Your browser is old and dusty. Try Google Chrome!

Details for slr0598

ORF slr0598
Accession NP_443052.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -33 -19 15.4376 0.104
NP_442711.1_1 Reverse -298 -312 15.3392 0.104
NP_441061.1_2 Forward -300 -286 9.63603 0.0708
NP_440557.1_1 Forward -32 -13 0.196116 0.265
NP_440795.1_7 Forward -32 -25 14.6904 0.0123
NP_440795.1_7 Reverse -25 -32 14.6904 0.0123
NP_440795.1_7 Reverse -358 -365 8.39725 0.213
NP_440795.1_7 Forward -127 -120 6.92228 0.26
NP_441418.1_6 Forward -140 -121 -18.8801 0.0839
NP_441418.1_6 Forward -146 -127 -28.9099 0.213
NP_441418.1_6 Forward -366 -347 -29.6965 0.234
NP_441418.1_6 Forward -20 -1 -29.7948 0.238
NP_441418.1_6 Forward -33 -14 -30.1882 0.262
NP_441418.1_6 Reverse -24 -43 -30.5815 0.286
NP_441418.1_6 Forward -155 -136 -30.7781 0.296
NP_442291.1_5 Forward -34 -18 -0.531451 0.185
NP_442291.1_5 Forward -308 -292 -4.75968 0.283
NP_440295.1_9 Reverse -236 -255 -3.73712 0.249
NP_440897.1_6 Reverse -239 -258 -0.787962 0.185
NP_441453.1_1 Reverse -350 -368 8.96649 0.176
NP_441453.1_4 Reverse -24 -32 16.539 0.00633
NP_441453.1_4 Forward -33 -25 16.539 0.00633
NP_441453.1_4 Forward -307 -299 14.8674 0.00947
NP_441453.1_4 Reverse -298 -306 6.80426 0.121
NP_441623.1_1 Forward -27 -9 -1.35749 0.24
NP_443041.1_6 Forward -365 -346 5.40766 0.276
NP_442151.1_6 Forward -33 -19 10.4227 0.123
NP_442151.1_6 Reverse -24 -38 9.63603 0.142
NP_440561.1_1 Reverse -108 -127 8.65176 0.298
NP_441818.1_9 Forward -149 -130 -2.26216 0.203
NP_441818.1_9 Forward -140 -121 -7.67036 0.273
NP_441818.1_9 Forward -139 -120 -9.047 0.287
NP_440226.1_1 Reverse -24 -43 9.43923 0.0726
NP_441630.1_3 Reverse -16 -35 -0.688862 0.288
NP_440813.1_1 Forward -313 -299 19.4684 0.0896
NP_440931.1_5 Forward -140 -121 14.2574 0.192
NP_440150.1_2 Reverse -7 -26 5.99684 0.261
NP_442655.1_1 Forward -38 -19 19.469 0.0194
NP_442655.1_10 Forward -369 -350 -9.14533 0.22
NP_442655.1_10 Forward -149 -130 -19.7651 0.289
NP_442173.1_1 Forward -32 -24 15.4574 0.00633
NP_442173.1_1 Reverse -25 -33 15.4574 0.00633
NP_442173.1_1 Reverse -299 -307 13.8841 0.0225
NP_442173.1_1 Forward -306 -298 12.0158 0.0316
NP_442752.1_4 Reverse -298 -305 13.8055 0.0199
NP_442752.1_4 Forward -33 -26 13.8055 0.0199
NP_442752.1_4 Reverse -24 -31 13.8055 0.0199
NP_442752.1_4 Forward -248 -241 12.1338 0.0546
NP_442752.1_4 Reverse -239 -246 12.1338 0.0546
NP_443027.1_4 Forward -35 -25 13.943 0.0452
NP_443027.1_4 Reverse -22 -32 13.2547 0.0521
NP_442975.1_10 Forward -37 -23 21.3367 0.00107
NP_442975.1_10 Forward -311 -297 3.44058 0.259
NP_441225.1_4 Reverse -124 -143 -1.27885 0.237
NP_440784.1_7 Forward -32 -25 15.9687 0.0123
NP_440784.1_7 Reverse -25 -32 15.9687 0.0123
NP_440784.1_7 Reverse -299 -306 6.23397 0.241
NP_440784.1_7 Forward -306 -299 6.13563 0.241
NP_440061.1_9 Reverse -237 -251 6.39049 0.248
NP_440061.1_9 Reverse -121 -135 5.30886 0.29
NP_441476.1_5 Reverse -275 -294 -6.78538 0.276
NP_439979.1_9 Forward -136 -118 9.95058 0.231
NP_440878.1_9 Reverse -121 -140 -1.86883 0.255
NP_442062.1_8 Reverse -24 -34 19.4496 0.000558
NP_442062.1_8 Forward -33 -23 10.3048 0.0493
NP_442062.1_8 Reverse -298 -308 9.7148 0.0559
NP_442062.1_8 Forward -307 -297 5.09324 0.184
NP_442062.1_8 Forward -248 -238 4.20827 0.228
NP_440761.1_4 Forward -38 -19 -3.83545 0.132
NP_441900.1_2 Reverse -124 -142 -4.99644 0.288
NP_440304.1_4 Forward -22 -12 11.5831 0.051
NP_440304.1_4 Reverse -22 -32 10.8948 0.051
NP_440304.1_4 Forward -35 -25 9.91146 0.051
NP_442242.1_4 Forward -32 -25 14.3954 0.0124
NP_442242.1_4 Reverse -25 -32 14.3954 0.0124
NP_440044.1_8 Reverse -25 -44 11.4058 0.0497
NP_442207.1_4 Reverse -299 -318 7.37428 0.285
NP_441208.1_9 Reverse -21 -35 8.16106 0.219
NP_441208.1_9 Forward -36 -22 5.99778 0.254
NP_441594.1_6 Forward -125 -106 2.3594 0.252
NP_442110.1_7 Forward -33 -19 12.3893 0.0586
NP_442110.1_7 Forward -307 -293 1.57289 0.222
NP_442110.1_7 Reverse -24 -38 0.392915 0.261
NP_441082.1_10 Forward -96 -83 8.86907 0.258
NP_442367.1_1 Forward -129 -110 -7.37537 0.26
NP_442726.1_7 Reverse -124 -142 -1.55415 0.296
NP_441925.1_4 Reverse -124 -143 1.27698 0.155
NP_441925.1_4 Reverse -121 -140 -6.88445 0.185
NP_441925.1_4 Reverse -115 -134 -7.57277 0.196
NP_441925.1_4 Reverse -111 -130 -16.7175 0.285
NP_440014.1_3 Forward -392 -378 15.9698 0.262
NP_440856.1_4 Reverse -17 -36 8.35759 0.0597
NP_441083.1_5 Reverse -24 -34 11.3864 0.0159
NP_441083.1_5 Forward -33 -23 11.2881 0.0159
NP_441083.1_5 Forward -307 -297 9.81313 0.0224
NP_441083.1_5 Forward -248 -238 8.53483 0.0342
NP_441083.1_5 Reverse -239 -249 -0.511621 0.269
NP_441083.1_5 Reverse -298 -308 -1.00328 0.289
NP_441434.1_7 Reverse -26 -40 3.04785 0.264
NP_440109.1_8 Forward -287 -268 8.16093 0.29
NP_441738.1_2 Forward -305 -298 15.28 0.0102
NP_441738.1_2 Forward -31 -24 15.28 0.0102
NP_441738.1_2 Reverse -26 -33 15.28 0.0102
NP_441558.1_5 Reverse -22 -41 12.5858 0.0675
NP_441558.1_5 Forward -309 -290 10.4225 0.098
NP_441558.1_5 Forward -142 -123 4.03102 0.293
NP_440209.1_1 Reverse -24 -32 18.1123 0.00295
NP_440209.1_1 Forward -33 -25 18.1123 0.00295
NP_440209.1_1 Reverse -298 -306 8.57422 0.0425
NP_442889.1_1 Reverse -350 -369 -15.1435 0.288
NP_442889.1_8 Forward -310 -296 11.307 0.0733
NP_442889.1_8 Forward -36 -22 3.73557 0.273
NP_441713.1_1 Forward -39 -20 -13.9635 0.257
NP_441713.1_3 Reverse -104 -123 5.211 0.253
NP_441713.1_8 Forward -370 -352 12.3105 0.197
NP_441770.1_10 Reverse -22 -41 8.16093 0.284
NP_440178.1_7 Reverse -23 -42 -12.6852 0.123
NP_442570.1_3 Forward -209 -190 -4.22878 0.228
NP_442570.1_3 Forward -52 -33 -9.63698 0.3
NP_441716.1_1 Forward -366 -352 6.09611 0.207
NP_441716.1_1 Forward -224 -210 2.75286 0.294
NP_442111.1_3 Reverse -260 -273 14.0036 0.245
NP_442111.1_4 Forward -34 -20 13.4709 0.0383
NP_440906.1_5 Forward -32 -25 15.8704 0.0124
NP_440906.1_5 Reverse -25 -32 15.8704 0.0124
NP_440906.1_5 Reverse -299 -306 6.23397 0.234
NP_440906.1_5 Forward -306 -299 6.13563 0.241
NP_440747.1_10 Reverse -21 -33 17.1486 0.000663
NP_440747.1_10 Forward -36 -24 -2.02597 0.0196
NP_440747.1_10 Forward -251 -239 -2.4193 0.0434
NP_440747.1_10 Forward -369 -357 -2.81262 0.0713
NP_440747.1_10 Reverse -295 -307 -4.58258 0.109
NP_440747.1_10 Reverse -236 -248 -4.58258 0.109
NP_440747.1_10 Forward -310 -298 -12.2524 0.254
NP_441130.1_7 Forward -261 -247 15.4369 0.287
NP_441130.1_10 Forward -35 -21 10.0294 0.117
NP_441130.1_10 Reverse -22 -36 8.94771 0.131
NP_441854.1_10 Forward -35 -16 10.3242 0.139
NP_442973.1_5 Reverse -15 -34 13.3725 0.169
NP_441486.1_1 Reverse -295 -309 4.62115 0.0425
NP_441486.1_1 Forward -310 -296 3.04785 0.0689
NP_441486.1_1 Forward -36 -22 -3.34366 0.178
NP_441880.2_10 Reverse -25 -43 14.2771 0.111
NP_440944.1_2 Reverse -286 -305 1.86774 0.249
NP_442634.1_4 Forward -35 -21 6.58777 0.0489
NP_442634.1_4 Reverse -22 -36 5.80112 0.051
NP_441265.1_3 Forward -39 -25 0.392915 0.248
NP_440403.1_4 Forward -300 -281 -2.36049 0.179
NP_440403.1_10 Reverse -128 -147 3.73603 0.272
NP_440842.1_10 Forward -92 -78 4.03116 0.254
NP_441014.1_8 Reverse -124 -143 -0.197208 0.218
NP_442848.1_1 Reverse -233 -247 -4.4253 0.291
NP_442848.1_5 Reverse -17 -35 2.57575 0.276
NP_442848.1_5 Reverse -112 -130 2.18243 0.276
NP_442848.1_5 Reverse -284 -302 -3.02911 0.29
NP_441012.1_4 Reverse -115 -128 6.01747 0.286
NP_443018.1_3 Forward -32 -25 14.8871 0.0123
NP_443018.1_3 Reverse -25 -32 14.8871 0.0123
NP_443018.1_3 Forward -306 -299 11.7405 0.0655
NP_443018.1_3 Reverse -299 -306 5.44732 0.193
NP_441316.1_7 Forward -35 -20 4.20813 0.135
NP_441634.1_8 Reverse -22 -36 15.1426 0.0248
NP_441634.1_8 Forward -142 -128 3.34284 0.154
NP_441634.1_8 Reverse -196 -210 -4.7203 0.295
NP_440376.1_1 Forward -33 -24 19.4693 0.000692
NP_440376.1_1 Reverse -24 -33 19.4693 0.000692
