442871.1_4 Reverse -363 -382 -9.14605 0.283
NP_442871.1_4 Reverse -112 -131 -9.24438 0.283
NP_441759.1_2 Forward -127 -108 2.94938 0.167
NP_441543.1_2 Forward -118 -109 18.486 0.00236
NP_441543.1_2 Reverse -255 -264 18.486 0.00236
NP_441543.1_2 Forward -262 -253 16.9127 0.00359
NP_441543.1_2 Reverse -111 -120 15.9293 0.00518
NP_441543.1_2 Forward -285 -276 4.42462 0.246
NP_442845.1_2 Reverse -248 -262 18.7808 0.0608
NP_442845.1_2 Forward -125 -111 6.6861 0.205
NP_442845.1_2 Forward -269 -255 3.63784 0.282
NP_441319.1_8 Reverse -104 -122 10.6389 0.183
NP_441469.1_8 Reverse -109 -118 16.126 0.00797
NP_441469.1_8 Forward -264 -255 16.126 0.00797
NP_441469.1_8 Forward -120 -111 6.5879 0.227
NP_441469.1_8 Reverse -253 -262 6.48957 0.227
NP_442315.1_2 Forward -312 -300 12.3303 0.291
NP_442637.1_8 Forward -346 -327 15.0441 0.103
NP_443064.1_5 Reverse -255 -274 16.9537 0.274
NP_443064.1_6 Forward -263 -253 12.5669 0.0796
NP_443064.1_6 Reverse -110 -120 10.8217 0.13
NP_442578.1_7 Forward -262 -255 14.5921 0.026
NP_442578.1_7 Forward -118 -111 14.5921 0.026
NP_442578.1_7 Reverse -255 -262 14.5921 0.026
NP_442578.1_7 Reverse -111 -118 14.5921 0.026
NP_441462.1_2 Reverse -110 -120 20.2362 0.000805
NP_441462.1_2 Forward -263 -253 11.5831 0.00406
NP_441462.1_2 Reverse -254 -264 11.5831 0.00406
NP_441462.1_2 Forward -119 -109 11.5831 0.00406
NP_441621.1_7 Reverse -252 -266 -3.44199 0.188
NP_441621.1_7 Reverse -108 -122 -5.70361 0.26
NP_443062.1_1 Forward -119 -101 11.3736 0.1
NP_443062.1_1 Reverse -254 -272 11.1786 0.103
NP_443062.1_1 Reverse -110 -128 6.01073 0.211
NP_443062.1_6 Reverse -282 -301 6.29264 0.183
NP_442204.1_1 Forward -267 -256 9.69511 0.0736
NP_442204.1_1 Forward -123 -112 7.72849 0.116
NP_441560.1_8 Reverse -219 -238 12.6814 0.248
NP_442487.1_5 Reverse -253 -272 7.76679 0.198
NP_440516.1_2 Forward -269 -251 3.3624 0.149
NP_440516.1_8 Forward -263 -254 16.9127 0.00442
NP_440516.1_8 Reverse -254 -263 16.9127 0.00442
NP_440516.1_8 Forward -119 -110 16.9127 0.00442
NP_440516.1_8 Reverse -110 -119 16.9127 0.00442
NP_441033.1_2 Reverse -100 -119 13.8641 0.0464
NP_442428.1_5 Forward -262 -255 15.8704 0.0124
NP_442428.1_5 Reverse -255 -262 15.8704 0.0124
NP_442428.1_5 Forward -118 -111 15.8704 0.0124
NP_442428.1_5 Reverse -111 -118 15.8704 0.0124
NP_440783.1_2 Reverse -312 -331 -2.45882 0.175
NP_441443.1_1 Forward -68 -49 -5.60541 0.298
NP_442120.1_10 Reverse -45 -64 -14.7502 0.289
NP_442823.1_8 Forward -71 -52 13.1758 0.259
NP_441835.1_2 Reverse -281 -300 5.89931 0.27
NP_440673.1_2 Forward -273 -254 9.60917 0.24
NP_440673.1_3 Forward -261 -254 12.4288 0.0426
NP_440673.1_3 Forward -117 -110 12.4288 0.0426
NP_440673.1_3 Reverse -256 -263 12.4288 0.0426
NP_440673.1_3 Reverse -112 -119 12.4288 0.0426
NP_440673.1_3 Reverse -279 -286 11.7405 0.0653
NP_440673.1_7 Forward -261 -242 11.9958 0.103
NP_441052.1_2 Forward -263 -253 19.9412 0.00106
NP_441052.1_2 Reverse -254 -264 10.5014 0.0285
NP_441052.1_2 Forward -119 -109 10.5014 0.0285
NP_441052.1_2 Reverse -110 -120 10.4031 0.0285
NP_441052.1_2 Reverse -283 -293 1.35667 0.248
NP_441052.1_2 Forward -233 -223 0.668351 0.256
NP_442219.1_8 Reverse -279 -298 20.1496 0.0434
NP_442219.1_9 Forward -262 -253 17.7976 0.00718
NP_442219.1_9 Reverse -255 -264 8.35786 0.0681
NP_442219.1_9 Forward -118 -109 8.35786 0.0681
NP_442219.1_9 Reverse -111 -120 8.25953 0.0681
NP_442219.1_9 Forward -172 -163 2.458 0.27
