Your browser is old and dusty. Try Google Chrome!

Details for slr0601

ORF slr0601
Accession NP_443055.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -308 -294 0.392915 0.211
NP_440795.1_7 Reverse -279 -286 8.00392 0.218
NP_440897.1_6 Forward -110 -91 2.45694 0.165
NP_441453.1_4 Forward -221 -213 5.42762 0.135
NP_441453.1_4 Forward -287 -279 3.85433 0.284
NP_442151.1_6 Reverse -212 -226 9.2427 0.155
NP_442151.1_6 Forward -315 -301 6.58777 0.228
NP_443043.1_7 Reverse -159 -178 14.1591 0.128
NP_442169.1_1 Reverse -266 -285 -1.47551 0.265
NP_440150.1_2 Forward -232 -213 7.37347 0.247
NP_442655.1_10 Reverse -350 -369 -13.8652 0.266
NP_442173.1_7 Forward -203 -184 17.6007 0.19
NP_442752.1_4 Reverse -278 -285 12.1338 0.0546
NP_443027.1_4 Reverse -276 -286 6.27322 0.286
NP_439997.1_4 Forward -149 -130 5.40766 0.287
NP_441812.1_3 Reverse -305 -319 8.06273 0.254
NP_442861.1_1 Forward -326 -307 10.3242 0.295
NP_442861.1_1 Reverse -184 -203 10.3242 0.295
NP_441250.1_3 Reverse -177 -196 3.04771 0.266
NP_441054.1_2 Forward -328 -309 16.6174 0.132
NP_442062.1_8 Forward -348 -338 7.94484 0.0848
NP_442062.1_8 Reverse -278 -288 6.56821 0.123
NP_442062.1_8 Forward -287 -277 3.81494 0.252
NP_442062.1_8 Reverse -161 -171 2.7333 0.297
NP_441995.1_6 Forward -224 -205 17.699 0.23
NP_441802.1_1 Forward -192 -173 6.19431 0.269
NP_441802.1_1 Forward -135 -116 5.89931 0.269
NP_441035.1_3 Forward -225 -206 6.4893 0.209
NP_439902.1_9 Forward -93 -75 16.4404 0.276
NP_440011.1_1 Reverse -93 -112 11.2092 0.286
NP_440916.1_1 Reverse -313 -327 8.65272 0.267
NP_439918.1_2 Reverse -266 -285 -3.14714 0.251
NP_439918.1_2 Reverse -288 -307 -3.3438 0.253
NP_441935.1_1 Reverse -279 -298 11.7008 0.208
NP_440518.1_9 Forward -333 -314 12.0942 0.293
NP_442110.1_2 Reverse -284 -297 16.6465 0.154
NP_442726.1_7 Forward -214 -196 -1.25915 0.293
NP_440769.1_8 Forward -32 -13 6.78429 0.286
NP_440856.1_7 Reverse -195 -214 -2.95047 0.193
NP_441434.1_1 Forward -19 -5 19.8739 0.0521
NP_441434.1_1 Reverse -5 -19 19.3965 0.0588
NP_441434.1_3 Forward -225 -206 -3.54046 0.292
NP_441738.1_2 Forward -183 -176 10.2652 0.101
NP_441558.1_5 Reverse -210 -229 5.60432 0.245
NP_440178.1_7 Forward -222 -203 -21.6334 0.232
NP_441792.1_5 Forward -308 -292 14.8082 0.172
NP_441716.1_1 Forward -297 -283 4.52282 0.255
NP_441716.1_2 Forward -139 -120 1.53728 0.251
NP_441163.1_9 Forward -362 -343 13.3725 0.236
NP_440747.1_10 Forward -210 -198 -11.9574 0.178
NP_441130.1_10 Forward -223 -209 5.01447 0.251
NP_442634.1_4 Reverse -292 -306 2.06454 0.147
NP_440470.1_5 Reverse -2 -21 6.73176 0.279
NP_442848.1_5 Reverse -212 -230 9.95058 0.232
NP_442848.1_9 Forward -302 -283 8.25926 0.182
NP_441012.1_4 Forward -211 -198 7.00078 0.272
NP_441012.1_4 Forward -232 -219 5.62415 0.291
NP_443018.1_3 Forward -220 -213 10.6589 0.0967
NP_443018.1_3 Reverse -213 -220 4.16902 0.278
NP_443018.1_3 Reverse -279 -286 4.07068 0.299
NP_441634.1_8 Reverse -193 -207 7.86607 0.114
NP_440376.1_1 Reverse -278 -287 3.83464 0.19
NP_442687.1_7 Reverse -106 -116 11.3864 0.0994