NP_440376.1_1 Forward -248 -239 7.07956 0.0869
NP_440376.1_1 Reverse -239 -248 7.07956 0.0869
NP_440376.1_1 Reverse -298 -307 5.89959 0.116
NP_440376.1_1 Forward -307 -298 -0.0986038 0.285
NP_441857.1_5 Forward -40 -22 6.50899 0.189
NP_441588.1_4 Forward -305 -295 18.1713 0.0143
NP_441588.1_4 Reverse -26 -36 6.96153 0.178
NP_442687.1_1 Forward -68 -55 12.4084 0.273
NP_442687.1_7 Forward -34 -24 15.8113 0.0125
NP_442687.1_7 Reverse -23 -33 9.02648 0.0994
NP_442687.1_7 Reverse -297 -307 5.68323 0.189
NP_441797.1_7 Forward -198 -180 10.4422 0.292
NP_441077.1_6 Reverse -254 -270 3.18749 0.271
NP_442485.1_3 Reverse -126 -145 5.40766 0.169
NP_441846.1_10 Forward -140 -121 -13.0786 0.197
NP_441846.1_10 Forward -133 -114 -14.4552 0.227
NP_441846.1_10 Forward -138 -119 -22.0267 0.257
NP_441846.1_10 Forward -136 -117 -22.715 0.264
NP_441846.1_10 Forward -147 -128 -23.4033 0.285
NP_440642.1_10 Reverse -79 -93 10.1271 0.175
NP_442770.1_4 Forward -311 -292 13.1758 0.135
NP_441422.1_7 Forward -309 -292 -3.5994 0.235
NP_441422.1_7 Forward -35 -18 -4.09106 0.238
NP_441029.1_7 Forward -303 -284 9.73422 0.274
NP_440667.1_2 Forward -350 -331 0.294447 0.208
NP_441950.1_7 Forward -137 -118 -2.0655 0.201
NP_442296.1_9 Forward -306 -287 -3.04881 0.249
NP_440360.1_10 Reverse -124 -138 3.04785 0.254
NP_442658.1_1 Forward -35 -25 18.7607 0.00222
NP_442658.1_1 Reverse -22 -32 14.2375 0.0237
NP_442658.1_1 Forward -309 -299 6.56775 0.224
NP_440141.1_8 Reverse -152 -171 6.29264 0.265
NP_441855.2_4 Reverse -3 -22 10.7764 0.243
NP_440662.1_1 Reverse -54 -73 6.39097 0.299
NP_442782.1_2 Forward -300 -286 18.5841 0.126
NP_442782.1_2 Forward -33 -19 8.16106 0.198
NP_440656.1_2 Reverse -315 -334 0.196116 0.258
NP_441414.1_9 Reverse -24 -43 -2.95047 0.126
NP_440607.1_5 Forward -134 -115 3.6377 0.226
NP_440607.1_8 Forward -130 -111 21.5339 0.0135
NP_441487.1_9 Reverse -23 -42 1.67108 0.197
NP_441256.1_1 Reverse -134 -153 -6.09707 0.239
NP_442321.1_1 Forward -155 -136 -1.47551 0.187
NP_441958.1_5 Reverse -23 -33 21.2195 0.000805
NP_441958.1_5 Forward -34 -24 12.2714 0.00183
NP_441958.1_5 Reverse -297 -307 8.73149 0.0255
NP_441958.1_5 Forward -249 -239 1.65166 0.0872
NP_441127.1_1 Forward -140 -126 12.7826 0.206
NP_439905.1_1 Reverse -245 -258 9.2624 0.221
NP_440984.1_7 Forward -38 -24 16.6175 0.0384
NP_440984.1_7 Reverse -19 -33 10.0294 0.126
NP_440984.1_7 Forward -253 -239 5.70279 0.245
NP_441162.1_3 Forward -144 -125 11.5042 0.198
NP_439990.1_5 Reverse -19 -32 10.639 0.128
NP_442690.1_1 Forward -82 -63 -14.1602 0.269
NP_442911.1_2 Reverse -14 -33 4.03102 0.0401
NP_442911.1_2 Forward -43 -24 -1.08219 0.0811
NP_441580.1_6 Forward -44 -25 -4.6221 0.235
NP_440153.1_5 Forward -32 -18 13.8643 0.0551
NP_440153.1_5 Reverse -25 -39 3.63784 0.206
NP_440153.1_8 Reverse -113 -126 -2.53732 0.244
NP_442536.1_8 Forward -131 -112 12.2908 0.253
NP_442051.1_5 Reverse -277 -296 10.4225 0.29
NP_442236.1_3 Reverse -104 -123 8.55425 0.248
NP_440993.1_2 Reverse -19 -35 15.2998 0.0631
NP_440993.1_2 Forward -38 -22 2.61514 0.263
NP_440993.1_3 Reverse -14 -33 8.55343 0.129
NP_440993.1_4 Reverse -192 -209 3.38209 0.289
NP_441913.1_3 Reverse -65 -78 14.9585 0.226
NP_441348.1_3 Forward -38 -19 8.84924 0.232
NP_441129.1_6 Reverse -16 -35 0.294447 0.229
NP_441099.1_5 Reverse -103 -122 -8.55534 0.197
NP_441099.1_5 Forward -317 -298 -9.83364 0.234
NP_441099.1_5 Reverse -121 -140 -10.4236 0.253
NP_442002.1_1 Forward -141 -123 -9.71562 0.283
NP_442002.1_9 Forward -21 -14 11.3472 0.185
NP_442002.1_9 Forward -34 -27 10.7572 0.185
NP_441294.1_7 Forward -37 -23 13.7621 0.0568
NP_441294.1_7 Forward -311 -297 12.9942 0.0767
NP_442438.1_10 Forward -38 -24 11.2093 0.0463
NP_442438.1_10 Forward -127 -113 3.73617 0.157
NP_442438.1_10 Reverse -19 -33 1.76955 0.188
NP_442431.1_10 Forward -140 -122 4.54237 0.206
NP_442431.1_10 Forward -131 -113 4.44404 0.206
NP_442431.1_10 Forward -134 -116 0.510803 0.273
NP_442431.1_10 Forward -143 -125 0.314141 0.278
NP_441000.1_6 Reverse -23 -37 5.1128 0.0933
NP_441000.1_6 Reverse -297 -311 -3.63866 0.225
NP_441000.1_6 Forward -34 -20 -4.03198 0.225
NP_440147.1_4 Reverse -22 -35 18.4072 0.00407
NP_440147.1_4 Reverse -296 -309 13.884 0.03
NP_440147.1_4 Forward -35 -22 10.4424 0.0355
NP_440147.1_4 Reverse -237 -250 -0.767364 0.299
NP_441550.1_8 Reverse -22 -32 15.8108 0.0132
NP_441550.1_8 Reverse -296 -306 13.3526 0.0252
NP_441550.1_8 Forward -35 -25 10.501 0.066
NP_441916.1_7 Forward -33 -23 18.9579 0.00144
NP_441916.1_7 Reverse -24 -34 18.4663 0.00144
NP_441916.1_7 Reverse -298 -308 6.66654 0.0875
NP_441916.1_7 Forward -307 -297 1.35667 0.286
NP_441041.1_1 Forward -137 -118 9.3409 0.221
NP_441041.1_4 Forward -307 -288 -4.81876 0.143
NP_441041.1_4 Reverse -280 -299 -8.35868 0.2
NP_441041.1_4 Reverse -286 -305 -12.7836 0.274
NP_441041.1_7 Forward -36 -24 19.5648 0.00277
NP_441041.1_7 Reverse -21 -33 13.3454 0.0485
NP_441041.1_7 Forward -310 -298 7.32042 0.169
NP_441041.1_7 Reverse -295 -307 4.98816 0.282
NP_440099.1_3 Reverse -169 -188 9.0459 0.262
NP_442396.1_5 Reverse -235 -248 11.6223 0.0913
NP_441725.1_4 Reverse -19 -33 13.7653 0.0693
NP_441725.1_5 Reverse -25 -35 9.02648 0.0553
NP_441725.1_5 Forward -32 -22 1.94665 0.115
NP_439966.1_7 Forward -35 -25 17.4824 0.00636
NP_439966.1_7 Reverse -22 -32 14.3359 0.0203
NP_439966.1_7 Forward -309 -299 8.73102 0.13
NP_439966.1_7 Reverse -197 -207 5.97777 0.199
NP_439966.1_7 Reverse -169 -179 5.87944 0.204
NP_439966.1_7 Reverse -129 -139 4.10949 0.289
NP_439966.1_9 Forward -35 -26 10.7178 0.0863
NP_440736.1_3 Reverse -289 -308 2.85105 0.282
NP_442941.1_3 Forward -32 -22 19.2529 0.00262
NP_442941.1_3 Reverse -240 -250 7.45319 0.0727
NP_442941.1_3 Reverse -25 -35 2.53664 0.14
NP_442941.1_3 Forward -306 -296 1.25834 0.15
NP_442941.1_3 Forward -247 -237 -0.708283 0.267
NP_440289.1_2 Forward -36 -23 12.9006 0.0132
NP_440289.1_2 Forward -310 -297 1.88757 0.112
NP_440289.1_2 Reverse -21 -34 -3.52063 0.267
NP_440983.1_5 Reverse -107 -126 -2.16383 0.231
NP_440983.1_5 Reverse -125 -144 -8.85033 0.298
NP_440983.1_9 Reverse -15 -34 0.294447 0.292
NP_440260.1_8 Forward -210 -192 -4.01242 0.263
NP_441678.1_9 Forward -366 -347 -4.72043 0.296
NP_442281.1_1 Forward -312 -298 18.1901 0.00483
NP_442281.1_1 Forward -38 -24 18.0918 0.00503
NP_442281.1_1 Reverse -19 -33 16.5185 0.00772
NP_442281.1_1 Reverse -293 -307 4.03056 0.21
NP_441334.1_7 Forward -35 -16 -19.9617 0.275
NP_440177.1_1 Forward -228 -210 5.03403 0.272
NP_442256.1_2 Forward -35 -17 -9.91228 0.299
NP_440437.1_1 Reverse -18 -37 17.2074 0.0176
NP_442500.1_8 Reverse -263 -277 15.6735 0.146
NP_439983.1_1 Reverse -116 -134 10.3431 0.289
NP_441087.1_6 Reverse -115 -133 -3.91481 0.296
NP_441457.1_7 Reverse -22 -41 9.73422 0.126
NP_440723.1_8 Forward -132 -118 11.0127 0.257
NP_441556.1_7 Reverse -175 -194 -1.27961 0.3
NP_441556.1_10 Forward -254 -240 10.9032 0.253
NP_442982.1_5 Reverse -14 -33 7.86593 0.12
NP_441644.1_6 Forward -33 -23 19.0557 0.000803
NP_441644.1_6 Forward -307 -297 14.7292 0.0105
NP_441644.1_6 Reverse -24 -34 10.1076 0.0628
NP_441644.1_6 Reverse -131 -141 3.12618 0.297
NP_443049.1_6 Forward -45 -35 12.3241 0.24
NP_443049.1_6 Reverse -308 -318 11.0554 0.282
NP_442215.1_2 Forward -35 -19 6.45005 0.0712
NP_442215.1_2 Forward -309 -293 -2.00642 0.191
NP_442215.1_2 Reverse -129 -145 -4.36636 0.232
NP_442215.1_2 Reverse -283 -299 -7.61128 0.3
NP_442215.1_3 Forward -136 -118 14.5721 0.248
NP_442177.1_5 Forward -137 -123 14.5526 0.22
NP_442029.1_6 Forward -137 -118 8.25926 0.208
NP_442029.1_6 Reverse -234 -253 5.01433 0.258
NP_442029.1_6 Forward -38 -19 3.83436 0.275
NP_442029.1_6 Reverse -293 -312 3.44104 0.282
NP_440253.1_2 Reverse -24 -42 -0.964162 0.227
NP_440929.1_8 Forward -33 -24 19.2726 0.000701
NP_440929.1_8 Reverse -24 -33 19.2726 0.000701