NP_440436.1_4 Forward -118 -109 18.1905 0.00233
NP_440436.1_4 Reverse -255 -264 18.1905 0.00233
NP_440436.1_4 Forward -262 -253 17.2072 0.00233
NP_440436.1_4 Reverse -111 -120 9.24241 0.0871
NP_440436.1_4 Forward -298 -289 6.48915 0.157
NP_440436.1_4 Forward -285 -276 4.42421 0.265
NP_441884.1_9 Forward -266 -247 -23.895 0.284
NP_441884.1_9 Reverse -278 -297 -23.9933 0.284
NP_442864.1_3 Reverse -104 -123 9.24257 0.208
NP_440314.1_9 Forward -262 -243 -10.3253 0.295
NP_440648.1_1 Reverse -110 -129 2.26107 0.3
NP_442907.1_5 Forward -91 -72 15.9291 0.262
NP_442907.1_9 Forward -268 -249 -0.000545616 0.212
NP_441719.1_2 Reverse -42 -56 14.3095 0.278
NP_441719.1_2 Reverse -251 -265 13.2523 0.286
NP_441719.1_2 Reverse -107 -121 13.1562 0.289
NP_441719.1_4 Forward -262 -255 16.3621 0.0124
NP_441719.1_4 Reverse -255 -262 16.3621 0.0124
NP_441719.1_4 Forward -118 -111 16.3621 0.0124
NP_441719.1_4 Reverse -111 -118 16.3621 0.0124
NP_441733.1_10 Reverse -251 -264 7.09911 0.156
NP_441004.1_1 Reverse -248 -267 11.7008 0.0398
NP_441004.1_1 Forward -386 -367 -10.4236 0.219
NP_441004.1_1 Forward -239 -220 -11.9969 0.243
NP_441004.1_1 Reverse -271 -290 -15.5368 0.275
NP_441004.1_1 Forward -77 -58 -16.1268 0.283
NP_441004.1_4 Forward -383 -373 11.5831 0.254
NP_442366.1_3 Reverse -109 -127 9.85225 0.0535
NP_442366.1_3 Forward -120 -102 5.91901 0.0829
NP_442366.1_3 Forward -264 -246 -1.75081 0.217
NP_442366.1_3 Reverse -276 -294 -4.30741 0.268
NP_442366.1_3 Forward -287 -269 -5.19239 0.284
NP_442366.1_5 Reverse -251 -261 15.4175 0.0374
NP_442366.1_5 Reverse -107 -117 13.3526 0.0775
NP_442139.1_7 Reverse -249 -268 10.9142 0.198
NP_441115.1_4 Forward -287 -269 11.6214 0.133
NP_441115.1_4 Forward -120 -102 7.29487 0.291
NP_442694.1_4 Forward -316 -307 13.3727 0.225
NP_442206.1_10 Reverse -254 -269 3.12649 0.191
NP_443054.1_2 Forward -121 -107 11.0127 0.0761
NP_443054.1_2 Forward -265 -251 1.86788 0.245
NP_441966.1_7 Reverse -169 -188 -0.689632 0.268
NP_441851.1_10 Forward -264 -254 16.008 0.00552
NP_441851.1_10 Reverse -109 -119 16.008 0.00552
NP_441851.1_10 Reverse -253 -263 15.8113 0.00552
NP_441851.1_10 Forward -120 -110 8.53483 0.114
NP_442001.1_1 Reverse -330 -349 -5.60616 0.286
NP_442856.1_7 Forward -272 -253 -0.0988766 0.206
NP_441668.1_4 Reverse -244 -263 4.62101 0.176
NP_441668.1_4 Reverse -280 -299 -0.4922 0.255
NP_441668.1_4 Reverse -100 -119 -0.590531 0.259
NP_442515.1_1 Forward -264 -250 4.62115 0.107
NP_442515.1_1 Reverse -109 -123 0.982901 0.174
NP_442515.1_1 Forward -120 -106 -3.24533 0.289
NP_442515.1_1 Reverse -253 -267 -4.81863 0.298
NP_440593.1_3 Reverse -249 -268 -7.08038 0.285
NP_441046.1_2 Forward -318 -299 8.94757 0.221
NP_441046.1_2 Forward -244 -225 2.16274 0.242
NP_441046.1_2 Reverse -243 -262 -1.37718 0.288
NP_440940.1_7 Forward -273 -255 4.44329 0.254
NP_441349.1_10 Reverse -100 -119 0.196116 0.0902
NP_441349.1_10 Forward -129 -110 -2.16383 0.114
NP_441349.1_10 Forward -273 -254 -7.17871 0.245
NP_441409.1_6 Forward -269 -250 -5.60541 0.108
NP_440432.1_9 Reverse -111 -126 -1.29841 0.167
NP_442843.1_1 Forward -53 -34 -11.9969 0.296
NP_440474.1_8 Reverse -111 -125 12.2903 0.0894
NP_440474.1_8 Forward -118 -104 7.07881 0.21
NP_441477.1_5 Reverse -18 -37 13.2741 0.268
NP_442450.1_5 Forward -121 -111 9.41981 0.115
NP_442450.1_5 Forward -265 -255 9.32148 0.115
NP_442450.1_5 Reverse -252 -262 7.55152 0.13
NP_442450.1_5 Reverse -108 -118 7.55152 0.13
