Your browser is old and dusty. Try Google Chrome!

Details for slr0588

ORF slr0588
Accession NP_443034.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -273 -259 17.5025 0.0786
NP_441061.1_2 Forward -272 -258 2.5562 0.174
NP_441061.1_2 Reverse -265 -279 -0.885388 0.242
NP_440557.1_1 Reverse -265 -284 0.687771 0.265
NP_440557.1_1 Reverse -229 -248 -1.57384 0.276
NP_440795.1_7 Forward -272 -265 14.6904 0.0123
NP_440795.1_7 Reverse -265 -272 14.6904 0.0123
NP_440795.1_7 Forward -188 -181 10.8555 0.132
NP_441418.1_6 Forward -273 -254 -9.93197 0.0301
NP_441418.1_6 Forward -375 -356 -29.9915 0.249
NP_440815.1_6 Forward -158 -139 16.6574 0.174
NP_441453.1_1 Reverse -257 -275 5.81991 0.246
NP_441453.1_4 Reverse -264 -272 16.539 0.00633
NP_441453.1_4 Forward -273 -265 16.539 0.00633
NP_441453.1_4 Reverse -180 -188 3.756 0.288
NP_442151.1_6 Reverse -264 -278 9.63603 0.142
NP_443043.1_3 Reverse -378 -397 10.5209 0.233
NP_440226.1_1 Reverse -264 -283 19.8623 0.0103
NP_440120.1_4 Forward -112 -98 13.6676 0.29
NP_442623.1_3 Forward -236 -217 -10.4236 0.181
NP_440150.1_6 Forward -276 -257 3.24438 0.253
NP_442655.1_10 Forward -276 -257 -18.5851 0.272
NP_442173.1_1 Forward -272 -264 15.4574 0.00633
NP_442173.1_1 Reverse -265 -273 15.4574 0.00633
NP_442752.1_4 Forward -273 -266 13.8055 0.0199
NP_442752.1_4 Reverse -264 -271 13.8055 0.0199
NP_443027.1_4 Forward -275 -265 13.943 0.0452
NP_443027.1_4 Forward -191 -181 12.0747 0.0872
NP_443027.1_4 Reverse -262 -272 11.8781 0.0872
NP_441812.1_3 Reverse -263 -277 11.406 0.21
NP_442975.1_10 Forward -277 -263 4.32555 0.245
NP_440784.1_7 Forward -272 -265 15.9687 0.0123
NP_440784.1_7 Reverse -265 -272 15.9687 0.0123
NP_440784.1_7 Reverse -181 -188 9.67555 0.104
NP_440784.1_7 Forward -236 -229 7.21728 0.15
NP_442000.2_7 Forward -289 -271 20.5703 0.0813
NP_441054.1_2 Forward -366 -347 10.8159 0.283
NP_441476.1_5 Forward -278 -259 -1.57384 0.205
NP_441476.1_5 Reverse -259 -278 -7.27704 0.285
NP_442062.1_8 Forward -273 -263 19.4496 0.000558
NP_442062.1_8 Reverse -264 -274 19.4496 0.000558
NP_440761.1_4 Forward -278 -259 -13.6686 0.257
NP_441900.1_2 Forward -337 -319 1.29671 0.25
NP_441859.1_3 Forward -274 -255 6.48849 0.176
NP_441802.1_1 Forward -196 -177 3.93269 0.298
NP_440304.1_4 Forward -275 -265 9.91146 0.051
NP_440304.1_4 Forward -136 -126 5.97822 0.185
NP_440304.1_4 Reverse -262 -272 1.84832 0.299
NP_442242.1_4 Forward -272 -265 14.3954 0.0124
NP_442242.1_4 Reverse -265 -272 14.3954 0.0124
NP_440916.1_1 Reverse -99 -113 9.14437 0.238
NP_441594.1_6 Reverse -75 -94 3.6377 0.226
NP_442110.1_7 Forward -273 -259 3.04785 0.218
NP_442110.1_7 Reverse -264 -278 0.491246 0.259
NP_441925.1_4 Forward -137 -118 -11.6043 0.252
NP_440856.1_4 Reverse -257 -276 -3.24547 0.229
NP_441083.1_5 Forward -273 -263 11.3864 0.0159
NP_441083.1_5 Reverse -264 -274 11.3864 0.0159
NP_441083.1_5 Reverse -366 -376 2.83163 0.191
NP_441434.1_7 Reverse -266 -280 12.4876 0.111
NP_441738.1_2 Forward -271 -264 15.28 0.0102
NP_441738.1_2 Reverse -266 -273 15.28 0.0102
NP_441955.1_8 Forward -126 -109 10.8552 0.241