NP_442687.1_7 Reverse -211 -221 5.09324 0.221
NP_441077.1_2 Forward -259 -240 4.91741 0.224
NP_442589.1_1 Reverse -175 -194 22.5172 0.0279
NP_442485.1_3 Forward -314 -295 -0.295539 0.252
NP_442485.1_3 Forward -224 -205 -2.0655 0.261
NP_442485.1_3 Reverse -199 -218 -4.42544 0.28
NP_442485.1_3 Reverse -159 -178 -6.1954 0.299
NP_441846.1_10 Forward -339 -320 -22.3217 0.259
NP_442530.1_2 Reverse -130 -140 15.713 0.203
NP_440642.1_10 Reverse -316 -330 2.8506 0.277
NP_440691.1_10 Forward -218 -199 8.55425 0.269
NP_440667.1_9 Forward -109 -90 13.9625 0.27
NP_442296.1_9 Forward -191 -172 -4.42544 0.273
NP_440360.1_10 Forward -301 -287 2.2612 0.267
NP_442658.1_1 Reverse -276 -286 6.46942 0.229
NP_442782.1_2 Forward -323 -309 5.60446 0.239
NP_442782.1_2 Reverse -176 -190 3.44117 0.265
NP_442496.1_5 Reverse -100 -118 4.14905 0.295
NP_440184.1_7 Reverse -237 -256 13.4144 0.28
NP_441958.1_5 Reverse -211 -221 -1.3966 0.239
NP_441137.1_2 Forward -274 -260 18.3446 0.228
NP_440203.1_5 Forward -306 -296 11.2876 0.2
NP_439905.1_1 Forward -212 -199 7.00078 0.269
NP_439905.1_2 Forward -218 -204 11.2093 0.208
NP_439905.1_2 Forward -115 -101 10.3243 0.214
NP_439905.1_2 Forward -233 -219 8.84938 0.241
NP_440984.1_7 Forward -226 -212 6.29277 0.219
NP_442690.1_1 Reverse -12 -31 -8.26035 0.185
NP_442911.1_2 Reverse -202 -221 -10.1286 0.27
NP_443055.1_1 Forward -84 -65 34.1203 0.00000228
NP_443055.1_3 Forward -296 -277 13.7963 0.156
NP_443055.1_6 Forward -221 -203 27.9443 0.000507
NP_443055.1_6 Forward -295 -277 3.26332 0.199
NP_440471.1_10 Reverse -53 -72 19.9606 0.156
NP_440827.1_8 Reverse -334 -352 26.2735 0.00833
NP_442002.1_1 Reverse -269 -287 -4.99573 0.229
NP_442002.1_9 Reverse -175 -182 9.47889 0.282
NP_441000.1_6 Reverse -277 -291 3.34284 0.113
NP_441000.1_6 Reverse -160 -174 0.589577 0.191
NP_442771.1_1 Forward -118 -100 7.19731 0.0505
NP_440147.1_4 Forward -289 -276 2.57589 0.207
NP_441550.1_8 Reverse -210 -220 12.1726 0.0361
NP_441550.1_8 Forward -223 -213 6.96107 0.183
NP_441916.1_7 Reverse -278 -288 3.91327 0.198
NP_441916.1_10 Forward -175 -156 5.11266 0.216
NP_440206.1_9 Reverse -260 -279 11.8975 0.272
NP_440206.1_9 Reverse -170 -189 7.07928 0.293
NP_440681.1_5 Forward -335 -316 19.764 0.0221
NP_441041.1_4 Reverse -201 -220 -11.8003 0.252
NP_441041.1_4 Reverse -294 -313 -12.7836 0.274
NP_441041.1_7 Forward -290 -278 6.15429 0.221
NP_440703.1_9 Reverse -101 -114 5.42692 0.293
NP_440703.1_9 Forward -296 -283 4.54195 0.296
NP_441725.1_5 Reverse -213 -223 -0.511621 0.26
NP_442941.1_4 Forward -327 -308 9.93088 0.159
NP_440674.1_1 Forward -84 -65 23.7955 0.00724
NP_440983.1_5 Reverse -213 -232 -7.76869 0.291
NP_441076.1_5 Reverse -333 -352 19.7631 0.196
NP_440260.1_8 Forward -82 -64 -2.63579 0.245
NP_441678.1_4 Forward -178 -159 17.699 0.16
NP_441678.1_9 Reverse -266 -285 -1.08219 0.238
NP_442281.1_1 Forward -292 -278 14.8469 0.0155
NP_442281.1_1 Forward -226 -212 6.39049 0.127
NP_442281.1_1 Reverse -289 -303 1.5723 0.296
NP_440177.1_9 Reverse -270 -289 12.0942 0.238
NP_442256.1_2 Reverse -210 -228 -8.33898 0.221