NP_440588.1_2 Reverse -245 -264 0.0977854 0.149
NP_441031.1_8 Forward -250 -231 -3.83545 0.248
NP_440954.1_1 Forward -322 -303 -10.817 0.289
NP_441570.1_1 Reverse -110 -128 7.4923 0.0166
NP_441570.1_1 Reverse -254 -272 -7.45401 0.0895
NP_440078.1_4 Reverse -243 -262 10.0292 0.27
NP_441078.1_4 Forward -263 -254 19.6659 0.0007
NP_441078.1_4 Reverse -254 -263 19.6659 0.0007
NP_441078.1_4 Forward -119 -110 19.6659 0.0007
NP_441078.1_4 Reverse -110 -119 19.6659 0.0007
NP_441078.1_4 Forward -233 -224 6.09625 0.0863
NP_441078.1_4 Reverse -224 -233 -2.06522 0.295
NP_442729.1_8 Reverse -250 -263 10.639 0.125
NP_442729.1_8 Forward -267 -254 8.08242 0.125
NP_440707.1_6 Forward -127 -108 12.9783 0.197
NP_440526.1_3 Forward -262 -251 1.04151 0.267
NP_440526.1_3 Reverse -225 -236 0.64819 0.273
NP_441432.1_8 Reverse -253 -262 16.8143 0.00595
NP_441432.1_8 Forward -120 -111 16.8143 0.00595
NP_441432.1_8 Reverse -109 -118 8.25953 0.0755
NP_441432.1_8 Forward -264 -255 8.25953 0.0755
NP_441432.1_8 Reverse -240 -249 5.21127 0.185
NP_441432.1_8 Forward -234 -225 3.24465 0.252
NP_441432.1_8 Reverse -11 -20 2.65466 0.292
NP_442320.1_8 Forward -269 -255 7.17775 0.0207
NP_442320.1_8 Reverse -104 -118 -2.06536 0.0851
NP_442320.1_8 Forward -125 -111 -2.45868 0.0894
NP_442320.1_8 Reverse -248 -262 -2.55701 0.0913
NP_442344.1_7 Forward -118 -99 2.75272 0.0638
NP_441732.1_2 Forward -267 -251 2.02515 0.0253
NP_441732.1_2 Forward -123 -107 -7.61128 0.0861
NP_441732.1_2 Reverse -106 -122 -16.4611 0.167
NP_441732.1_2 Reverse -220 -236 -16.7561 0.195
NP_441030.1_6 Reverse -108 -127 12.0813 0.248
NP_440760.1_1 Forward -263 -244 20.2556 0.00347
NP_440199.1_10 Forward -122 -112 12.9597 0.114
NP_442353.1_4 Forward -269 -250 -0.39464 0.29
NP_440713.1_4 Forward -129 -110 2.85105 0.256
NP_442489.1_2 Forward -268 -249 8.06259 0.172
NP_442489.1_7 Forward -263 -254 20.1576 0.000695
NP_442489.1_7 Reverse -254 -263 20.1576 0.000695
NP_442489.1_7 Forward -119 -110 20.1576 0.000695
NP_442489.1_7 Reverse -110 -119 20.1576 0.000695
NP_442489.1_7 Forward -233 -224 -1.6719 0.235
NP_442489.1_7 Reverse -224 -233 -1.77023 0.247
NP_442079.1_7 Reverse -255 -274 12.4875 0.084
NP_440559.1_1 Forward -262 -253 17.4043 0.00658
NP_440559.1_1 Reverse -255 -264 8.75118 0.0586
NP_440559.1_1 Forward -118 -109 8.75118 0.0586
NP_440559.1_1 Reverse -111 -120 8.65285 0.0586
NP_441659.2_8 Reverse -110 -120 20.9245 0.000805
NP_441659.2_8 Forward -263 -253 18.1713 0.00133
NP_441659.2_8 Reverse -254 -264 11.9764 0.0147
NP_441659.2_8 Forward -119 -109 11.9764 0.0147
NP_441659.2_8 Forward -286 -276 2.83163 0.187
NP_441659.2_8 Forward -299 -289 1.84832 0.224
NP_442913.1_9 Reverse -248 -267 11.2092 0.199
NP_442913.1_10 Forward -128 -109 -2.26216 0.183
NP_441040.1_2 Reverse -252 -271 -12.2919 0.255
NP_441800.1_3 Reverse -249 -267 3.06741 0.298
NP_441800.1_10 Forward -308 -289 0.884433 0.283
NP_440779.1_5 Forward -119 -102 -14.5141 0.246
NP_442346.1_5 Reverse -253 -263 16.6963 0.00248
NP_442346.1_5 Forward -120 -110 16.303 0.00248
NP_442346.1_5 Forward -264 -254 9.02648 0.118
NP_442346.1_5 Reverse -109 -119 9.02648 0.118
NP_442346.1_5 Reverse -289 -299 4.20827 0.296
NP_440545.1_3 Reverse -250 -267 2.59545 0.0976
NP_440545.1_3 Reverse -106 -123 -4.77938 0.232
NP_441856.1_3 Forward -24 -5 4.916 0.146
NP_441856.1_5 Forward -179 -160 14.8466 0.276
NP_443014.1_4 Forward -373 -354 13.3725 0.198
NP_440831.1_3 Reverse -245 -264 7.35791 0.256