NP_440929.1_8 Forward -307 -298 7.17789 0.0713
NP_442933.1_10 Forward -33 -24 17.601 0.00325
NP_442933.1_10 Reverse -24 -33 17.601 0.00325
NP_442933.1_10 Forward -307 -298 8.06287 0.0885
NP_442933.1_10 Reverse -298 -307 7.96454 0.0937
NP_441751.2_8 Forward -32 -18 7.57108 0.0339
NP_442926.1_3 Forward -121 -102 1.96607 0.296
NP_442554.1_8 Forward -32 -22 17.2863 0.00543
NP_442554.1_8 Reverse -25 -35 16.008 0.0065
NP_442554.1_8 Forward -306 -296 5.48657 0.146
NP_442554.1_8 Reverse -299 -309 2.14332 0.281
NP_442554.1_8 Forward -252 -242 1.84832 0.292
NP_441762.1_7 Reverse -23 -35 12.527 0.0142
NP_441762.1_7 Forward -34 -22 2.30059 0.0676
NP_441762.1_7 Forward -308 -296 1.51394 0.0747
NP_442142.1_4 Reverse -21 -34 15.4566 0.0264
NP_442142.1_4 Forward -36 -23 14.4733 0.0311
NP_442142.1_4 Reverse -354 -367 2.87033 0.273
NP_442142.1_4 Reverse -273 -286 2.37867 0.294
NP_442142.1_4 Reverse -295 -308 2.28034 0.295
NP_442292.1_1 Forward -32 -23 17.5026 0.00435
NP_442292.1_1 Reverse -25 -34 9.63616 0.0183
NP_442292.1_1 Forward -306 -297 8.65285 0.0335
NP_442292.1_1 Forward -247 -238 -0.68859 0.268
NP_442476.1_6 Reverse -25 -39 7.47274 0.112
NP_442381.1_8 Forward -36 -17 -12.3902 0.267
NP_443009.1_5 Reverse -23 -34 19.626 0.00102
NP_443009.1_5 Reverse -238 -249 11.2679 0.066
NP_443009.1_5 Forward -34 -23 7.82632 0.118
NP_443009.1_5 Reverse -297 -308 7.53132 0.126
NP_443009.1_5 Forward -249 -238 6.94134 0.144
NP_442301.1_2 Reverse -118 -137 11.7983 0.159
NP_442301.1_2 Reverse -121 -140 5.70185 0.263
NP_441715.1_4 Forward -32 -22 16.7946 0.0106
NP_441715.1_4 Reverse -25 -35 9.32148 0.097
NP_441715.1_4 Reverse -299 -309 7.84651 0.107
NP_440357.1_6 Reverse -119 -138 6.58763 0.279
NP_440881.1_4 Reverse -240 -259 12.7825 0.167
NP_440183.1_9 Forward -160 -141 -10.1286 0.226
NP_440183.1_9 Reverse -139 -158 -16.3235 0.276
NP_441198.1_5 Forward -305 -292 14.2767 0.206
NP_440379.1_5 Reverse -348 -367 -9.047 0.259
NP_441468.1_1 Forward -32 -25 15.8704 0.0124
NP_441468.1_1 Reverse -25 -32 15.8704 0.0124
NP_441468.1_1 Reverse -299 -306 6.13563 0.209
NP_441468.1_1 Forward -306 -299 6.0373 0.223
NP_441618.1_7 Reverse -240 -259 12.8206 0.295
NP_441020.2_6 Forward -130 -113 14.3952 0.0553
NP_441020.2_6 Forward -35 -18 7.90532 0.215
NP_441020.2_6 Forward -142 -125 7.217 0.237
NP_441020.2_6 Forward -22 -5 6.43035 0.262
NP_441020.2_9 Forward -143 -124 21.5339 0.0531
NP_441015.1_10 Forward -145 -126 4.52268 0.125
NP_441015.1_10 Forward -139 -120 -8.45701 0.273
NP_441015.1_10 Forward -136 -117 -8.45701 0.273
NP_441015.1_10 Forward -142 -123 -8.94866 0.278
NP_441015.1_10 Forward -137 -118 -9.44032 0.282
NP_441015.1_10 Forward -127 -108 -10.3253 0.284
NP_441015.1_10 Forward -365 -346 -10.6203 0.286
NP_441015.1_10 Forward -151 -132 -10.6203 0.286
NP_441015.1_10 Forward -38 -19 -10.817 0.288
NP_441673.1_1 Forward -33 -24 20.8459 0.000698
NP_441673.1_1 Reverse -24 -33 20.8459 0.000698
NP_441673.1_1 Forward -307 -298 1.27803 0.155
NP_441673.1_1 Reverse -298 -307 1.27803 0.155
NP_441673.1_1 Forward -248 -239 1.27803 0.155
NP_441673.1_1 Reverse -239 -248 1.27803 0.155
NP_441244.1_8 Forward -143 -124 5.11266 0.143
NP_441731.1_3 Reverse -16 -35 -5.50708 0.284
NP_441731.1_3 Forward -148 -129 -6.29373 0.29
NP_441876.1_9 Forward -389 -379 10.796 0.287
NP_441826.1_2 Reverse -18 -32 7.66941 0.085
NP_441826.1_2 Reverse -292 -306 6.78443 0.09
NP_441826.1_2 Forward -372 -358 5.01447 0.0978
NP_441826.1_2 Forward -39 -25 4.62115 0.101
NP_441826.1_2 Forward -307 -293 -2.26202 0.269
NP_441826.1_5 Forward -306 -287 1.67108 0.289
NP_441330.1_1 Reverse -19 -38 -12.3902 0.183
NP_442811.1_2 Forward -362 -343 -3.54046 0.296
NP_442868.1_6 Reverse -22 -32 10.4031 0.038
NP_442868.1_6 Forward -35 -25 8.53483 0.0555
NP_442868.1_6 Reverse -296 -306 0.0783647 0.248
NP_441612.1_2 Reverse -285 -295 7.19391 0.26
NP_442227.1_2 Reverse -124 -143 12.3892 0.159
NP_442227.1_2 Reverse -130 -149 5.80098 0.202
NP_442227.1_2 Reverse -121 -140 1.96607 0.241
NP_442227.1_2 Reverse -112 -131 -2.45882 0.274
NP_442227.1_2 Reverse -118 -137 -3.24547 0.29
NP_443058.1_9 Reverse -126 -144 12.7038 0.189
NP_442361.1_3 Reverse -292 -305 8.57408 0.285
NP_442808.1_1 Forward -34 -24 18.4657 0.00201
NP_442808.1_1 Forward -308 -298 10.501 0.0481
NP_442808.1_1 Reverse -23 -33 8.73102 0.0481
NP_442808.1_1 Reverse -130 -140 7.84605 0.0668
NP_442808.1_1 Forward -249 -239 3.61784 0.234
NP_442808.1_1 Reverse -238 -248 3.51951 0.238
NP_442808.1_1 Reverse -284 -294 1.84789 0.281
NP_441101.1_10 Reverse -124 -143 -7.4737 0.29
NP_440145.1_3 Forward -317 -298 -5.60541 0.273
NP_442542.1_2 Forward -35 -22 10.344 0.126
NP_442113.1_10 Reverse -124 -143 -7.67036 0.27
NP_442050.1_1 Forward -135 -116 7.37428 0.274
NP_442050.1_5 Reverse -22 -32 15.9091 0.0091
NP_442050.1_5 Forward -35 -25 8.23937 0.234
NP_440038.1_4 Reverse -16 -35 1.37609 0.275
NP_442342.1_9 Forward -35 -19 2.51681 0.286
NP_440342.1_2 Forward -140 -121 11.6025 0.219
NP_440558.1_2 Forward -304 -285 3.14605 0.161
NP_440558.1_2 Forward -298 -279 1.0811 0.185
NP_440558.1_2 Reverse -119 -138 0.982764 0.185
NP_440558.1_2 Reverse -110 -129 -1.7705 0.218
NP_440558.1_2 Reverse -282 -301 -5.80207 0.264
NP_440558.1_2 Reverse -37 -56 -6.58872 0.277
NP_442789.1_4 Forward -139 -120 -4.81876 0.264
NP_441878.1_6 Reverse -23 -33 10.5014 0.0176
NP_441878.1_6 Forward -34 -24 10.4031 0.0176
NP_441878.1_6 Reverse -356 -366 -7.59145 0.245
NP_441036.1_8 Forward -34 -24 17.7779 0.000554
NP_441036.1_8 Reverse -23 -33 15.713 0.00724
NP_441036.1_8 Forward -308 -298 8.1415 0.176
NP_441557.1_5 Forward -33 -24 19.9609 0.000699
NP_441557.1_5 Reverse -24 -33 19.9609 0.000699
NP_441557.1_5 Reverse -298 -307 8.94785 0.0289
NP_441557.1_5 Forward -307 -298 0.688044 0.128
NP_441557.1_5 Forward -248 -239 0.393051 0.166
NP_441557.1_5 Reverse -239 -248 0.393051 0.166
NP_441590.1_4 Reverse -115 -134 15.3382 0.144
NP_441590.1_4 Reverse -119 -138 4.62021 0.28
NP_442066.2_4 Reverse -298 -317 -0.4922 0.173
NP_442066.2_4 Forward -33 -14 -8.06369 0.293
NP_442066.2_4 Reverse -24 -43 -8.65367 0.294
NP_442066.2_9 Forward -37 -24 8.47575 0.185
NP_442419.1_2 Reverse -19 -38 -1.57384 0.246
NP_441308.1_8 Forward -250 -240 10.1081 0.22
NP_441308.1_8 Forward -35 -25 9.22315 0.226
NP_440101.1_3 Forward -38 -19 7.96426 0.17
NP_442830.1_5 Reverse -169 -183 7.66879 0.215
NP_442183.1_1 Reverse -24 -38 9.63603 0.0954
NP_441870.1_9 Forward -60 -41 19.3707 0.186
NP_441574.1_1 Forward -122 -103 0.196116 0.196
NP_441574.1_1 Forward -140 -121 -6.39206 0.277
NP_441574.1_1 Reverse -286 -305 -6.68705 0.277
NP_440540.1_8 Forward -39 -20 8.35759 0.249
NP_442170.1_5 Reverse -298 -317 -3.3438 0.272
NP_442347.1_2 Reverse -25 -34 11.1111 0.056
NP_442347.1_2 Forward -306 -297 10.3245 0.058
NP_442347.1_2 Forward -247 -238 8.75118 0.0772
NP_442347.1_2 Reverse -36 -45 8.06287 0.116
NP_442347.1_2 Forward -32 -23 3.34298 0.284
NP_442645.1_2 Reverse -231 -250 -12.8819 0.144
NP_442645.1_2 Reverse -290 -309 -16.7168 0.24
NP_442888.1_6 Forward -311 -292 3.44104 0.244
NP_441037.1_4 Forward -35 -25 16.2838 0.0168
NP_441037.1_4 Reverse -22 -32 7.22024 0.237
NP_442594.1_8 Forward -134 -115 5.11266 0.254
NP_441633.1_3 Reverse -22 -35 13.3923 0.018
NP_441633.1_3 Forward -35 -22 -3.81562 0.177
NP_441633.1_3 Reverse -126 -139 -5.88057 0.236
NP_440136.1_2 Forward -32 -25 15.9687 0.0123
NP_440136.1_2 Reverse -25 -32 15.9687 0.0123
NP_440136.1_2 Reverse -299 -306 6.23397 0.171
NP_440136.1_2 Forward -306 -299 6.13563 0.193
NP_442590.1_9 Forward -129 -110 4.32602 0.273
NP_442590.1_10 Forward -307 -288 20.8456 0.0978
NP_442998.1_5 Forward -85 -75 11.4848 0.184
NP_442998.1_5 Reverse -190 -200 9.81313 0.233
NP_442998.1_10 Forward -305 -298 15.5754 0.0102
NP_442998.1_10 Forward -31 -24 15.5754 0.0102
NP_442998.1_10 Reverse -26 -33 15.5754 0.0102