NP_441644.1_6 Forward -221 -211 11.2876 0.0524
NP_441644.1_6 Reverse -294 -304 3.51951 0.277
NP_442215.1_2 Reverse -291 -307 -0.334789 0.166
NP_442215.1_2 Forward -169 -153 -2.98973 0.207
NP_442215.1_2 Reverse -252 -268 -5.34967 0.249
NP_442215.1_2 Reverse -217 -233 -7.11963 0.286
NP_440929.1_8 Forward -221 -212 4.91628 0.162
NP_442933.1_10 Reverse -278 -287 4.62128 0.227
NP_441310.1_10 Forward -326 -316 16.9581 0.0807
NP_442554.1_8 Reverse -213 -223 10.7964 0.043
NP_442554.1_8 Forward -302 -292 9.41981 0.0594
NP_442554.1_8 Forward -286 -276 3.22496 0.235
NP_442554.1_8 Forward -220 -210 2.7333 0.259
NP_442970.1_3 Forward -32 -14 15.0309 0.168
NP_441762.1_7 Forward -288 -276 -5.76255 0.238
NP_441762.1_7 Forward -171 -159 -5.76255 0.238
NP_442292.1_5 Forward -121 -102 3.24438 0.257
NP_440919.1_1 Reverse -207 -226 -7.57203 0.278
NP_442381.1_8 Forward -290 -271 0.392778 0.119
NP_442381.1_8 Reverse -267 -286 -14.7502 0.284
NP_442381.1_9 Forward -262 -243 14.6508 0.202
NP_443009.1_5 Forward -288 -277 4.28642 0.254
NP_442301.1_2 Reverse -218 -237 8.35677 0.23
NP_442741.1_1 Forward -221 -202 6.78429 0.14
NP_440183.1_9 Reverse -280 -299 -21.1417 0.296
NP_440379.1_5 Forward -222 -203 -0.0988766 0.182
NP_440379.1_5 Reverse -161 -180 -11.7019 0.3
NP_441468.1_1 Reverse -279 -286 10.2655 0.0906
NP_441468.1_1 Forward -220 -213 3.97235 0.277
NP_441015.1_8 Forward -309 -290 1.67108 0.272
NP_441015.1_10 Forward -233 -214 -11.2103 0.292
NP_440672.1_1 Reverse -96 -114 17.0304 0.215
NP_441826.1_2 Reverse -213 -227 1.96621 0.137
NP_441826.1_5 Reverse -159 -178 2.85105 0.276
NP_442719.1_2 Reverse -246 -264 1.39504 0.162
NP_442719.1_2 Reverse -303 -321 -8.14302 0.242
NP_442719.1_2 Forward -19 -1 -10.7979 0.283
NP_442808.1_1 Forward -288 -278 4.7978 0.19
NP_442808.1_1 Forward -98 -88 1.15957 0.292
NP_441101.1_3 Reverse -283 -302 11.7992 0.293
NP_442775.1_6 Forward -233 -214 15.8307 0.236
NP_440145.1_3 Forward -238 -219 -3.14714 0.189
NP_440558.1_2 Forward -312 -293 -5.21209 0.254
NP_441878.1_6 Forward -222 -212 1.65166 0.0795
NP_441878.1_6 Reverse -293 -303 0.668351 0.139
NP_441878.1_6 Forward -214 -204 -0.0199663 0.163
NP_441878.1_6 Reverse -211 -221 -0.314959 0.174
NP_441878.1_6 Reverse -197 -207 -7.00147 0.201
NP_441878.1_6 Reverse -106 -116 -7.19813 0.21
NP_441878.1_6 Reverse -100 -110 -7.19813 0.21
NP_441878.1_6 Forward -117 -107 -7.68978 0.255
NP_441557.1_5 Reverse -278 -287 -0.786921 0.239
NP_441557.1_8 Forward -286 -276 12.9592 0.23
NP_441445.1_1 Reverse -192 -211 -0.39387 0.291
NP_442267.1_4 Reverse -286 -305 0.786102 0.285
NP_441433.1_8 Forward -275 -256 -3.73712 0.283
NP_442419.1_2 Forward -292 -273 -2.16383 0.247
NP_440101.1_3 Forward -190 -171 0.392778 0.299
NP_442135.1_5 Forward -296 -278 24.9944 0.00318
NP_441574.1_1 Forward -225 -206 -5.40875 0.26
NP_442347.1_2 Forward -169 -160 12.3894 0.056
NP_442347.1_2 Forward -286 -277 4.52295 0.282
NP_440547.1_1 Reverse -223 -242 12.88 0.168
NP_441037.1_4 Forward -223 -213 12.0931 0.114
NP_441633.1_3 Forward -172 -159 -5.78224 0.236
NP_440136.1_2 Reverse -279 -286 4.26735 0.218