NP_440831.1_3 Forward -41 -22 6.29006 0.275
NP_441629.1_3 Reverse -306 -325 -4.32786 0.29
NP_441923.1_6 Forward -181 -167 9.5377 0.278
NP_440010.1_4 Forward -267 -248 -2.75457 0.289
NP_442551.1_4 Forward -301 -286 6.9614 0.179
NP_442311.1_5 Reverse -19 -38 4.12936 0.245
NP_442603.1_7 Reverse -254 -268 10.6187 0.125
NP_441888.1_7 Forward -268 -254 3.8345 0.225
NP_441948.1_4 Reverse -103 -121 5.91901 0.0698
NP_441833.1_4 Forward -262 -255 15.9687 0.0124
NP_441833.1_4 Reverse -255 -262 15.9687 0.0124
NP_441833.1_4 Forward -118 -111 15.9687 0.0124
NP_441833.1_4 Reverse -111 -118 15.9687 0.0124
NP_441833.1_4 Reverse -278 -285 4.46401 0.256
NP_441112.1_6 Forward -129 -110 2.26107 0.242
NP_442162.1_9 Forward -262 -255 16.2637 0.0124
NP_442162.1_9 Reverse -255 -262 16.2637 0.0124
NP_442162.1_9 Forward -118 -111 16.2637 0.0124
NP_442162.1_9 Reverse -111 -118 16.2637 0.0124
NP_442162.1_9 Forward -249 -242 9.28223 0.0694
NP_440671.1_4 Forward -269 -255 19.4691 0.00937
NP_440671.1_4 Forward -256 -242 13.9626 0.0723
NP_440671.1_4 Forward -332 -318 7.76774 0.208
NP_442199.1_5 Forward -127 -108 8.45592 0.0702
NP_442140.1_3 Forward -118 -108 16.2046 0.0255
NP_442140.1_3 Forward -262 -252 12.2714 0.0632
NP_442140.1_3 Reverse -255 -265 8.33817 0.119
NP_442021.1_3 Reverse -248 -267 13.0775 0.0395
NP_440875.1_9 Reverse -256 -266 9.05339 0.233
NP_441813.1_5 Forward -265 -255 17.188 0.00979
NP_441813.1_5 Forward -121 -111 15.9097 0.01
NP_441813.1_5 Reverse -108 -118 9.91146 0.021
NP_441813.1_5 Reverse -252 -262 8.63316 0.0367
NP_441813.1_5 Forward -252 -242 2.14332 0.199
NP_441227.1_5 Reverse -99 -118 16.3224 0.172
NP_440590.1_4 Forward -118 -105 10.4424 0.027
NP_440590.1_4 Forward -262 -249 7.88576 0.0493
NP_440590.1_4 Reverse -255 -268 6.80412 0.0565
NP_440590.1_4 Forward -285 -272 -1.16069 0.212
NP_440590.1_4 Reverse -111 -124 -5.48725 0.28
NP_440567.1_1 Forward -262 -248 11.701 0.0272
NP_440567.1_1 Reverse -111 -125 8.94771 0.0517
NP_440567.1_1 Reverse -255 -269 7.86607 0.0642
NP_442497.1_10 Reverse -111 -120 17.601 0.00813
NP_442497.1_10 Forward -262 -253 10.4228 0.0087
NP_442497.1_10 Forward -118 -109 10.4228 0.0087
NP_442497.1_10 Reverse -255 -264 10.4228 0.0087
NP_440821.1_4 Forward -265 -255 19.0562 0.00399
NP_440821.1_4 Forward -121 -111 11.0914 0.0146
NP_440821.1_4 Reverse -108 -118 10.2065 0.0163
NP_440821.1_4 Reverse -252 -262 9.41981 0.0286
NP_441239.1_9 Forward -121 -109 14.6903 0.0258
NP_441239.1_9 Forward -265 -253 13.3137 0.037
NP_441239.1_9 Reverse -108 -120 12.3303 0.0477
NP_441239.1_9 Reverse -252 -264 5.93884 0.202
NP_441239.1_9 Reverse -60 -72 3.18557 0.292
NP_441951.1_4 Reverse -271 -290 0.982764 0.29
NP_441009.1_9 Forward -317 -298 13.5691 0.274
NP_441727.1_3 Reverse -247 -266 2.65439 0.299
NP_440400.1_1 Reverse -374 -393 -3.34455 0.294
NP_441892.1_1 Forward -128 -111 0.628827 0.165
NP_442399.1_3 Forward -117 -98 10.8449 0.245
NP_440604.1_6 Reverse -110 -129 -3.3438 0.225
NP_442270.1_9 Reverse -243 -262 -5.9004 0.207
NP_441017.1_8 Forward -302 -287 10.993 0.188
NP_440354.1_7 Forward -125 -107 16.0471 0.167
NP_442052.1_8 Reverse -43 -53 15.5163 0.253
NP_442052.1_8 Reverse -288 -298 13.4514 0.253
NP_440546.1_4 Reverse -110 -120 13.5365 0.0459
NP_440546.1_4 Reverse -254 -264 11.8882 0.0679
NP_440546.1_4 Forward -119 -109 11.8882 0.0679
NP_440546.1_4 Forward -263 -253 10.046 0.109
NP_440546.1_6 Forward -273 -254 7.96426 0.265
NP_441230.1_6 Reverse -172 -191 17.994 0.142