NP_440731.1_2 Reverse -286 -305 9.24257 0.275
NP_440299.1_1 Reverse -20 -33 11.1301 0.0518
NP_440299.1_1 Forward -370 -357 6.31189 0.146
NP_440299.1_1 Reverse -294 -307 4.64028 0.205
NP_441799.1_1 Reverse -20 -34 10.3237 0.0756
NP_441799.1_1 Forward -37 -23 10.0287 0.0797
NP_440640.1_6 Forward -152 -133 6.4893 0.183
NP_440640.1_9 Reverse -271 -290 18.9773 0.153
NP_441007.1_10 Forward -38 -25 3.5592 0.182
NP_441007.1_10 Reverse -19 -32 1.29759 0.203
NP_442201.1_10 Forward -44 -25 -2.55715 0.141
NP_442299.1_10 Forward -309 -295 16.7152 0.292
NP_442333.2_5 Reverse -281 -300 -9.24366 0.246
NP_440256.1_1 Reverse -295 -314 12.6841 0.0114
NP_440256.1_1 Reverse -21 -40 10.0292 0.019
NP_440256.1_1 Reverse -288 -307 -0.197208 0.0907
NP_440256.1_1 Reverse -236 -255 -3.24547 0.129
NP_440256.1_1 Forward -150 -131 -3.73712 0.138
NP_440256.1_1 Forward -36 -17 -7.76869 0.245
NP_440256.1_1 Forward -369 -350 -9.53865 0.281
NP_441229.1_1 Reverse -103 -118 15.4179 0.21
NP_442007.1_8 Reverse -118 -136 8.57317 0.297
NP_441559.1_8 Reverse -19 -33 10.9143 0.0574
NP_441559.1_8 Forward -253 -239 10.3243 0.0595
NP_441559.1_8 Reverse -166 -180 3.14618 0.143
NP_441559.1_8 Reverse -352 -366 -5.01529 0.245
NP_440915.1_6 Forward -37 -23 15.4376 0.0183
NP_440915.1_6 Reverse -20 -34 10.6193 0.0301
NP_440915.1_6 Reverse -235 -249 5.21113 0.0924
NP_440915.1_6 Forward -252 -238 2.35953 0.119
NP_440915.1_6 Forward -311 -297 1.47456 0.138
NP_440717.1_3 Reverse -126 -140 7.96378 0.275
NP_442866.1_1 Forward -38 -19 -2.36049 0.21
NP_440748.1_5 Forward -304 -285 0.687771 0.246
NP_440748.1_5 Forward -298 -279 -2.75381 0.281
NP_441464.1_10 Forward -142 -128 7.9644 0.287
NP_440702.1_2 Forward -142 -123 -5.60541 0.257
NP_440026.1_7 Forward -253 -238 14.4346 0.251
NP_441939.1_3 Forward -32 -13 19.8623 0.0103
NP_441939.1_3 Reverse -240 -259 5.01433 0.292
NP_441199.1_6 Forward -254 -235 6.09597 0.14
NP_441199.1_6 Forward -37 -18 -0.885524 0.283
NP_441494.1_6 Forward -25 -12 7.59077 0.254
NP_441494.1_6 Reverse -19 -32 6.01747 0.289
NP_442993.1_1 Reverse -24 -40 -7.80794 0.146
NP_442386.1_9 Forward -34 -25 15.7322 0.0144
NP_442386.1_9 Forward -308 -299 12.8806 0.0501
NP_442386.1_9 Reverse -238 -247 9.5374 0.159
NP_442386.1_9 Reverse -23 -32 6.39082 0.219
NP_442386.1_9 Forward -301 -292 6.09583 0.23
NP_442386.1_9 Reverse -40 -49 4.7192 0.289
NP_440570.1_4 Forward -147 -129 0.314141 0.287
NP_440570.1_5 Forward -150 -131 2.65439 0.234
NP_441750.1_1 Forward -146 -127 6.09597 0.103
NP_441750.1_4 Reverse -20 -39 0.884433 0.291
NP_441750.1_7 Forward -140 -130 15.3197 0.254
NP_441340.1_5 Forward -32 -25 15.6737 0.0124
NP_441340.1_5 Reverse -25 -32 15.6737 0.0124
NP_441340.1_5 Reverse -299 -306 13.5105 0.0314
NP_441340.1_5 Forward -306 -299 5.84064 0.208
NP_441340.1_9 Forward -86 -76 8.25522 0.256
NP_442484.1_2 Reverse -287 -306 2.85105 0.218
NP_442791.1_5 Forward -308 -289 -12.1936 0.296
NP_441254.1_2 Forward -276 -257 8.94757 0.212
NP_442240.1_1 Reverse -16 -35 13.3716 0.167
NP_442240.1_2 Reverse -299 -318 -10.522 0.137
NP_442240.1_2 Forward -32 -13 -10.6203 0.137
NP_440211.1_1 Reverse -114 -133 18.0915 0.13
NP_440586.1_1 Forward -135 -116 1.67108 0.231
NP_440586.1_1 Forward -138 -119 1.37609 0.231
NP_440586.1_8 Forward -32 -25 13.2151 0.026
NP_440586.1_8 Reverse -25 -32 13.2151 0.026
NP_440586.1_8 Forward -306 -299 9.47853 0.146
NP_440586.1_8 Reverse -299 -306 5.74197 0.283
NP_442251.1_6 Forward -32 -25 15.2804 0.0124
NP_442251.1_6 Reverse -25 -32 15.2804 0.0124
NP_442959.1_6 Forward -128 -109 0.294447 0.297
NP_441262.1_2 Reverse -209 -223 18.728 0.23
NP_441262.1_3 Reverse -298 -305 14.7888 0.0223
NP_441262.1_3 Reverse -24 -31 14.7888 0.0223
NP_441262.1_3 Forward -33 -26 14.7888 0.0223
NP_440027.1_3 Reverse -113 -131 14.8663 0.102
NP_440027.1_8 Forward -36 -17 12.9783 0.19
NP_440027.1_8 Forward -310 -291 8.55343 0.246
NP_440027.1_8 Forward -304 -285 8.55343 0.246
NP_443051.1_1 Reverse -23 -32 19.5676 0.00335
NP_443051.1_1 Forward -34 -25 10.4228 0.00754
NP_443051.1_1 Reverse -297 -306 7.47288 0.0571
NP_443051.1_1 Forward -249 -240 -0.000272808 0.245
NP_439937.1_8 Forward -121 -102 -1.67217 0.249
NP_439937.1_9 Forward -83 -66 -11.6632 0.261
NP_439937.1_9 Reverse -23 -40 -16.1864 0.287
NP_441740.2_10 Forward -295 -276 10.1275 0.286
NP_440408.1_7 Forward -33 -14 9.53756 0.256
NP_440439.1_1 Reverse -21 -34 18.1122 0.0105
NP_440439.1_1 Forward -36 -23 9.36073 0.0465
NP_440439.1_1 Forward -251 -238 2.08423 0.138
NP_440372.1_2 Forward -32 -25 16.3621 0.0124
NP_440372.1_2 Reverse -25 -32 16.3621 0.0124
NP_440372.1_2 Reverse -299 -306 13.8055 0.0214
NP_440372.1_2 Forward -306 -299 6.52896 0.188
NP_441789.1_7 Reverse -121 -140 -2.45958 0.257
NP_441789.1_7 Reverse -118 -137 -3.63955 0.277
NP_441789.1_7 Reverse -109 -128 -5.21283 0.294
NP_442285.1_1 Reverse -377 -396 9.24257 0.287
NP_440819.1_5 Reverse -252 -260 7.8859 0.266
NP_440316.1_10 Forward -141 -131 7.45319 0.251
NP_441803.1_2 Reverse -19 -38 8.84924 0.111
NP_441803.1_2 Reverse -111 -130 1.76941 0.226
NP_439977.1_5 Forward -39 -20 -2.75381 0.289
NP_441572.1_7 Forward -39 -20 6.19431 0.0821
NP_441572.1_7 Reverse -18 -37 -0.688862 0.182
NP_441572.1_7 Reverse -29 -48 -5.99873 0.278
NP_440267.1_2 Reverse -19 -33 11.5037 0.125
NP_440267.1_2 Forward -253 -239 9.34041 0.156
NP_442384.1_10 Forward -33 -20 18.8988 0.00338
NP_442384.1_10 Reverse -357 -370 7.00078 0.0899
NP_442384.1_10 Reverse -239 -252 6.90245 0.092
NP_442384.1_10 Forward -307 -294 6.4108 0.102
NP_442114.1_4 Reverse -24 -35 12.1534 0.107
NP_440221.1_8 Reverse -62 -81 14.2574 0.15
NP_441018.1_7 Reverse -294 -313 10.6192 0.201
NP_440530.1_6 Forward -271 -257 14.9069 0.264
NP_442790.1_4 Reverse -15 -34 -6.88371 0.147
NP_442790.1_4 Forward -42 -23 -14.9469 0.283
NP_442262.1_8 Reverse -293 -312 20.354 0.156
NP_442262.1_10 Forward -32 -25 14.1988 0.0123
NP_442262.1_10 Reverse -25 -32 14.1988 0.0123
NP_442262.1_10 Forward -306 -299 13.2155 0.0213
NP_441689.1_5 Reverse -22 -32 8.3377 0.132
NP_442244.1_6 Forward -122 -103 0.982764 0.291
NP_440163.1_10 Forward -143 -133 14.533 0.102
NP_440163.1_10 Forward -363 -353 10.8948 0.187
NP_440344.1_1 Reverse -296 -315 7.7676 0.272
NP_440344.1_10 Forward -40 -23 -6.54933 0.114
NP_440344.1_10 Reverse -350 -367 -9.10594 0.139
NP_440344.1_10 Forward -314 -297 -13.3342 0.282
NP_440282.1_10 Reverse -281 -300 -9.047 0.269
NP_440531.1_6 Forward -315 -296 -2.26216 0.247
NP_440531.1_6 Reverse -177 -196 -3.14714 0.262
NP_440531.1_6 Reverse -33 -52 -4.42544 0.28
NP_440531.1_6 Reverse -349 -368 -5.01543 0.291
NP_441060.1_3 Forward -369 -350 7.17762 0.297
NP_440189.1_2 Reverse -16 -35 3.44104 0.268
NP_441965.1_10 Forward -36 -20 10.1866 0.107
NP_440297.1_9 Forward -32 -22 -0.216628 0.282
NP_440297.1_9 Reverse -25 -35 -0.216628 0.282
NP_441103.1_2 Reverse -287 -305 8.6715 0.183
NP_440894.1_10 Forward -312 -293 7.37428 0.205
NP_440999.1_9 Forward -37 -23 11.6026 0.0438
NP_440999.1_9 Forward -311 -297 11.406 0.0448
NP_440999.1_9 Reverse -127 -141 3.04785 0.137
NP_440999.1_9 Reverse -20 -34 1.17956 0.169
NP_440888.1_2 Reverse -24 -38 18.2885 0.00261
NP_440888.1_2 Forward -33 -19 15.9285 0.00837
NP_440888.1_2 Reverse -239 -253 10.8154 0.0842
NP_440888.1_2 Forward -307 -293 9.14375 0.137
NP_440888.1_2 Reverse -131 -145 7.66879 0.186
NP_440888.1_2 Reverse -119 -133 6.78381 0.22
NP_440888.1_2 Forward -262 -248 5.70218 0.267
NP_440888.1_2 Forward -248 -234 5.21053 0.288
NP_440888.1_2 Reverse -298 -312 5.01387 0.298
NP_440822.1_8 Forward -358 -339 7.96426 0.258
NP_440491.1_1 Forward -36 -17 13.4467 0.122
NP_440491.1_1 Forward -143 -124 8.57379 0.236
NP_439969.1_3 Forward -38 -19 1.17943 0.257
NP_442277.1_4 Reverse -15 -34 11.7983 0.0703
NP_442033.1_10 Forward -35 -16 -7.4737 0.186
NP_441543.1_2 Reverse -25 -34 18.486 0.00236