NP_442998.1_5 Forward -323 -313 14.7297 0.149
NP_442998.1_10 Forward -114 -107 3.97235 0.297
NP_440299.1_1 Reverse -103 -116 3.46031 0.243
NP_442802.1_6 Reverse -257 -276 -0.590531 0.204
NP_442333.2_5 Forward -232 -213 -13.5702 0.259
NP_440256.1_1 Forward -290 -271 -5.99873 0.198
NP_440256.1_1 Forward -351 -332 -8.94866 0.27
NP_441229.1_3 Forward -296 -284 18.1319 0.248
NP_441090.1_6 Reverse -260 -274 8.06273 0.28
NP_442007.1_8 Forward -214 -196 9.85146 0.269
NP_442158.1_4 Forward -272 -262 10.6981 0.283
NP_442452.1_3 Forward -314 -295 3.24438 0.267
NP_441464.1_8 Forward -207 -193 9.5377 0.189
NP_441939.1_3 Forward -286 -267 5.30933 0.28
NP_441199.1_6 Reverse -203 -222 2.16274 0.198
NP_442993.1_1 Reverse -306 -322 -10.7579 0.226
NP_442386.1_9 Forward -288 -279 12.4873 0.0591
NP_442386.1_9 Reverse -277 -286 12.094 0.075
NP_440570.1_5 Forward -279 -260 -3.93378 0.298
NP_441340.1_5 Reverse -213 -220 11.3472 0.0526
NP_442791.1_5 Forward -178 -159 -8.16202 0.279
NP_442791.1_5 Forward -295 -276 -11.4069 0.29
NP_440168.1_4 Forward -217 -198 -7.76869 0.296
NP_440327.1_6 Forward -345 -326 7.47261 0.228
NP_440327.1_6 Reverse -201 -220 2.94938 0.285
NP_440586.1_1 Reverse -194 -213 4.03102 0.202
NP_440586.1_1 Reverse -169 -188 -3.63879 0.272
NP_440586.1_8 Forward -220 -213 5.74197 0.283
NP_443051.1_1 Reverse -211 -220 3.24465 0.123
NP_439937.1_9 Forward -211 -194 -8.90993 0.177
NP_442294.1_3 Forward -280 -266 11.897 0.297
NP_440408.1_1 Forward -220 -201 4.81767 0.227
NP_440439.1_1 Reverse -275 -288 2.08423 0.138
NP_440819.1_5 Forward -324 -316 7.98423 0.228
NP_440316.1_10 Reverse -100 -110 8.23984 0.24
NP_442416.1_1 Reverse -5 -24 6.92274 0.255
NP_440267.1_2 Forward -292 -278 11.9953 0.125
NP_442384.1_10 Forward -170 -157 1.19926 0.267
NP_442262.1_10 Forward -220 -213 12.0355 0.062
NP_442244.1_6 Reverse -158 -177 4.22769 0.291
NP_440531.1_6 Forward -295 -276 -2.36049 0.249
NP_440531.1_6 Reverse -93 -112 -2.95047 0.26
NP_442556.1_10 Forward -85 -66 16.852 0.136
NP_440297.1_9 Reverse -213 -223 0.176696 0.282
NP_440297.1_9 Forward -302 -292 -0.118297 0.282
NP_440297.1_9 Forward -220 -210 -0.314959 0.282
NP_440297.1_9 Reverse -295 -305 -0.314959 0.282
NP_441896.1_5 Reverse -287 -294 15.3787 0.268
NP_440888.1_2 Forward -287 -273 11.1104 0.0757
NP_440888.1_2 Reverse -219 -233 7.96378 0.175
NP_439969.1_3 Reverse -160 -179 -0.4922 0.271
NP_442948.1_6 Forward -209 -190 15.7324 0.268
NP_442033.1_10 Reverse -217 -236 -12.6852 0.274
NP_441543.1_2 Forward -286 -277 6.5879 0.143
NP_441304.1_10 Forward -39 -30 14.0611 0.213
NP_441178.1_6 Forward -113 -94 15.0432 0.177
NP_441469.1_8 Forward -288 -279 6.5879 0.227
NP_441469.1_8 Reverse -277 -286 5.60459 0.258
NP_441462.1_2 Reverse -212 -222 -1.29827 0.299
NP_443062.1_1 Forward -287 -269 6.40076 0.202
NP_443062.1_1 Reverse -294 -312 3.57305 0.293
NP_440939.1_5 Reverse -97 -113 11.3666 0.273
NP_440349.1_3 Reverse -220 -239 11.0117 0.282
NP_440519.1_3 Reverse -89 -108 7.7676 0.285
NP_440519.1_8 Reverse -294 -310 1.73016 0.279
NP_442204.1_1 Forward -47 -36 3.89358 0.266