NP_440675.1_1 Reverse -251 -270 6.4893 0.195
NP_440462.1_6 Forward -121 -111 16.893 0.00853
NP_440462.1_6 Forward -265 -255 15.418 0.0142
NP_440462.1_6 Reverse -108 -118 9.02648 0.0498
NP_440462.1_6 Forward -252 -242 3.42162 0.247
NP_440462.1_6 Reverse -252 -262 1.35667 0.294
NP_442592.1_4 Forward -398 -379 17.5024 0.264
NP_440868.1_4 Forward -123 -111 15.4769 0.0164
NP_440868.1_4 Forward -267 -255 8.6921 0.0582
NP_440868.1_4 Reverse -106 -118 8.39711 0.0602
NP_440868.1_4 Reverse -250 -262 8.10212 0.0602
NP_441084.1_6 Forward -121 -107 15.9372 0.0707
NP_440696.1_3 Forward -273 -255 -0.865831 0.249
NP_442039.1_4 Forward -262 -255 15.1821 0.0124
NP_442039.1_4 Reverse -255 -262 15.1821 0.0124
NP_442039.1_4 Forward -118 -111 15.1821 0.0124
NP_442039.1_4 Reverse -111 -118 15.1821 0.0124
NP_441811.1_8 Reverse -248 -262 15.2409 0.162
NP_441926.1_3 Reverse -110 -126 6.05672 0.17
NP_440825.1_7 Forward -262 -252 12.9096 0.152
NP_440825.1_7 Forward -118 -108 12.4217 0.155
NP_442837.1_3 Forward -262 -255 15.7721 0.0124
NP_442837.1_3 Reverse -255 -262 15.7721 0.0124
NP_442837.1_3 Forward -118 -111 15.7721 0.0124
NP_442837.1_3 Reverse -111 -118 15.7721 0.0124
NP_442053.1_1 Forward -263 -254 18.3876 0.0007
NP_442053.1_1 Reverse -254 -263 18.3876 0.0007
NP_442053.1_1 Forward -119 -110 18.3876 0.0007
NP_442053.1_1 Reverse -110 -119 18.3876 0.0007
NP_440505.1_3 Forward -121 -111 15.123 0.014
NP_440505.1_3 Forward -265 -255 13.8447 0.0247
NP_440505.1_3 Reverse -252 -262 9.22315 0.122
NP_440505.1_3 Reverse -108 -118 6.76487 0.169
NP_440505.1_3 Reverse -239 -249 5.28991 0.236
NP_440505.1_3 Forward -35 -25 5.28991 0.236
NP_441701.1_3 Forward -243 -226 11.3469 0.213
NP_441701.1_3 Forward -69 -52 7.11867 0.266
NP_441102.1_1 Reverse -242 -261 4.81767 0.256
NP_441203.1_1 Reverse -255 -274 -11.7019 0.139
NP_441203.1_1 Forward -285 -266 -12.6852 0.144
NP_441203.1_1 Reverse -242 -261 -15.4385 0.229
NP_441203.1_2 Forward -78 -59 -7.67036 0.299
NP_442532.1_4 Forward -344 -326 11.9402 0.223
NP_442532.1_7 Reverse -110 -124 3.44117 0.197
NP_441408.2_7 Forward -265 -246 0.294447 0.228
NP_440914.1_1 Forward -263 -253 17.5935 0.000537
NP_440914.1_1 Reverse -110 -120 16.3248 0.00196
NP_440914.1_1 Forward -119 -109 8.6151 0.186
NP_440914.1_1 Reverse -254 -264 8.6151 0.186
NP_441011.1_8 Forward -118 -109 16.9127 0.00602
NP_441011.1_8 Reverse -255 -264 16.9127 0.00602
NP_441011.1_8 Reverse -111 -120 16.6177 0.00602
NP_441011.1_8 Forward -262 -253 8.25953 0.144
NP_441011.1_8 Reverse -278 -287 5.70292 0.237
NP_442533.1_6 Forward -263 -254 17.2076 0.00137
NP_442533.1_6 Reverse -254 -263 17.2076 0.00137
NP_442533.1_6 Forward -119 -110 17.2076 0.00137
NP_442533.1_6 Reverse -110 -119 17.2076 0.00137
NP_442232.1_3 Forward -68 -49 -8.16202 0.219
NP_442229.1_1 Reverse -252 -266 7.27547 0.196
NP_441482.1_7 Forward -269 -255 0.589577 0.0554
NP_441482.1_7 Forward -125 -111 -1.47537 0.0721
NP_441482.1_7 Reverse -248 -262 -10.7185 0.213
NP_439944.1_9 Reverse -111 -121 17.6796 0.00347
NP_439944.1_9 Forward -262 -252 10.5014 0.0887
NP_439944.1_9 Reverse -255 -265 10.3048 0.0887
NP_442269.1_10 Forward -319 -300 8.65258 0.194
NP_441028.1_6 Reverse -66 -76 6.17443 0.232
NP_440116.1_8 Reverse -255 -274 -5.40875 0.192
NP_440115.1_6 Forward -122 -112 6.46988 0.181
NP_440007.1_9 Forward -267 -253 3.73617 0.267
NP_440007.1_9 Forward -254 -240 2.45787 0.281
NP_439965.1_1 Forward -272 -253 -2.75381 0.177