NP_441543.1_2 Forward -32 -23 15.9293 0.00518
NP_441543.1_2 Forward -306 -297 7.07956 0.131
NP_441543.1_2 Reverse -299 -308 6.09625 0.153
NP_442845.1_2 Reverse -292 -306 14.7492 0.0774
NP_442845.1_2 Forward -146 -132 9.04604 0.182
NP_442845.1_2 Reverse -285 -299 6.78443 0.202
NP_442845.1_2 Reverse -18 -32 6.48943 0.209
NP_442845.1_4 Reverse -22 -41 8.75091 0.185
NP_441551.1_5 Forward -37 -21 10.3826 0.193
NP_441178.1_6 Reverse -121 -140 5.80018 0.268
NP_441469.1_8 Forward -34 -25 16.126 0.00797
NP_441469.1_8 Reverse -23 -32 6.5879 0.227
NP_442315.1_1 Forward -142 -124 3.46073 0.288
NP_442315.1_3 Reverse -286 -305 8.75091 0.202
NP_442315.1_5 Forward -136 -126 16.4013 0.3
NP_443064.1_6 Forward -248 -238 13.9243 0.0796
NP_443064.1_6 Reverse -239 -249 12.1791 0.0975
NP_443064.1_6 Forward -33 -23 10.8217 0.13
NP_442578.1_7 Forward -32 -25 14.5921 0.026
NP_442578.1_7 Reverse -25 -32 14.5921 0.026
NP_442578.1_7 Reverse -299 -306 6.0373 0.18
NP_440710.1_1 Forward -256 -238 -9.32229 0.297
NP_440071.1_6 Forward -137 -123 18.071 0.108
NP_441462.1_2 Forward -33 -23 20.2362 0.000805
NP_441462.1_2 Reverse -24 -34 11.5831 0.00406
NP_441462.1_2 Reverse -298 -308 8.82982 0.03
NP_441462.1_2 Reverse -239 -249 0.668351 0.135
NP_441621.1_7 Forward -35 -21 14.0609 0.0266
NP_441621.1_7 Reverse -22 -36 -3.34366 0.188
NP_441621.1_7 Reverse -129 -143 -6.19526 0.279
NP_443062.1_1 Reverse -24 -42 14.8839 0.0427
NP_443062.1_1 Forward -33 -15 7.96088 0.163
NP_443062.1_1 Reverse -298 -316 4.64563 0.255
NP_441601.1_4 Reverse -133 -152 -2.45882 0.293
NP_441601.1_4 Reverse -353 -372 -3.14714 0.293
NP_441410.1_3 Reverse -15 -34 6.39097 0.23
NP_442204.1_1 Reverse -20 -31 21.1015 0.0035
NP_442204.1_2 Reverse -14 -33 14.5524 0.188
NP_442204.1_5 Forward -43 -24 9.24257 0.105
NP_442204.1_5 Reverse -160 -179 0.392778 0.264
NP_440516.1_8 Forward -33 -24 16.9127 0.00442
NP_440516.1_8 Reverse -24 -33 16.9127 0.00442
NP_440516.1_8 Reverse -298 -307 9.4395 0.0183
NP_440516.1_8 Forward -307 -298 5.11294 0.118
NP_440516.1_8 Forward -140 -131 -0.196935 0.185
NP_442080.1_7 Forward -25 -6 6.68596 0.122
NP_442080.1_7 Forward -151 -132 0.196116 0.239
NP_441033.1_2 Forward -43 -24 -7.67036 0.293
NP_442428.1_5 Forward -32 -25 15.8704 0.0124
NP_442428.1_5 Reverse -25 -32 15.8704 0.0124
NP_442428.1_5 Reverse -299 -306 6.13563 0.209
NP_442428.1_5 Forward -306 -299 6.0373 0.212
NP_442120.1_10 Reverse -339 -358 -6.68705 0.217
NP_442120.1_10 Forward -39 -20 -15.4385 0.294
NP_440673.1_2 Forward -43 -24 8.92631 0.26
NP_440673.1_3 Forward -305 -298 12.4288 0.0426
NP_440673.1_3 Forward -31 -24 12.4288 0.0426
NP_440673.1_3 Reverse -26 -33 12.4288 0.0426
NP_440673.1_7 Forward -31 -12 5.40766 0.178
NP_440718.1_2 Reverse -275 -294 10.6192 0.28
NP_440865.1_9 Forward -39 -20 2.16274 0.116
NP_441052.1_2 Reverse -357 -367 10.5014 0.0285
NP_441052.1_2 Reverse -24 -34 10.5014 0.0285
NP_441052.1_2 Forward -33 -23 10.4031 0.0285
NP_441052.1_2 Forward -248 -238 8.63316 0.0415
NP_441052.1_2 Forward -307 -297 1.65166 0.233
NP_440992.1_2 Reverse -286 -305 10.6192 0.273
NP_442219.1_8 Reverse -142 -161 10.1964 0.21
NP_442219.1_8 Reverse -181 -200 7.10414 0.277
NP_442219.1_9 Reverse -25 -34 8.35786 0.0681
NP_442219.1_9 Forward -32 -23 8.25953 0.0681
NP_442219.1_9 Forward -306 -297 7.96454 0.0696
NP_442219.1_9 Forward -247 -238 5.3096 0.177
NP_440436.1_4 Reverse -25 -34 18.1905 0.00233
NP_440436.1_4 Forward -32 -23 9.24241 0.0871
NP_440436.1_4 Forward -306 -297 7.57079 0.124
NP_440436.1_4 Reverse -299 -308 7.37413 0.132
NP_440436.1_4 Forward -247 -238 4.52254 0.256
NP_441884.1_8 Forward -34 -15 -11.7019 0.271
NP_441884.1_9 Forward -36 -17 -13.3736 0.138
NP_441336.1_3 Reverse -17 -31 13.9626 0.298
NP_442864.1_2 Reverse -105 -124 11.1109 0.255
NP_440314.1_9 Reverse -25 -44 -7.67036 0.241
NP_442414.1_9 Reverse -5 -24 11.1109 0.282
NP_442907.1_9 Forward -300 -281 -5.80207 0.284
NP_441719.1_4 Forward -32 -25 16.3621 0.0124
NP_441719.1_4 Reverse -25 -32 16.3621 0.0124
NP_441719.1_4 Reverse -299 -306 6.82395 0.0855
NP_441719.1_4 Forward -306 -299 6.52896 0.188
NP_441733.1_10 Forward -36 -23 10.5407 0.106
NP_441733.1_10 Reverse -295 -308 9.55739 0.113
NP_441733.1_10 Reverse -21 -34 5.82081 0.203
NP_441004.1_1 Forward -137 -118 3.83436 0.106
NP_441004.1_1 Forward -26 -7 3.73603 0.106
NP_441004.1_1 Forward -131 -112 -8.65367 0.201
NP_441004.1_1 Forward -152 -133 -8.94866 0.206
NP_441004.1_1 Forward -372 -353 -10.1286 0.218
NP_441004.1_1 Reverse -293 -312 -11.5053 0.24
NP_441004.1_1 Forward -140 -121 -12.0953 0.244
NP_441004.1_1 Forward -122 -103 -13.1769 0.255
NP_441004.1_1 Reverse -235 -254 -18.0934 0.297
NP_441004.1_2 Forward -142 -123 3.04771 0.212
NP_441004.1_2 Reverse -182 -201 2.3594 0.215
NP_441004.1_2 Forward -136 -117 -1.08219 0.259
NP_441004.1_4 Reverse -190 -200 8.04317 0.282
NP_442366.1_3 Forward -34 -16 16.1454 0.0198
NP_442366.1_3 Forward -308 -290 4.9357 0.0899
NP_442366.1_3 Reverse -23 -41 -3.91409 0.26
NP_442366.1_5 Reverse -295 -305 14.8275 0.0375
NP_442366.1_5 Reverse -236 -246 11.8776 0.156
NP_442873.1_3 Reverse -118 -137 4.03023 0.274
NP_442873.1_5 Reverse -124 -143 9.7334 0.248
NP_441115.1_4 Forward -34 -16 18.1112 0.0152
NP_441115.1_4 Reverse -23 -41 8.47483 0.247
NP_440328.1_4 Reverse -18 -37 8.65258 0.111
NP_443054.1_2 Reverse -22 -36 19.7641 0.0121
NP_443054.1_2 Forward -250 -236 4.52282 0.24
NP_442430.1_4 Forward -35 -16 18.1907 0.137
NP_441966.1_7 Reverse -347 -366 5.11187 0.192
NP_440864.1_3 Reverse -128 -147 8.25926 0.297
NP_441851.1_10 Forward -34 -24 16.008 0.00552
NP_441851.1_10 Reverse -238 -248 12.6647 0.046
NP_441851.1_10 Reverse -23 -33 8.53483 0.114
NP_441851.1_10 Reverse -297 -307 7.35486 0.142
NP_441851.1_10 Forward -249 -239 5.38824 0.214
NP_442208.1_5 Forward -35 -16 2.55606 0.248
NP_441668.1_4 Reverse -14 -33 -1.18052 0.27
NP_442515.1_1 Reverse -23 -37 -3.34366 0.29
NP_441396.1_5 Forward -139 -130 7.66954 0.241
NP_441396.1_5 Reverse -303 -312 7.27622 0.29
NP_441683.1_5 Forward -305 -286 8.06259 0.248
NP_440593.1_3 Forward -377 -358 -5.11376 0.258
NP_440593.1_9 Forward -143 -129 8.16106 0.261
NP_440463.1_8 Reverse -121 -140 12.9214 0.199
NP_442709.1_3 Reverse -232 -251 12.1925 0.109
NP_441046.1_2 Forward -84 -65 -1.18052 0.288
NP_441046.1_2 Forward -133 -114 -1.67217 0.292
NP_441349.1_10 Forward -43 -24 0.0977854 0.0906
NP_441349.1_10 Reverse -14 -33 -0.787193 0.0964
NP_441349.1_10 Forward -54 -35 -6.1954 0.223
NP_441409.1_6 Reverse -18 -37 -9.047 0.178
NP_440432.1_9 Reverse -25 -40 14.9262 0.0135
NP_441062.1_6 Forward -270 -252 15.948 0.246
NP_442843.1_1 Forward -26 -7 -5.60541 0.244
NP_442843.1_1 Forward -90 -71 -10.7186 0.28
NP_442843.1_1 Forward -152 -133 -11.0136 0.285
NP_439960.1_6 Reverse -285 -304 9.93088 0.22
NP_439960.1_6 Forward -295 -276 9.3409 0.235
NP_439960.1_10 Reverse -17 -35 7.19731 0.138
NP_439960.1_10 Reverse -243 -261 0.412472 0.212
NP_439960.1_10 Forward -373 -355 -2.3408 0.254
NP_440474.1_8 Reverse -25 -39 16.3219 0.0486
NP_441477.1_5 Forward -184 -165 8.94757 0.268
NP_441477.1_9 Forward -186 -167 17.109 0.15
NP_440588.1_2 Reverse -15 -34 16.5191 0.0108
NP_440588.1_2 Forward -375 -356 -0.39387 0.15
NP_440588.1_2 Forward -149 -130 -1.96717 0.158
NP_440195.1_4 Reverse -286 -305 5.89931 0.284
NP_442006.1_2 Forward -140 -123 -15.4975 0.227
NP_442006.1_2 Reverse -144 -161 -17.4641 0.276
NP_441003.1_9 Reverse -128 -147 6.68596 0.242
NP_442243.1_1 Reverse -244 -262 -2.53818 0.293
NP_441570.1_1 Reverse -292 -310 -17.0904 0.264
NP_441078.1_4 Forward -33 -24 19.6659 0.0007
NP_441078.1_4 Reverse -24 -33 19.6659 0.0007
NP_441078.1_4 Reverse -239 -248 7.37455 0.0688
NP_441078.1_4 Forward -248 -239 7.37455 0.0688
NP_441078.1_4 Reverse -357 -366 6.29291 0.079
NP_441078.1_4 Reverse -298 -307 0.0980582 0.205