NP_442204.1_5 Reverse -97 -116 8.16093 0.122
NP_440516.1_6 Forward -213 -199 10.6187 0.226
NP_442428.1_5 Reverse -279 -286 4.66067 0.244
NP_442428.1_5 Forward -220 -213 4.36568 0.271
NP_441443.1_1 Reverse -202 -221 -6.09707 0.3
NP_441443.1_10 Forward -366 -348 2.28001 0.275
NP_441267.1_1 Forward -80 -61 2.3594 0.243
NP_442120.1_10 Reverse -213 -232 -5.50708 0.2
NP_442219.1_8 Forward -265 -246 7.39404 0.267
NP_440436.1_4 Forward -286 -277 12.2907 0.038
NP_442412.1_5 Reverse -174 -193 4.62101 0.294
NP_441086.1_3 Reverse -299 -318 13.0564 0.118
NP_441086.1_4 Reverse -160 -177 21.18 0.124
NP_441004.1_1 Reverse -347 -366 -8.06369 0.2
NP_441004.1_1 Reverse -288 -307 -10.1286 0.218
NP_441004.1_1 Reverse -192 -211 -12.4886 0.247
NP_441004.1_1 Forward -339 -320 -16.8151 0.287
NP_441004.1_2 Reverse -342 -361 -2.95047 0.269
NP_441004.1_4 Reverse -350 -360 9.02648 0.259
NP_442366.1_3 Reverse -211 -229 -2.83245 0.234
NP_443029.1_8 Forward -234 -215 11.7008 0.293
NP_442206.1_10 Reverse -294 -309 2.33984 0.202
NP_440328.1_4 Forward -227 -208 7.66927 0.123
NP_440094.1_8 Reverse -80 -99 2.16274 0.242
NP_443054.1_2 Forward -230 -216 0.294584 0.269
NP_441851.1_9 Reverse -341 -360 8.25926 0.267
NP_441851.1_10 Reverse -277 -287 14.4347 0.016
NP_441851.1_10 Forward -222 -212 5.97822 0.19
NP_442208.1_5 Reverse -92 -111 -3.93378 0.258
NP_442622.1_1 Forward -222 -203 -12.8819 0.281
NP_441668.1_4 Reverse -188 -207 -1.27885 0.271
NP_442515.1_1 Forward -222 -208 1.47456 0.158
NP_442515.1_1 Forward -208 -194 -3.63866 0.295
NP_440463.1_8 Forward -223 -204 4.98276 0.294
NP_441046.1_2 Forward -144 -125 0.786102 0.262
NP_440432.1_9 Reverse -279 -294 -5.13331 0.236
NP_442843.1_1 Reverse -262 -281 -7.08038 0.245
NP_442843.1_1 Reverse -279 -298 -10.9153 0.282
NP_442843.1_1 Forward -328 -309 -11.2103 0.286
NP_439960.1_10 Reverse -203 -221 -1.84914 0.246
NP_441124.1_5 Reverse -9 -19 12.6262 0.216
NP_441124.1_5 Forward -15 -5 12.3397 0.225
NP_442168.1_5 Forward -220 -201 -1.7705 0.264
NP_440588.1_2 Forward -119 -100 -5.70374 0.259
NP_440195.1_5 Reverse -206 -225 6.88262 0.192
NP_442006.1_2 Reverse -203 -220 -17.1691 0.27
NP_442006.1_2 Reverse -101 -118 -18.3491 0.29
NP_441003.1_9 Forward -119 -100 3.04771 0.3
NP_440483.1_1 Reverse -94 -113 -4.81876 0.221
NP_442038.1_1 Reverse -180 -199 8.45592 0.129
NP_441078.1_4 Forward -116 -107 -1.18024 0.237
NP_441078.1_4 Forward -287 -278 -1.96689 0.282
NP_441528.1_2 Reverse -284 -303 11.7 0.251
NP_441528.1_5 Forward -299 -285 18.9768 0.14
NP_442348.1_2 Forward -36 -27 6.8829 0.298
NP_441432.1_9 Reverse -241 -254 11.3132 0.232
NP_442157.1_1 Reverse -69 -88 22.4189 0.0114
NP_440760.1_7 Forward -20 -1 7.07848 0.192
NP_440199.1_10 Reverse -356 -366 13.4514 0.108
NP_442489.1_7 Forward -221 -212 -1.47524 0.203
NP_442489.1_7 Reverse -278 -287 -1.6719 0.235
NP_441830.1_2 Reverse -279 -298 -1.47551 0.26
NP_440559.1_1 Reverse -213 -222 4.91628 0.175
NP_441659.2_8 Forward -221 -211 3.12662 0.172
NP_441092.1_6 Reverse -196 -215 5.211 0.297
NP_442913.1_10 Reverse -203 -222 0.0977854 0.156
NP_440029.1_9 Reverse -283 -302 21.5339 0.125