NP_439965.1_1 Reverse -245 -264 -6.49039 0.214
NP_441347.1_5 Reverse -10 -24 9.83206 0.269
NP_441602.1_3 Reverse -249 -268 -0.885524 0.226
NP_441972.1_5 Forward -285 -266 -3.14714 0.197
NP_441106.1_1 Forward -120 -111 18.486 0.0028
NP_441106.1_1 Reverse -109 -118 18.191 0.0028
NP_441106.1_1 Forward -264 -255 18.191 0.0028
NP_441106.1_1 Reverse -253 -262 9.63616 0.0311
NP_441825.1_4 Reverse -188 -198 10.8948 0.265
NP_441869.1_9 Forward -318 -299 13.6675 0.263
NP_439903.1_6 Forward -266 -247 14.1583 0.0721
NP_442588.1_1 Reverse -311 -330 14.1591 0.143
NP_442928.1_3 Forward -126 -107 15.8021 0.205
NP_442306.1_10 Forward -124 -105 -9.63698 0.11
NP_442306.1_10 Forward -303 -284 -21.9284 0.296
NP_441286.1_1 Reverse -253 -265 14.4936 0.00418
NP_441286.1_1 Reverse -109 -121 4.8572 0.0272
NP_441286.1_1 Forward -264 -252 3.38223 0.0467
NP_441286.1_1 Forward -120 -108 -3.40261 0.145
NP_440670.1_8 Forward -263 -254 18.3876 0.000699
NP_440670.1_8 Reverse -254 -263 18.3876 0.000699
NP_440670.1_8 Forward -119 -110 18.3876 0.000699
NP_440670.1_8 Reverse -110 -119 18.3876 0.000699
NP_441479.1_9 Reverse -31 -49 20.0787 0.112
NP_440886.1_7 Forward -264 -254 17.7774 0.0011
NP_440886.1_7 Reverse -109 -119 17.7774 0.0011
NP_440886.1_7 Forward -120 -110 8.04271 0.0805
NP_440886.1_7 Reverse -253 -263 7.94438 0.0805
NP_440886.1_7 Forward -287 -277 4.50281 0.232
NP_442614.1_2 Forward -263 -249 7.07942 0.275
NP_439995.1_5 Forward -208 -189 5.40766 0.276
NP_442072.1_9 Reverse -223 -241 -12.6655 0.0877
NP_442072.1_9 Reverse -61 -79 -22.9903 0.271
NP_441808.1_2 Forward -334 -315 8.55425 0.235
NP_441808.1_8 Reverse -22 -41 6.88262 0.283
NP_440907.2_8 Forward -118 -108 14.2375 0.0312
NP_440907.2_8 Reverse -111 -121 9.51767 0.103
NP_440907.2_8 Reverse -255 -265 7.84605 0.117
NP_440907.2_8 Forward -262 -252 7.64939 0.117
NP_440664.1_3 Reverse -278 -297 11.3075 0.134
NP_442264.1_2 Reverse -250 -267 4.75873 0.293
NP_441021.1_8 Forward -124 -106 2.18243 0.251
NP_440841.1_4 Forward -121 -102 6.78429 0.0787
NP_440841.1_4 Forward -265 -246 -6.39206 0.215
NP_441463.1_3 Forward -129 -110 7.66927 0.0515
NP_441463.1_3 Reverse -100 -119 -6.09707 0.239
NP_441463.1_6 Reverse -252 -266 5.54623 0.287
NP_441626.1_2 Forward -262 -255 15.7721 0.0124
NP_441626.1_2 Reverse -255 -262 15.7721 0.0124
NP_441626.1_2 Forward -118 -111 15.7721 0.0124
NP_441626.1_2 Reverse -111 -118 15.7721 0.0124
NP_442365.1_7 Forward -267 -248 -4.52377 0.245
NP_440107.1_5 Reverse -253 -272 -0.688862 0.178
NP_442794.1_1 Reverse -273 -285 15.5753 0.0479
NP_442794.1_1 Forward -267 -255 10.1671 0.0721
NP_442794.1_1 Reverse -250 -262 9.28209 0.0795
NP_442794.1_1 Forward -161 -149 2.79224 0.286
NP_442615.1_1 Reverse -101 -119 25.0935 0.00168
NP_442615.1_1 Reverse -245 -263 6.80398 0.0338
NP_442615.1_1 Forward -128 -110 2.47742 0.0675
NP_441962.1_4 Reverse -249 -268 -11.5053 0.241
NP_440387.1_1 Reverse -110 -126 14.9065 0.00603
NP_440387.1_1 Forward -263 -247 13.1366 0.00945
NP_440387.1_1 Forward -119 -103 -1.3181 0.142
NP_440387.1_1 Reverse -254 -270 -2.30141 0.147
NP_441431.1_2 Forward -266 -252 11.5037 0.136
NP_441431.1_2 Forward -122 -108 7.96378 0.23
NP_441431.1_2 Forward -302 -288 5.50552 0.298
NP_441488.1_7 Forward -386 -367 4.03102 0.2
NP_441836.1_2 Reverse -248 -267 -4.52377 0.259
NP_441993.1_1 Reverse -248 -267 4.96787 0.21
NP_441993.1_1 Forward -77 -58 0.484826 0.298
NP_441174.1_2 Forward -122 -108 16.8142 0.062