NP_441078.1_4 Forward -307 -298 0.0980582 0.205
NP_441078.1_4 Forward -366 -357 -2.06522 0.295
NP_442729.1_5 Forward -141 -131 12.6647 0.235
NP_441663.1_8 Reverse -18 -37 0.687771 0.215
NP_440707.1_6 Reverse -16 -35 13.47 0.18
NP_440707.1_9 Forward -139 -120 2.55606 0.27
NP_440707.1_9 Forward -359 -340 -0.197208 0.299
NP_442443.1_1 Forward -136 -117 -4.13045 0.268
NP_442443.1_1 Forward -139 -120 -5.40875 0.282
NP_442443.1_1 Reverse -16 -35 -6.68705 0.295
NP_440793.1_1 Forward -267 -253 10.422 0.291
NP_441094.1_1 Reverse -120 -134 18.9768 0.247
NP_440526.1_3 Reverse -25 -36 11.7595 0.0646
NP_440526.1_3 Forward -306 -295 0.64819 0.273
NP_440526.1_3 Forward -247 -236 0.156538 0.297
NP_441432.1_8 Reverse -23 -32 16.8143 0.00595
NP_441432.1_8 Reverse -297 -306 14.0611 0.0258
NP_441432.1_8 Forward -34 -25 8.25953 0.0755
NP_441333.1_1 Forward -275 -265 12.7339 0.229
NP_442320.1_8 Forward -39 -25 23.9923 0.00275
NP_442320.1_8 Forward -313 -299 4.91614 0.0442
NP_442320.1_8 Reverse -292 -306 -5.40861 0.225
NP_441732.1_2 Reverse -20 -36 3.20513 0.0141
NP_440497.1_6 Forward -145 -126 -1.08219 0.264
NP_442003.1_4 Reverse -299 -318 9.73422 0.299
NP_440760.1_1 Forward -33 -14 -13.5702 0.107
NP_442797.1_1 Reverse -118 -137 -4.52377 0.286
NP_442797.1_1 Reverse -121 -140 -5.40875 0.288
NP_442797.1_6 Reverse -103 -122 8.61286 0.265
NP_442797.1_7 Forward -254 -236 0.609134 0.272
NP_442797.1_7 Forward -255 -237 -0.374176 0.282
NP_442797.1_7 Reverse -278 -296 -1.65248 0.299
NP_442797.1_9 Reverse -239 -257 8.7706 0.265
NP_440199.1_10 Reverse -295 -305 7.25653 0.231
NP_441057.1_3 Reverse -66 -85 -10.817 0.214
NP_441057.1_3 Forward -257 -238 -11.8986 0.247
NP_441057.1_4 Forward -132 -114 -4.01242 0.299
NP_441072.1_2 Forward -44 -25 7.37428 0.257
NP_442489.1_7 Forward -33 -24 20.1576 0.000695
NP_442489.1_7 Reverse -24 -33 20.1576 0.000695
NP_442489.1_7 Forward -307 -298 0.786375 0.152
NP_442489.1_7 Forward -248 -239 0.589713 0.17
NP_442489.1_7 Reverse -298 -307 0.589713 0.17
NP_442489.1_7 Reverse -239 -248 0.589713 0.17
NP_442489.1_7 Reverse -357 -366 -1.6719 0.235
NP_440559.1_1 Reverse -25 -34 8.75118 0.0586
NP_440559.1_1 Forward -32 -23 8.65285 0.0586
NP_440559.1_1 Forward -306 -297 7.76787 0.0918
NP_440559.1_1 Reverse -299 -308 6.09625 0.134
NP_441659.2_8 Forward -33 -23 20.9245 0.000805
NP_441659.2_8 Forward -307 -297 12.7631 0.0147
NP_441659.2_8 Reverse -24 -34 11.9764 0.0147
NP_441659.2_8 Reverse -239 -249 1.35667 0.242
NP_441659.2_8 Reverse -131 -141 0.471689 0.264
NP_440363.1_9 Forward -131 -113 13.5888 0.249
NP_442913.1_9 Reverse -292 -311 10.9142 0.2
NP_442913.1_10 Forward -42 -23 5.70265 0.0684
NP_442913.1_10 Reverse -230 -249 -5.60541 0.271
NP_441040.1_2 Reverse -16 -35 -13.6686 0.284
NP_441040.1_2 Forward -148 -129 -14.4552 0.286
NP_441040.1_3 Forward -133 -114 8.84924 0.289
NP_442008.1_2 Forward -36 -17 6.09597 0.223
NP_441800.1_7 Reverse -114 -132 18.5054 0.0382
NP_440779.1_5 Reverse -24 -41 -4.87771 0.12
NP_442346.1_5 Reverse -23 -33 16.303 0.00248
NP_442346.1_5 Forward -34 -24 9.02648 0.118
NP_442346.1_5 Reverse -297 -307 7.05986 0.183
NP_440352.1_5 Reverse -359 -378 15.1865 0.13
NP_440352.1_5 Forward -95 -76 12.5584 0.229
NP_440545.1_2 Forward -115 -96 13.3853 0.296
NP_440545.1_3 Forward -37 -20 7.11867 0.0518
NP_440545.1_3 Reverse -20 -37 -1.0428 0.162
NP_440545.1_3 Forward -370 -353 -2.41943 0.184
NP_441629.1_3 Reverse -124 -143 8.65176 0.178
NP_440459.1_2 Forward -309 -292 17.9351 0.0733
NP_440459.1_7 Forward -35 -21 17.3641 0.0994
NP_441653.1_2 Reverse -287 -306 6.6219 0.225
NP_440010.1_3 Forward -359 -340 -8.55534 0.297
NP_440010.1_4 Reverse -103 -122 -1.37794 0.267
NP_440010.1_10 Forward -158 -139 13.5691 0.181
NP_442551.1_4 Forward -125 -110 -3.85501 0.297
NP_442603.1_7 Forward -33 -19 10.5204 0.125
NP_442603.1_7 Reverse -131 -145 5.99717 0.264
NP_441233.1_2 Forward -136 -117 19.2723 0.122
NP_441888.1_7 Reverse -19 -33 3.8345 0.225
NP_441888.1_7 Forward -312 -298 1.86788 0.235
NP_441050.1_5 Forward -135 -117 -1.84914 0.271
NP_440449.1_6 Forward -41 -23 12.2436 0.115
NP_441948.1_4 Reverse -17 -35 -3.02911 0.181
NP_441948.1_4 Forward -255 -237 -3.52077 0.198
NP_441833.1_4 Forward -32 -25 15.9687 0.0124
NP_441833.1_4 Reverse -25 -32 15.9687 0.0124
NP_441833.1_4 Forward -306 -299 6.52896 0.0924
NP_441833.1_4 Reverse -299 -306 6.23397 0.163
NP_442799.1_2 Reverse -80 -99 5.80098 0.18
NP_442162.1_9 Forward -32 -25 16.2637 0.0124
NP_442162.1_9 Reverse -25 -32 16.2637 0.0124
NP_442162.1_9 Forward -306 -299 12.9205 0.0282
NP_442162.1_9 Reverse -299 -306 12.9205 0.0282
NP_440671.1_2 Forward -30 -16 16.3225 0.155
NP_440671.1_4 Reverse -18 -32 10.0294 0.165
NP_440671.1_4 Reverse -292 -306 8.35772 0.201
NP_440671.1_4 Forward -146 -132 7.76774 0.208
NP_440671.1_4 Reverse -285 -299 5.40779 0.283
NP_440671.1_4 Forward -39 -25 5.40779 0.283
NP_440671.1_5 Reverse -126 -140 15.8302 0.208
NP_442404.1_9 Reverse -2 -16 9.73373 0.263
NP_440224.1_1 Forward -259 -240 -3.63879 0.267
NP_442045.1_5 Reverse -110 -129 -0.688862 0.269
NP_442045.1_5 Reverse -119 -138 -1.27885 0.29
NP_442140.1_3 Reverse -25 -35 17.4829 0.0159
NP_442140.1_3 Forward -306 -296 10.2065 0.0902
NP_442140.1_3 Forward -32 -22 4.69992 0.238
NP_442140.1_3 Reverse -299 -309 4.69992 0.238
NP_442723.1_1 Forward -322 -303 1.17865 0.298
NP_440875.1_9 Reverse -26 -36 17.619 0.0104
NP_440875.1_9 Forward -31 -21 16.5483 0.0145
NP_440875.1_9 Reverse -173 -183 6.81464 0.297
NP_442547.1_7 Reverse -8 -27 14.4078 0.171
NP_441813.1_5 Reverse -22 -32 18.1713 0.00743
NP_441813.1_5 Forward -309 -299 15.5163 0.0106
NP_441813.1_5 Forward -35 -25 10.0098 0.0208
NP_442254.1_1 Forward -158 -139 -4.81876 0.282
NP_440590.1_4 Reverse -25 -38 11.9173 0.0173
NP_440590.1_4 Reverse -299 -312 11.524 0.0197
NP_440590.1_4 Forward -306 -293 9.55739 0.0347
NP_440590.1_4 Forward -32 -19 4.44418 0.0601
NP_440567.1_1 Reverse -25 -39 12.3893 0.0236
NP_440567.1_1 Forward -32 -18 5.80112 0.0959
NP_440567.1_1 Forward -306 -292 2.16287 0.182
NP_440567.1_1 Reverse -299 -313 -0.000409212 0.261
NP_442497.1_10 Forward -32 -23 17.601 0.00813
NP_442497.1_10 Reverse -25 -34 10.4228 0.0087
NP_442497.1_10 Forward -306 -297 0.589713 0.153
NP_442497.1_10 Reverse -299 -308 -1.18024 0.256
NP_440821.1_4 Forward -35 -25 18.7612 0.00422
NP_440821.1_4 Reverse -22 -32 2.24165 0.131
NP_440821.1_4 Reverse -296 -306 -0.314959 0.251
NP_441239.1_9 Forward -35 -23 16.0669 0.0175
NP_441239.1_9 Reverse -22 -34 15.5753 0.0186
NP_441239.1_9 Forward -309 -297 11.347 0.0627
NP_441239.1_9 Forward -155 -143 8.9871 0.117
NP_441239.1_9 Reverse -242 -254 5.74217 0.21
NP_441239.1_9 Reverse -129 -141 5.54551 0.217
NP_441239.1_9 Forward -302 -290 4.5622 0.251
NP_441239.1_9 Reverse -121 -133 4.16888 0.26
NP_441239.1_9 Reverse -278 -290 3.18557 0.292
NP_441951.1_4 Reverse -292 -311 11.1109 0.228
NP_441951.1_4 Forward -146 -127 4.71934 0.273
NP_441951.1_6 Reverse -134 -153 10.9142 0.248
NP_440156.1_4 Reverse -74 -84 13.2542 0.176
NP_440400.1_1 Reverse -113 -132 -2.16459 0.285
NP_440400.1_1 Reverse -2 -21 -2.95123 0.288
NP_441892.1_1 Reverse -135 -152 4.6604 0.108
NP_441892.1_1 Reverse -15 -32 2.00546 0.145
NP_440665.1_1 Forward -152 -133 3.53937 0.146
NP_442193.1_1 Forward -131 -113 7.88563 0.28
NP_442193.1_8 Forward -36 -17 9.63507 0.292
NP_442643.1_1 Forward -39 -20 -10.4236 0.231
NP_442643.1_3 Reverse -352 -371 -8.94866 0.297
NP_441017.1_6 Forward -311 -297 12.192 0.224
NP_443035.1_10 Forward -160 -143 11.8386 0.209
NP_440354.1_5 Forward -36 -17 7.07928 0.174
NP_440546.1_4 Reverse -298 -308 14.5061 0.0459
NP_440546.1_4 Forward -33 -23 13.5365 0.0459
NP_440546.1_4 Reverse -24 -34 11.8882 0.0679
NP_440546.1_4 Forward -307 -297 8.20381 0.199
NP_440546.1_4 Forward -50 -40 7.91294 0.214
NP_440546.1_4 Forward -333 -323 7.33119 0.246