NP_442346.1_5 Reverse -352 -362 6.46988 0.201
NP_442346.1_5 Forward -222 -212 6.07655 0.216
NP_442346.1_5 Reverse -358 -368 5.09324 0.262
NP_442346.1_5 Reverse -293 -303 5.09324 0.262
NP_442346.1_10 Reverse -159 -178 3.24438 0.194
NP_440352.1_5 Reverse -96 -115 11.6824 0.254
NP_440545.1_3 Forward -225 -208 2.98877 0.0903
NP_440545.1_3 Reverse -208 -225 -5.76269 0.259
NP_440831.1_3 Forward -224 -205 7.74622 0.245
NP_440459.1_2 Forward -230 -213 9.18362 0.233
NP_441653.1_2 Reverse -267 -286 5.65556 0.243
NP_441653.1_4 Forward -344 -332 18.0335 0.26
NP_440010.1_3 Reverse -88 -107 -7.67036 0.286
NP_440010.1_4 Forward -238 -219 0.0970122 0.25
NP_440010.1_10 Forward -114 -95 7.57094 0.226
NP_441943.1_8 Reverse -257 -276 4.22769 0.164
NP_442311.1_5 Reverse -174 -193 4.62101 0.245
NP_442603.1_9 Forward -310 -292 5.13236 0.293
NP_441585.1_6 Forward -204 -185 18.0915 0.147
NP_441888.1_7 Forward -292 -278 2.06454 0.229
NP_441050.1_5 Forward -40 -22 1.98577 0.225
NP_440449.1_6 Reverse -196 -214 5.14342 0.283
NP_441948.1_4 Forward -294 -276 -1.65248 0.148
NP_441895.1_2 Reverse -262 -281 -26.7466 0.247
NP_441112.1_8 Reverse -14 -33 2.85105 0.232
NP_440671.1_1 Reverse -9 -28 8.33225 0.204
NP_440671.1_4 Forward -216 -202 5.70279 0.275
NP_441044.1_4 Reverse -24 -42 1.29745 0.274
NP_440772.1_8 Forward -302 -283 9.53756 0.253
NP_442045.1_5 Forward -113 -94 -0.4922 0.269
NP_442199.1_5 Reverse -270 -289 -6.09707 0.263
NP_442140.1_3 Forward -220 -210 12.7631 0.0632
NP_440875.1_9 Forward -183 -173 9.54007 0.233
NP_441813.1_5 Reverse -276 -286 -0.0199663 0.227
NP_439901.1_5 Reverse -169 -188 2.65439 0.273
NP_442497.1_10 Reverse -213 -222 0.29472 0.199
NP_440821.1_4 Reverse -210 -220 -0.609952 0.279
NP_440821.1_10 Reverse -244 -262 16.185 0.284
NP_441239.1_9 Forward -305 -293 11.642 0.0572
NP_441239.1_9 Reverse -210 -222 8.88877 0.12
NP_441239.1_9 Forward -223 -211 8.39711 0.134
NP_441239.1_9 Reverse -276 -288 8.29878 0.137
NP_441239.1_9 Forward -215 -203 6.62715 0.182
NP_441239.1_9 Forward -289 -277 5.93884 0.202
NP_441239.1_9 Reverse -163 -175 5.34885 0.223
NP_441892.1_1 Reverse -285 -302 -4.77938 0.268
NP_440833.1_6 Forward -23 -9 12.9786 0.175
NP_440354.1_7 Reverse -206 -224 10.8356 0.224
NP_442138.1_10 Reverse -278 -297 1.67108 0.121
NP_440546.1_4 Reverse -278 -288 9.65817 0.126
NP_440546.1_6 Forward -195 -176 7.7676 0.267
NP_440462.1_6 Reverse -276 -286 5.78156 0.138
NP_442340.1_3 Forward -220 -201 -7.57203 0.236
NP_442340.1_3 Forward -211 -192 -10.522 0.289
NP_442479.1_9 Reverse -179 -198 -7.96535 0.266
NP_442402.1_4 Forward -122 -103 -8.06442 0.278
NP_442402.1_9 Reverse -161 -180 14.5524 0.18
NP_440036.1_10 Reverse -287 -299 13.9036 0.284
NP_441848.1_7 Reverse -310 -329 5.80018 0.209
NP_441848.1_7 Reverse -311 -330 3.04693 0.217
NP_441084.1_6 Reverse -99 -113 10.2167 0.25
NP_439942.1_7 Forward -277 -258 -5.70374 0.279
NP_440696.1_3 Reverse -278 -296 4.34571 0.198
NP_440696.1_3 Reverse -161 -179 -1.45582 0.259
NP_442679.1_2 Forward -337 -318 8.16093 0.247
NP_440160.1_2 Reverse -266 -285 -9.047 0.293