NP_440114.1_10 Reverse -110 -124 19.3708 0.00349
NP_440114.1_10 Forward -119 -105 9.83269 0.16
NP_440114.1_10 Reverse -290 -304 7.76774 0.227
NP_440114.1_10 Forward -263 -249 7.37441 0.236
NP_442437.1_4 Forward -89 -70 8.16093 0.25
NP_442324.1_7 Reverse -34 -53 6.53351 0.268
NP_441272.1_7 Reverse -248 -258 13.943 0.257
NP_440293.1_3 Forward -315 -296 -2.85214 0.241
NP_440766.1_4 Forward -267 -253 8.25939 0.0871
NP_440766.1_4 Forward -123 -109 6.78443 0.0973
NP_441237.1_9 Forward -262 -252 14.828 0.0242
NP_441237.1_9 Forward -298 -288 10.0098 0.255
NP_439910.1_2 Forward -271 -254 -12.4492 0.0863
NP_439910.1_2 Forward -127 -110 -21.4956 0.183
NP_439910.1_2 Reverse -102 -119 -21.4956 0.183
NP_440457.1_1 Forward -267 -255 8.29878 0.101
NP_440457.1_1 Forward -123 -111 2.0056 0.221
NP_440798.1_6 Forward -118 -105 4.64084 0.144
NP_440798.1_6 Reverse -111 -124 2.87088 0.159
NP_441981.1_3 Forward -202 -188 14.4066 0.268
NP_440801.1_8 Forward -264 -245 5.30933 0.192
NP_441436.1_2 Forward -77 -58 -5.70374 0.294
NP_442509.1_9 Reverse -254 -264 16.2041 0.00739
NP_442509.1_9 Forward -119 -109 16.2041 0.00739
NP_442509.1_9 Forward -263 -253 8.14104 0.192
NP_442509.1_9 Reverse -110 -120 8.04271 0.192
NP_442509.1_9 Reverse -277 -287 6.66608 0.259
NP_440554.1_4 Reverse -111 -121 16.1063 0.0189
NP_440554.1_4 Reverse -255 -265 14.6313 0.02
NP_440554.1_4 Forward -118 -108 7.35486 0.103
NP_441885.1_5 Forward -263 -253 20.9245 0.000538
NP_441885.1_5 Reverse -254 -264 11.4848 0.00668
NP_441885.1_5 Forward -119 -109 11.4848 0.00668
NP_441885.1_5 Reverse -110 -120 11.3864 0.00668
NP_440478.1_10 Reverse -108 -122 7.76774 0.257
NP_442128.1_6 Forward -177 -163 13.9626 0.29
NP_442341.1_7 Reverse -253 -267 17.7975 0.0111
NP_442341.1_7 Forward -264 -250 13.6676 0.0334
NP_442341.1_7 Reverse -223 -237 11.996 0.049
NP_442341.1_9 Reverse -108 -122 12.2903 0.108
NP_442341.1_9 Forward -265 -251 7.07881 0.204
NP_441756.1_5 Reverse -58 -77 -3.83545 0.29
NP_440409.1_1 Reverse -246 -265 -4.22878 0.268
NP_443000.1_7 Forward -121 -111 17.4829 0.00719
NP_443000.1_7 Reverse -252 -262 10.3048 0.0345
NP_443000.1_7 Forward -265 -255 8.73149 0.0437
NP_443000.1_7 Reverse -108 -118 1.94665 0.226
NP_440507.2_3 Forward -272 -253 6.78348 0.299
NP_441842.1_10 Forward -126 -112 9.04604 0.2
NP_441842.1_10 Reverse -103 -117 6.98109 0.27
NP_440275.1_3 Forward -121 -111 9.12481 0.055
NP_440275.1_3 Forward -265 -255 8.4365 0.0602
NP_440275.1_3 Reverse -108 -118 8.33817 0.0602
NP_440275.1_3 Reverse -252 -262 8.04317 0.0602
NP_440275.1_3 Reverse -239 -249 2.92996 0.242
NP_440091.1_1 Forward -123 -111 6.52882 0.095
NP_440091.1_1 Forward -267 -255 1.41561 0.197
NP_440091.1_1 Reverse -106 -118 1.41561 0.197
NP_443060.1_5 Reverse -246 -265 14.5516 0.109
NP_442451.1_2 Reverse -43 -62 -2.85214 0.187
NP_442451.1_2 Reverse -282 -301 -10.3253 0.267
NP_442451.1_2 Reverse -246 -265 -11.5053 0.296
NP_440149.1_8 Reverse -254 -273 -0.000545616 0.143
NP_440149.1_8 Forward -263 -244 -0.688862 0.151
NP_441105.1_3 Reverse -243 -262 7.66927 0.0524
NP_441105.1_3 Forward -261 -242 -7.08038 0.245
NP_440216.1_1 Reverse -110 -124 6.29277 0.0156
NP_440216.1_1 Forward -119 -105 5.50613 0.0196
NP_440216.1_1 Reverse -254 -268 -2.16369 0.0482
NP_440216.1_1 Reverse -12 -26 -4.13031 0.1
NP_440216.1_1 Forward -263 -249 -10.6202 0.145
NP_440216.1_9 Reverse -175 -184 16.5193 0.128
NP_440216.1_9 Forward -181 -172 5.70292 0.29