NP_440546.1_7 Reverse -244 -254 15.8113 0.237
NP_443033.1_7 Reverse -280 -299 21.2389 0.0748
NP_441230.1_5 Forward -38 -19 5.60432 0.182
NP_441230.1_5 Reverse -126 -145 0.196116 0.273
NP_441230.1_5 Forward -312 -293 -0.885524 0.292
NP_440462.1_6 Reverse -22 -32 18.7612 0.00454
NP_440462.1_6 Forward -35 -25 17.9746 0.00578
NP_440462.1_6 Forward -309 -299 13.648 0.0266
NP_440462.1_6 Forward -250 -240 7.15819 0.089
NP_442465.1_9 Forward -69 -55 14.1593 0.208
NP_442465.1_9 Reverse -255 -269 11.111 0.271
NP_442592.1_3 Forward -303 -284 11.6025 0.219
NP_440868.1_4 Forward -37 -25 9.77374 0.043
NP_440868.1_4 Reverse -20 -32 8.00379 0.0602
NP_440341.1_7 Forward -248 -234 11.996 0.225
NP_442402.1_4 Forward -256 -237 -1.08295 0.189
NP_442402.1_4 Forward -303 -284 -5.80282 0.248
NP_441848.1_4 Forward -90 -74 7.83714 0.288
NP_441848.1_7 Forward -383 -364 -2.8529 0.271
NP_441084.1_6 Reverse -289 -303 14.192 0.106
NP_441084.1_6 Reverse -22 -36 12.4467 0.16
NP_440653.1_10 Forward -306 -287 5.211 0.234
NP_440696.1_3 Forward -212 -194 -0.865831 0.249
NP_442039.1_4 Forward -32 -25 15.1821 0.0124
NP_442039.1_4 Reverse -25 -32 15.1821 0.0124
NP_442039.1_4 Reverse -299 -306 11.6422 0.0747
NP_442625.1_3 Forward -287 -268 11.9958 0.22
NP_440008.1_9 Reverse -18 -37 7.66927 0.283
NP_440825.1_7 Forward -306 -296 10.9578 0.278
NP_442837.1_3 Forward -32 -25 15.7721 0.0124
NP_442837.1_3 Reverse -25 -32 15.7721 0.0124
NP_442837.1_3 Reverse -240 -247 9.47889 0.125
NP_442837.1_3 Forward -247 -240 9.47889 0.125
NP_442837.1_3 Forward -306 -299 6.0373 0.25
NP_442837.1_3 Reverse -299 -306 6.0373 0.25
NP_442053.1_1 Forward -33 -24 18.3876 0.0007
NP_442053.1_1 Reverse -24 -33 18.3876 0.0007
NP_442053.1_1 Forward -307 -298 7.17789 0.104
NP_442053.1_1 Forward -248 -239 5.3096 0.197
NP_442053.1_1 Reverse -239 -248 5.3096 0.197
NP_440505.1_3 Reverse -22 -32 17.188 0.00332
NP_440505.1_3 Forward -35 -25 14.1397 0.0235
NP_440505.1_3 Forward -250 -240 13.0581 0.0387
NP_440505.1_3 Reverse -296 -306 7.64985 0.151
NP_440505.1_3 Reverse -237 -247 5.09324 0.246
NP_440505.1_7 Reverse -20 -39 -1.18052 0.271
NP_441959.1_10 Reverse -297 -315 15.2844 0.178
NP_441102.1_10 Forward -140 -121 5.70265 0.289
NP_442456.1_5 Forward -144 -126 8.57394 0.26
NP_441252.1_6 Forward -23 -16 11.9372 0.25
NP_441203.1_1 Forward -32 -13 -3.54046 0.0699
NP_441203.1_1 Reverse -25 -44 -11.6036 0.139
NP_441408.2_7 Forward -35 -16 -5.60541 0.297
NP_440914.1_1 Forward -33 -23 16.3248 0.00196
NP_440914.1_1 Forward -307 -297 14.373 0.0158
NP_440914.1_1 Forward -248 -238 12.8115 0.0461
NP_440914.1_1 Reverse -239 -249 11.5428 0.0887
NP_440914.1_1 Reverse -24 -34 8.6151 0.186
NP_440914.1_1 Reverse -286 -296 7.24882 0.242
NP_441011.1_8 Reverse -25 -34 16.9127 0.00602
NP_441011.1_8 Forward -32 -23 16.6177 0.00602
NP_441011.1_8 Reverse -299 -308 14.651 0.023
NP_442533.1_1 Forward -143 -124 -3.63879 0.14
NP_442533.1_1 Forward -137 -118 -3.63879 0.14
NP_442533.1_1 Forward -149 -130 -13.4719 0.237
NP_442533.1_6 Forward -33 -24 17.2076 0.00137
NP_442533.1_6 Reverse -24 -33 17.2076 0.00137
NP_442533.1_6 Forward -248 -239 6.78456 0.103
NP_442533.1_6 Reverse -239 -248 6.78456 0.103
NP_442533.1_6 Reverse -298 -307 5.40793 0.14
NP_442533.1_6 Reverse -357 -366 5.01461 0.16
NP_442533.1_6 Forward -307 -298 4.52295 0.179
NP_442533.1_6 Forward -300 -291 2.65466 0.246
NP_442232.1_3 Reverse -16 -35 -7.17871 0.194
NP_442232.1_3 Forward -136 -117 -14.2585 0.288
NP_442232.1_3 Reverse -236 -255 -15.6352 0.295
NP_442322.1_4 Reverse -116 -133 8.88789 0.141
NP_442322.1_4 Reverse -115 -132 -7.82829 0.286
NP_442322.1_4 Reverse -122 -139 -8.71327 0.286
NP_441482.1_7 Reverse -18 -32 6.98109 0.0257
NP_439944.1_9 Reverse -25 -35 10.4031 0.0887
NP_439944.1_9 Forward -32 -22 9.12481 0.1
NP_441697.1_5 Forward -282 -263 -11.5072 0.295
NP_441697.1_5 Reverse -255 -274 -11.6027 0.297
NP_441028.1_6 Forward -258 -248 6.0761 0.232
NP_442664.1_9 Reverse -84 -103 22.3206 0.0539
NP_440115.1_6 Reverse -21 -31 14.0414 0.0615
NP_440007.1_4 Forward -44 -25 9.24257 0.274
NP_440007.1_9 Reverse -288 -302 6.88276 0.216
NP_440007.1_9 Reverse -20 -34 2.06454 0.281
NP_439965.1_1 Reverse -15 -34 -9.14533 0.284
NP_443045.1_2 Reverse -125 -144 16.8141 0.181
NP_441972.1_5 Reverse -25 -44 -3.63879 0.201
NP_441972.1_5 Forward -139 -120 -8.65367 0.27
NP_441972.1_5 Forward -306 -287 -9.73531 0.293
NP_441106.1_1 Reverse -23 -32 18.486 0.0028
NP_441106.1_1 Forward -34 -25 18.191 0.0028
NP_441106.1_1 Forward -308 -299 7.66954 0.0776
NP_440429.1_2 Reverse -120 -139 9.0459 0.272
NP_442588.1_6 Forward -188 -169 4.32602 0.199
NP_442928.1_3 Forward -147 -128 16.5752 0.205
NP_442306.1_10 Reverse -19 -38 -9.73531 0.11
NP_441286.1_1 Reverse -23 -35 5.34885 0.0259
NP_441286.1_1 Forward -34 -22 -3.59927 0.145
NP_441286.1_1 Reverse -198 -210 -6.05754 0.245
NP_442674.1_1 Reverse -251 -270 17.7452 0.133
NP_440670.1_8 Forward -33 -24 18.3876 0.000699
NP_440670.1_8 Reverse -24 -33 18.3876 0.000699
NP_440670.1_8 Reverse -298 -307 8.65285 0.0627
NP_440670.1_8 Forward -307 -298 6.29291 0.124
NP_441479.1_1 Forward -36 -17 16.1257 0.0989
NP_441479.1_1 Reverse -236 -255 6.68596 0.292
NP_442908.1_9 Forward -374 -355 8.35759 0.289
NP_440886.1_7 Forward -34 -24 17.7774 0.0011
NP_440886.1_7 Reverse -130 -140 15.2208 0.0327
NP_440886.1_7 Reverse -23 -33 8.04271 0.0805
NP_440886.1_7 Forward -308 -298 7.74772 0.0843
NP_440886.1_7 Reverse -356 -366 6.86274 0.113
NP_440886.1_7 Reverse -118 -128 4.50281 0.232
NP_440828.1_1 Reverse -115 -134 -0.492971 0.27
NP_440828.1_4 Reverse -109 -128 -0.492971 0.19
NP_442382.1_7 Reverse -285 -304 6.58763 0.229
NP_440404.1_10 Reverse -267 -280 16.7146 0.254
NP_442072.1_9 Reverse -23 -41 -2.24246 0.0317
NP_442072.1_9 Forward -34 -16 -12.8622 0.0926
NP_442072.1_9 Forward -308 -290 -12.9605 0.095
NP_442072.1_9 Reverse -297 -315 -14.6322 0.153
NP_442213.1_6 Reverse -174 -193 3.6377 0.29
NP_441808.1_8 Forward -146 -127 8.75091 0.259
NP_442022.1_4 Forward -122 -103 5.70265 0.279
NP_442022.1_4 Forward -131 -112 5.211 0.293
NP_440907.2_8 Reverse -25 -35 17.4824 0.00685
NP_440907.2_8 Forward -32 -22 9.616 0.103
NP_440907.2_8 Forward -306 -296 5.87944 0.184
NP_440907.2_8 Reverse -240 -250 5.68278 0.191
NP_441021.1_1 Forward -306 -287 5.60432 0.0704
NP_441021.1_8 Reverse -19 -37 3.95239 0.226
NP_440193.1_1 Forward -35 -16 22.6441 0.0222
NP_441463.1_3 Forward -305 -286 -6.88371 0.251
NP_441463.1_3 Reverse -1 -20 -9.34199 0.278
NP_441463.1_3 Forward -43 -24 -9.73531 0.284
NP_441626.1_2 Forward -32 -25 15.7721 0.0124
NP_441626.1_2 Reverse -25 -32 15.7721 0.0124
NP_441626.1_2 Reverse -299 -306 12.2322 0.0511
NP_441626.1_2 Forward -306 -299 5.93897 0.231
NP_442211.1_3 Reverse -280 -299 12.3352 0.243
NP_440107.1_5 Reverse -112 -131 6.78429 0.139
NP_440107.1_5 Reverse -17 -36 -5.99873 0.225
NP_442794.1_1 Reverse -20 -32 10.5604 0.0721
NP_442794.1_1 Reverse -294 -306 2.69391 0.286
NP_442615.1_1 Forward -42 -24 11.4255 0.0179
NP_442615.1_1 Reverse -15 -33 0.314141 0.105
NP_441962.1_4 Forward -127 -108 -13.0786 0.268
NP_441962.1_5 Reverse -126 -145 12.3892 0.158
NP_440387.1_1 Forward -33 -17 -0.334789 0.137
NP_440387.1_1 Forward -248 -232 -6.33298 0.279
NP_440387.1_5 Reverse -37 -56 11.9031 0.26
NP_441431.1_2 Forward -310 -296 15.8302 0.0441
NP_441431.1_2 Reverse -21 -35 13.1753 0.0952
NP_441431.1_2 Forward -36 -22 9.24208 0.19
NP_441488.1_8 Reverse -293 -307 11.602 0.146
NP_441488.1_8 Reverse -19 -33 9.73373 0.146
NP_441836.1_2 Forward -56 -37 -6.39206 0.297
NP_441993.1_1 Reverse -292 -311 16.2729 0.0608
NP_441993.1_1 Forward -39 -20 11.3026 0.115
NP_441993.1_1 Reverse -357 -376 8.7687 0.139
NP_441993.1_1 Reverse -18 -37 3.60346 0.231
NP_441993.1_1 Forward -33 -14 0.582284 0.297
NP_441174.1_2 Reverse -21 -35 19.8624 0.00567
NP_440814.1_4 Reverse -289 -308 -12.9802 0.254