NP_440505.1_3 Reverse -276 -286 6.07655 0.197
NP_440351.1_1 Reverse -181 -200 2.16274 0.15
NP_440351.1_1 Forward -135 -116 0.786102 0.19
NP_441102.1_2 Forward -44 -25 14.2574 0.159
NP_441536.1_1 Forward -269 -250 9.43923 0.298
NP_442532.1_1 Reverse -5 -19 9.14183 0.284
NP_441011.1_8 Forward -169 -160 7.07956 0.179
NP_441011.1_8 Reverse -279 -288 5.11294 0.283
NP_442533.1_6 Forward -287 -278 7.07956 0.0964
NP_442533.1_6 Reverse -278 -287 4.42462 0.179
NP_442533.1_6 Forward -221 -212 3.93297 0.197
NP_442533.1_6 Forward -207 -198 2.94966 0.232
NP_442541.1_10 Forward -110 -96 3.14559 0.254
NP_442541.1_10 Forward -222 -208 1.47397 0.286
NP_442232.1_3 Forward -193 -174 -12.4886 0.282
NP_442232.1_3 Reverse -157 -176 -15.8318 0.296
NP_442322.1_4 Forward -112 -95 -9.30325 0.29
NP_442229.1_1 Reverse -252 -266 8.84875 0.184
NP_441482.1_7 Reverse -101 -115 -11.3085 0.254
NP_441028.1_6 Reverse -315 -325 5.48612 0.255
NP_441028.1_6 Reverse -31 -41 3.8145 0.281
NP_441028.1_6 Forward -113 -103 3.51951 0.292
NP_440721.1_5 Forward -206 -187 11.2084 0.195
NP_442202.1_10 Forward -214 -200 8.45605 0.255
NP_441527.1_4 Forward -253 -234 -10.0748 0.264
NP_441527.1_4 Forward -158 -139 -12.9396 0.296
NP_441347.1_5 Forward -175 -161 8.75042 0.283
NP_440608.1_6 Forward -220 -201 5.11187 0.255
NP_441972.1_5 Reverse -166 -185 -10.0303 0.296
NP_441106.1_1 Reverse -277 -286 5.3096 0.162
NP_442674.1_2 Forward -25 -6 8.75091 0.244
NP_440670.1_8 Reverse -212 -221 5.01461 0.175
NP_440670.1_8 Forward -221 -212 4.22796 0.202
NP_440886.1_7 Forward -288 -278 6.0761 0.147
NP_441399.1_10 Reverse -86 -105 14.8474 0.209
NP_442401.1_2 Reverse -203 -222 9.43841 0.206
NP_441753.1_10 Reverse -203 -222 6.98095 0.186
NP_440223.1_7 Reverse -102 -116 19.9608 0.146
NP_440028.1_6 Reverse -214 -232 11.1305 0.274
NP_440907.2_8 Forward -220 -210 6.0761 0.179
NP_440907.2_9 Reverse -22 -41 1.96529 0.291
NP_439967.1_4 Forward -291 -277 18.7808 0.23
NP_441021.1_8 Reverse -273 -291 2.67408 0.241
NP_440176.1_3 Reverse -319 -333 13.2736 0.261
NP_441463.1_5 Reverse -160 -174 12.9793 0.188
NP_441463.1_5 Reverse -277 -291 11.0127 0.249
NP_442211.1_3 Forward -209 -190 10.0008 0.257
NP_442467.1_2 Forward -200 -181 18.9773 0.181
NP_440855.1_2 Forward -181 -162 11.7983 0.299
NP_441431.1_2 Reverse -209 -223 7.27547 0.244
NP_441431.1_2 Reverse -216 -230 6.68548 0.263
NP_442020.1_1 Forward -20 -1 0.195343 0.257
NP_441836.1_2 Forward -176 -157 -6.49039 0.298
NP_441993.1_1 Reverse -213 -232 5.74752 0.195
NP_441993.1_1 Reverse -158 -177 1.65431 0.273
NP_440114.1_10 Reverse -278 -292 9.04604 0.186
NP_440114.1_10 Forward -221 -207 8.84938 0.192
NP_440725.1_4 Forward -366 -347 9.0459 0.118
NP_440293.1_10 Reverse -195 -214 -1.86883 0.271
NP_440766.1_5 Forward -27 -15 7.46481 0.29
NP_439988.1_3 Reverse -208 -222 10.1277 0.233
NP_441237.1_9 Reverse -213 -223 14.1397 0.0488
NP_442743.1_4 Forward -109 -90 -1.7705 0.203
NP_442930.1_1 Reverse -310 -320 9.81266 0.28
NP_442867.1_8 Forward -220 -201 3.93269 0.295
NP_440457.1_1 Reverse -208 -220 -0.354346 0.262