NP_440172.1_1 Reverse -110 -120 17.5813 0.00421
NP_440172.1_1 Forward -263 -253 15.0247 0.00945
NP_440172.1_1 Reverse -254 -264 8.73149 0.0586
NP_440172.1_1 Forward -119 -109 8.73149 0.0586
NP_440172.1_1 Reverse -290 -300 3.02829 0.251
NP_442015.1_10 Forward -267 -254 19.1938 0.00444
NP_442015.1_10 Forward -290 -277 6.50913 0.114
NP_442015.1_10 Forward -123 -110 1.88757 0.204
NP_442015.1_10 Reverse -106 -119 1.78924 0.204
NP_442015.1_10 Reverse -250 -263 1.39592 0.204
NP_442015.1_10 Reverse -367 -380 -0.767364 0.281
NP_441226.1_7 Forward -262 -255 14.4934 0.0123
NP_441226.1_7 Reverse -255 -262 14.4934 0.0123
NP_441226.1_7 Forward -118 -111 14.4934 0.0123
NP_441226.1_7 Reverse -111 -118 14.4934 0.0123
NP_441111.1_7 Forward -262 -254 18.7023 0.00294
NP_441111.1_7 Forward -118 -110 18.7023 0.00294
NP_441111.1_7 Reverse -255 -263 18.7023 0.00294
NP_441111.1_7 Reverse -111 -119 18.7023 0.00294
NP_442379.1_10 Forward -126 -109 3.87375 0.162
NP_441766.1_2 Forward -263 -254 17.5026 0.00297
NP_441766.1_2 Reverse -254 -263 17.5026 0.00297
NP_441766.1_2 Forward -119 -110 17.5026 0.00297
NP_441766.1_2 Reverse -110 -119 17.5026 0.00297
NP_442417.1_5 Reverse -254 -268 12.1926 0.0981
NP_440416.1_9 Reverse -103 -122 -13.6686 0.169
NP_440416.1_9 Reverse -247 -266 -19.1751 0.27
NP_440416.1_9 Forward -270 -251 -22.0267 0.3
NP_443052.1_8 Forward -129 -110 19.0757 0.00417
NP_443052.1_8 Reverse -100 -119 -6.78538 0.147
NP_443052.1_8 Forward -273 -254 -11.8986 0.241
NP_443052.1_9 Reverse -58 -77 -6.39206 0.282
NP_440591.1_9 Reverse -253 -271 5.62401 0.241
NP_442154.1_1 Forward -391 -373 -2.43913 0.125
NP_442154.1_1 Reverse -246 -264 -14.2388 0.217
NP_442154.1_1 Forward -190 -172 -17.0904 0.249
NP_440261.1_5 Reverse -255 -268 -2.93064 0.0983
NP_440261.1_5 Forward -232 -219 -6.47056 0.201
NP_440261.1_5 Forward -262 -249 -10.3055 0.201
NP_440261.1_5 Forward -118 -105 -12.2721 0.277
NP_440261.1_5 Reverse -111 -124 -12.2721 0.277
NP_440261.1_5 Forward -298 -285 -12.4687 0.297
NP_440988.1_10 Reverse -258 -272 4.02751 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGGAATTGTCTATGTTTGGGGTGTTGGAAGGCGAAGTAGAGATGACTTTGCAAGGTAAGTTTATTGAAACCATTGAGGCCGGAGGCATTTTTGGCATAGGAGCCATTGTCCACAGCGATCATCAAAGGGCTTCCACGGCGATCGCCAAAACCGATTGCAAGTTAGTGGCTATGGACCGGGAACATTTTCTGTTTGCAGTGCAACAAACCCCGATGTTTGCCTTGGAAGTGATCCAGAACTATTCAGACCGCTACCGGAGTTTGAAAGCATTGTACGAGAAGGCGATCGCCGAATAGAACCAAGTCGATTTGGGTTTATGAAAGCCAGAGGACAGGGCGGGGAGAATGCAGTTGCTCAACTTCCTGCGGGAATACGGCCAGTGATAGGCTAGAAAGATAA

CDS

ATGTCAAGCCGTTCTGCGGGGCGGAATTCCCCCATCCTTCCTTTGATGAGCCACTCTGATTTGCCTTTGGCTAACGCTGTCCCCCTCGATAAAATTCGCTACAACGACCAGGGATTAGTGCCGGCGATCGCCCAAGACTATTTGGACGGCACGGTGTTGATGTTGGCCTGGATGAACGAAGCAGCCCTGGCGAAAACCCTAGCCACGGGACAGGTGTGGTATTGGAGTCGTTCCCGCCAAGAACTATGGCATAAGGGAGCAACCTCCGGCCACTTTCAAAAACTTTTGGGCATCCGCTACGACTGCGACAGCGACGCATTATTACTGACCATTGAGCAAAAGGGGGACATTGCCTGCCACACCGGGGAACGGAGTTGTTTCCATCAACTGGACGGCCATAAATCCCCTCCCCCAGCGGATATGTTGACGGAATTGGCTCGGGTCATTGGTGATCGCCGGGATCACCCCACCCCCGAATCCTACACCTGTAAATTATTGGCGGGGGGAGATAATAAAATTCTCAAAAAAATTGGCGAAGAAAGTGCGGAAGTGGTCATGGCTTGCAAAGATGATGACCCGGAAGCCATCGCCGGAGAGGTAGCGGATTTGTTCTACCACACCCTGGTGGCCCTAGCCCATCACAACGTTGATCTACGGGCCGTTTATCGCAAGCTTGGCGATCGTCGCCGTTAA

Protein

MSSRSAGRNSPILPLMSHSDLPLANAVPLDKIRYNDQGLVPAIAQDYLDGTVLMLAWMNEAALAKTLATGQVWYWSRSRQELWHKGATSGHFQKLLGIRYDCDSDALLLTIEQKGDIACHTGERSCFHQLDGHKSPPPADMLTELARVIGDRRDHPTPESYTCKLLAGGDNKILKKIGEESAEVVMACKDDDPEAIAGEVADLFYHTLVALAHHNVDLRAVYRKLGDRRR