NP_440467.1_3 Forward -252 -233 16.4323 0.101
NP_440467.1_8 Reverse -107 -126 10.5209 0.273
NP_440114.1_10 Reverse -24 -38 15.3392 0.0264
NP_440114.1_10 Reverse -291 -305 7.37441 0.236
NP_442323.1_7 Forward -306 -287 11.405 0.14
NP_442323.1_7 Reverse -19 -38 6.39016 0.194
NP_441510.2_7 Reverse -292 -306 11.1104 0.28
NP_440287.1_6 Reverse -289 -308 6.78429 0.16
NP_440293.1_3 Forward -139 -120 0.392778 0.22
NP_440293.1_10 Forward -134 -115 1.76941 0.219
NP_440766.1_4 Reverse -294 -308 12.8809 0.0431
NP_440766.1_4 Reverse -20 -34 7.76774 0.0871
NP_439988.1_3 Forward -32 -18 6.19444 0.278
NP_439988.1_3 Reverse -133 -147 4.52282 0.295
NP_442743.1_1 Reverse -121 -140 5.01354 0.288
NP_442743.1_4 Reverse -240 -259 -4.72043 0.255
NP_442930.1_1 Reverse -263 -273 14.1392 0.239
NP_442930.1_1 Reverse -74 -84 10.6976 0.276
NP_439910.1_2 Forward -41 -24 -2.91109 0.0305
NP_439910.1_2 Forward -315 -298 -12.9408 0.113
NP_440457.1_1 Reverse -20 -32 7.70879 0.101
NP_440457.1_1 Reverse -294 -306 0.530633 0.25
NP_440457.1_1 Forward -130 -118 -1.14099 0.294
NP_440798.1_6 Reverse -25 -38 12.3107 0.0468
NP_440798.1_6 Forward -32 -19 2.08423 0.186
NP_442680.1_5 Reverse -249 -268 6.71518 0.207
NP_440801.1_10 Forward -144 -125 5.211 0.289
NP_441984.1_1 Forward -131 -113 8.18062 0.262
NP_441984.1_3 Forward -311 -293 9.26226 0.211
NP_441984.1_4 Forward -146 -132 11.7993 0.299
NP_441984.1_6 Forward -200 -188 15.4769 0.219
NP_441332.1_6 Reverse -130 -140 12.034 0.236
NP_441436.1_8 Reverse -297 -316 12.1925 0.243
NP_440473.1_9 Forward -148 -129 -7.57203 0.238
NP_442509.1_9 Reverse -24 -34 16.2041 0.00739
NP_442509.1_9 Forward -33 -23 8.04271 0.192
NP_441871.1_1 Reverse -207 -226 13.7658 0.198
NP_440554.1_4 Forward -32 -22 17.9746 0.0131
NP_440554.1_4 Reverse -25 -35 13.943 0.0218
NP_440554.1_4 Reverse -299 -309 8.82982 0.0646
NP_441885.1_5 Reverse -24 -34 11.4848 0.00668
NP_441885.1_5 Forward -33 -23 11.3864 0.00668
NP_441885.1_5 Forward -248 -238 8.92815 0.0272
NP_441885.1_5 Reverse -298 -308 7.94484 0.0385
NP_441885.1_5 Forward -307 -297 1.35667 0.11
NP_441885.1_5 Reverse -357 -367 0.471689 0.145
NP_441885.1_5 Reverse -239 -249 -0.609952 0.215
NP_440478.1_10 Forward -35 -21 14.5526 0.107
NP_442341.1_7 Forward -308 -294 8.35772 0.0881
NP_442341.1_7 Forward -367 -353 4.32615 0.194
NP_442341.1_7 Reverse -23 -37 3.8345 0.21
NP_442341.1_7 Forward -34 -20 1.67122 0.282
NP_442341.1_9 Forward -250 -236 9.14375 0.156
NP_442341.1_9 Forward -309 -295 5.30886 0.274
NP_441756.1_5 Forward -37 -18 5.01433 0.187
NP_441756.1_5 Reverse -353 -372 3.93269 0.199
NP_441756.1_5 Reverse -134 -153 -3.54046 0.29
NP_442395.2_4 Forward -34 -15 19.6648 0.0185
NP_443000.1_7 Reverse -22 -32 20.3345 0.00223
NP_443000.1_7 Forward -35 -25 2.04498 0.226
NP_443000.1_7 Forward -250 -240 1.16001 0.271
NP_443000.1_7 Forward -309 -299 1.06167 0.274
NP_443000.1_7 Reverse -296 -306 0.57002 0.294
NP_440727.1_5 Forward -140 -126 19.8624 0.0934
NP_441842.1_10 Forward -40 -26 6.58777 0.283
NP_440275.1_3 Forward -35 -25 17.9746 0.0082
NP_440275.1_3 Reverse -22 -32 16.1063 0.0155
NP_440275.1_3 Reverse -296 -306 5.48657 0.145
NP_440091.1_1 Forward -37 -25 20.1968 0.00953
NP_443046.1_1 Forward -135 -116 17.0931 0.24
NP_441902.1_4 Forward -138 -119 6.39097 0.24
NP_440679.1_10 Forward -135 -116 -19.9617 0.283
NP_440679.1_10 Forward -126 -107 -20.2567 0.283
NP_440679.1_10 Forward -138 -119 -20.3551 0.284
NP_441359.1_5 Reverse -168 -187 0.982764 0.29
NP_442451.1_2 Reverse -115 -134 -6.98204 0.232
NP_442451.1_2 Reverse -16 -35 -9.83364 0.26
NP_441122.1_1 Reverse -287 -302 4.20813 0.28
NP_441207.1_7 Reverse -261 -275 8.96496 0.282
NP_439962.1_4 Reverse -16 -35 -2.0655 0.224
NP_439962.1_4 Reverse -120 -139 -2.55715 0.231
NP_439962.1_4 Reverse -123 -142 -6.29373 0.283
NP_439962.1_4 Reverse -115 -134 -7.57203 0.29
NP_442495.1_4 Forward -29 -19 16.303 0.0771
NP_442495.1_6 Reverse -242 -261 18.879 0.202
NP_440149.1_8 Reverse -292 -311 -5.11376 0.219
NP_440149.1_8 Reverse -11 -30 -7.67036 0.29
NP_441105.1_3 Reverse -13 -32 18.4857 0.00932
NP_441105.1_3 Reverse -233 -252 -7.67036 0.258
NP_441105.1_3 Forward -377 -358 -9.34199 0.288
NP_442373.1_2 Forward -140 -121 -7.67036 0.237
NP_440216.1_1 Forward -33 -19 17.1092 0.00188
NP_440216.1_1 Reverse -24 -38 16.1259 0.00307
NP_440216.1_1 Reverse -239 -253 6.6861 0.0139
NP_440216.1_1 Reverse -298 -312 -1.47537 0.0328
NP_440216.1_1 Forward -307 -293 -11.8001 0.219
NP_440172.1_1 Forward -33 -23 17.5813 0.00421
NP_440172.1_1 Forward -300 -290 10.8948 0.045
NP_440172.1_1 Reverse -24 -34 8.73149 0.0586
NP_440172.1_1 Forward -307 -297 2.33998 0.279
NP_441008.1_4 Reverse -113 -132 15.6412 0.295
NP_442015.1_10 Reverse -20 -33 13.4906 0.0354
NP_442015.1_10 Forward -228 -215 6.4108 0.116
NP_442015.1_10 Reverse -353 -366 3.95252 0.178
NP_442015.1_10 Forward -311 -298 3.36254 0.183
NP_442015.1_10 Forward -370 -357 -0.767364 0.281
NP_441226.1_7 Forward -32 -25 14.4934 0.0123
NP_441226.1_7 Reverse -25 -32 14.4934 0.0123
NP_441226.1_7 Reverse -299 -306 12.7234 0.0312
NP_441226.1_7 Forward -306 -299 11.5435 0.0757
NP_442834.1_9 Reverse -141 -160 5.70265 0.268
NP_441111.1_7 Forward -32 -24 18.7023 0.00294
NP_441111.1_7 Reverse -25 -33 18.7023 0.00294
NP_441111.1_7 Forward -306 -298 8.86921 0.0589
NP_442379.1_10 Forward -40 -23 -0.944468 0.223
NP_441766.1_2 Forward -33 -24 17.5026 0.00297
NP_441766.1_2 Reverse -24 -33 17.5026 0.00297
NP_441766.1_2 Reverse -298 -307 8.1612 0.0645
NP_441766.1_2 Forward -307 -298 5.89959 0.103
NP_442417.1_5 Forward -33 -19 14.3559 0.0633
NP_442252.1_4 Forward -137 -118 14.2574 0.237
NP_440416.1_1 Reverse -298 -317 -14.2585 0.284
NP_440416.1_9 Reverse -17 -36 -6.98204 0.0951
NP_440416.1_9 Reverse -112 -131 -9.53865 0.133
NP_440416.1_9 Reverse -291 -310 -12.5869 0.159
NP_440416.1_9 Forward -373 -354 -12.7836 0.16
NP_440416.1_9 Reverse -130 -149 -17.3068 0.237
NP_443052.1_8 Forward -43 -24 26.1555 0.000423
NP_443052.1_8 Forward -317 -298 -11.2103 0.224
NP_443052.1_9 Reverse -121 -140 16.3224 0.0341
NP_443052.1_9 Reverse -118 -137 7.86593 0.131
NP_443052.1_9 Reverse -127 -146 1.0811 0.186
NP_443052.1_9 Reverse -124 -143 -6.98204 0.291
NP_443052.1_10 Forward -151 -132 20.4419 0.103
NP_440072.1_5 Forward -131 -113 4.24738 0.236
NP_440072.1_5 Forward -140 -122 0.609134 0.236
NP_440072.1_5 Forward -134 -116 -0.964162 0.252
NP_440072.1_5 Forward -137 -119 -2.93078 0.271
NP_442403.1_9 Forward -372 -353 11.9958 0.148
NP_442403.1_9 Forward -122 -103 6.19431 0.197
NP_442154.1_1 Forward -139 -121 5.62401 0.0591
NP_442154.1_1 Forward -136 -118 -3.6191 0.125
NP_442154.1_1 Forward -127 -109 -4.30741 0.125
NP_442154.1_1 Forward -130 -112 -4.50408 0.125
NP_442154.1_1 Forward -148 -130 -13.6489 0.217
NP_442154.1_1 Forward -121 -103 -14.2388 0.217
NP_440261.1_5 Forward -32 -19 6.70579 0.0318
NP_440261.1_5 Reverse -25 -38 -1.16069 0.0662
NP_440261.1_7 Forward -28 -9 6.29264 0.0911
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATTCAAAGGCTGCGTCCCAACACATGTGCCCCTGGTCATAGCCGTGGAAGGAGGCGTTGTAATAATCGGGATAGGTTAACTCTTCATCCACCACCGATCGCCAATGGCTTTGCCAGTCCTGCTGTTGATAATTTTTTACTGTTTCCCGCCAGGGGATCCCCAATCTTTCTGCCCGTTTGATCATCATGGAGCGGGCTTGCCATTTGGCCACGTTCCACAGGGGCTTGACGGCCAATAAACCATTGACGACCTGGCTCATGGCGGTGGGGGCAGGGGTGGCGGTGCTGACAGTCATGGAATGCTTTAATGGGACTAGGGAAAATTGTCGCTGAAAAATCCAAACCTGTCTAGGCATGGGTATCAAGCGGCGATCGCCTGGGGCAATTTCGGTGTTGAACC

CDS

ATGACCGGTAAACAGTTACACCAGTTGATTGTGGATAAATGGGGTTATTCTTTCGATGTGCAATTGCGACGCATCAAAGACCGCATTTTTCTACAGATTATGTGGCGGTACCTAGAACAGGCTTCCTTTCCCCTCTCGGAAGAGGATTATTTCGCTAATCTAGAGGCGATCGCCCAGTATCTCCAGGCCTGGGGAGGGGGGGAGCAGGTGCAACAGTTCATTGCCCAAACCAAAGAAAAACCCCGCCTAGGCAAAGCAGTTAGTATTCCCCTGGAACTTGGGGCCAGGGCCGCAGAATGGTTTATTTGA

Protein

MTGKQLHQLIVDKWGYSFDVQLRRIKDRIFLQIMWRYLEQASFPLSEEDYFANLEAIAQYLQAWGGGEQVQQFIAQTKEKPRLGKAVSIPLELGARAAEWFI