NP_440457.1_1 Reverse -97 -109 -1.23932 0.3
NP_440798.1_6 Reverse -213 -226 12.704 0.0468
NP_440798.1_6 Forward -220 -207 10.2457 0.0785
NP_442297.1_3 Reverse -206 -225 9.04509 0.27
NP_441436.1_8 Reverse -266 -285 7.07928 0.293
NP_440473.1_9 Forward -298 -279 -9.53865 0.261
NP_442509.1_5 Forward -294 -277 13.7061 0.259
NP_440554.1_4 Forward -286 -276 3.71661 0.217
NP_442862.1_3 Reverse -180 -197 9.08529 0.232
NP_440628.1_3 Forward -24 -10 15.0442 0.288
NP_442703.1_9 Forward -142 -124 3.26407 0.297
NP_441756.1_5 Forward -279 -260 -4.72043 0.295
NP_441756.1_5 Forward -101 -82 -5.11376 0.298
NP_441173.1_9 Reverse -316 -324 9.75379 0.284
NP_442395.2_4 Reverse -175 -194 2.55527 0.221
NP_440275.1_3 Reverse -210 -220 7.25653 0.0823
NP_442932.1_9 Forward -269 -250 3.6377 0.298
NP_442354.1_2 Reverse -196 -215 11.7992 0.257
NP_442275.1_1 Forward -119 -100 3.14605 0.284
NP_441902.1_1 Forward -177 -158 11.11 0.282
NP_440679.1_10 Reverse -197 -216 -11.3086 0.182
NP_439962.1_4 Forward -221 -202 -4.81876 0.272
NP_439962.1_4 Forward -178 -159 -7.27704 0.288
NP_440804.1_4 Forward -128 -119 15.6344 0.226
NP_441105.1_3 Reverse -283 -302 -7.17871 0.248
NP_441105.1_3 Reverse -208 -227 -7.67036 0.258
NP_442373.1_2 Forward -330 -311 -7.37537 0.233
NP_442373.1_2 Reverse -195 -214 -8.55534 0.249
NP_440216.1_1 Forward -221 -207 -5.31028 0.126
NP_440216.1_1 Forward -110 -96 -11.4068 0.184
NP_440216.1_9 Reverse -263 -272 8.25953 0.286
NP_440172.1_1 Forward -221 -211 4.0116 0.208
NP_442015.1_10 Reverse -263 -276 -0.767364 0.281
NP_441226.1_7 Reverse -213 -220 12.4284 0.0404
NP_441226.1_7 Forward -286 -279 11.2485 0.0971
NP_441226.1_7 Reverse -321 -328 5.64364 0.286
NP_440244.1_1 Forward -337 -318 -0.590531 0.188
NP_441177.1_7 Forward -297 -278 9.83173 0.279
NP_440416.1_9 Reverse -292 -311 -20.8467 0.289
NP_443052.1_8 Reverse -202 -221 -1.27885 0.0786
NP_443052.1_8 Forward -297 -278 -11.0136 0.221
NP_442116.1_6 Forward -32 -15 8.35994 0.253
NP_440261.1_5 Forward -220 -207 -4.7006 0.165
NP_440261.1_5 Reverse -213 -226 -12.4687 0.297
NP_440988.1_10 Forward -224 -210 7.7064 0.215
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCACAACGGGTTTGATCAACATGGGTTCTGTGTACCATAACCATTACCTCAAGGGCATTGAAGGTTTGGAATGGGACGGGGAAAATTTGGTCACCAATGACATGGCCCAAACCAGCCATCCCCGGATCTTTGCCCTGGGAGATTTGAAAAAAGGTTTAAACCAGGTATCCGTAGCAGTGGCCGATGGCACCCTGGCCGCCACCCAAATTTGGCGCAACATTCGCCGGGCCAGTGAACCCCGCAAATGGATTCATTAGATAAATTATTGGCACATAAAATTAGTGGACTTTCGCCCTAGCCCGCCGGGAAACCAAGTTTGACGGGCTGTCTTTTGACCCTTGAACGTTATTCTGCCTAGGATAGGGGGCATTCTTTTAGCAGAAATTTACTAAATTTCCCC

CDS

ATGTCCACGGAAAACCCCATCGAAACCAAGTCACCGGAAAACAATCAGTCTTTAGACTGCAGCAGCCCGGATCCTTCCCGTAAATGGTACCAAGCCCGCCTATTTTCCTTTGGCATTACTCCAACGGGTTATGTGGCAGTGGGGGTAGCTCCCATGGGGGTAGTGGCCATTGGCATTGTGCCCATGGGGGTGATTTCCGTTGGCATGGTAGGTATGGGGGCGATCGCCGCTGGATTTGTCACCATGGGGATGGTAGCGTTTGGTGAAGTGAATATGTCCTACTTCGGTGGTCACAAAGGAGGCAAGGGCCATGGTGCAATGCCCACCCAGGAAATGCCCATGACCGATAAACCCATGGAAAAACCCATGGAGCACAGCAATCACTAA

Protein

MSTENPIETKSPENNQSLDCSSPDPSRKWYQARLFSFGITPTGYVAVGVAPMGVVAIGIVPMGVISVGMVGMGAIAAGFVTMGMVAFGEVNMSYFGGHKGGKGHGAMPTQEMPMTDKPMEKPMEHSNH