NP_440209.1_1 Reverse -264 -272 18.1123 0.00295
NP_440209.1_1 Forward -273 -265 18.1123 0.00295
NP_442889.1_8 Forward -276 -262 3.8339 0.273
NP_440447.1_1 Forward -242 -224 14.9655 0.104
NP_440447.1_1 Reverse -259 -277 8.67227 0.194
NP_441713.1_1 Reverse -340 -359 -15.7335 0.27
NP_441713.1_1 Reverse -258 -277 -16.6185 0.285
NP_441770.1_4 Reverse -373 -392 -3.3438 0.201
NP_441770.1_4 Reverse -112 -131 -12.2919 0.291
NP_440178.1_7 Reverse -263 -282 -3.63879 0.0481
NP_440178.1_7 Forward -367 -348 -20.7484 0.199
NP_440331.1_4 Forward -122 -103 -8.06369 0.291
NP_442111.1_4 Forward -274 -260 12.7826 0.042
NP_440851.1_6 Reverse -116 -133 6.43035 0.263
NP_440906.1_5 Forward -272 -265 15.8704 0.0124
NP_440906.1_5 Reverse -265 -272 15.8704 0.0124
NP_440906.1_9 Forward -337 -318 12.6833 0.296
NP_440747.1_1 Forward -129 -111 8.08229 0.251
NP_440747.1_10 Reverse -261 -273 17.0502 0.000794
NP_440747.1_10 Forward -276 -264 -2.02597 0.0196
NP_440747.1_10 Reverse -354 -366 -12.4491 0.282
NP_441130.1_10 Reverse -262 -276 18.2892 0.0142
NP_441130.1_10 Forward -275 -261 11.8976 0.104
NP_441854.1_10 Forward -275 -256 0.786102 0.282
NP_441486.1_1 Forward -276 -262 3.73617 0.0553
NP_441486.1_1 Reverse -261 -275 -5.21195 0.226
NP_441880.2_10 Reverse -265 -283 14.9655 0.111
NP_442330.1_4 Forward -275 -256 16.8979 0.233
NP_442634.1_4 Reverse -178 -192 4.22782 0.0819
NP_442634.1_4 Forward -275 -261 -2.85201 0.156
NP_442634.1_4 Reverse -262 -276 -3.34366 0.161
NP_441014.1_10 Reverse -58 -77 -1.57461 0.262
NP_442848.1_1 Forward -279 -265 -3.147 0.263
NP_442848.1_9 Reverse -249 -268 4.03102 0.211
NP_441012.1_4 Forward -271 -258 6.60746 0.278
NP_443018.1_3 Forward -272 -265 14.8871 0.0123
NP_443018.1_3 Reverse -265 -272 14.8871 0.0123
NP_443018.1_3 Forward -188 -181 4.07068 0.299
NP_441316.1_7 Reverse -262 -277 -3.16669 0.273
NP_441634.1_8 Reverse -262 -276 15.0442 0.0248
NP_440376.1_1 Forward -273 -264 19.4693 0.000692
NP_440376.1_1 Reverse -264 -273 19.4693 0.000692
NP_440376.1_1 Reverse -119 -128 2.35967 0.224
NP_441857.1_5 Forward -280 -262 7.39397 0.189
NP_441588.1_4 Reverse -266 -276 6.96153 0.178
NP_441588.1_4 Reverse -61 -71 6.37155 0.2
NP_442687.1_7 Forward -274 -264 15.8113 0.0125
NP_442687.1_7 Reverse -263 -273 15.8113 0.0125
NP_442687.1_7 Reverse -179 -189 5.48657 0.2
NP_442485.1_3 Reverse -253 -272 2.65439 0.209
NP_442485.1_3 Forward -278 -259 -2.0655 0.261
NP_442485.1_3 Forward -131 -112 -4.22878 0.278
NP_442485.1_3 Reverse -283 -302 -5.60541 0.293
NP_441846.1_10 Forward -373 -354 -14.0619 0.216
NP_442958.1_3 Forward -284 -265 -1.86883 0.293
NP_441422.1_7 Reverse -262 -279 6.52869 0.0992
NP_441422.1_7 Forward -275 -258 -1.53445 0.194
NP_441422.1_7 Forward -95 -78 -4.09106 0.238
NP_440741.1_4 Forward -273 -254 12.7825 0.271
NP_440533.1_9 Forward -273 -254 9.43923 0.147
NP_442296.1_9 Forward -192 -173 -0.885524 0.197
NP_440360.1_4 Forward -242 -223 8.35759 0.224
NP_442658.1_1 Forward -275 -265 18.7607 0.00222
NP_442658.1_1 Reverse -262 -272 17.0891 0.00615
NP_441971.1_2 Forward -355 -336 16.1257 0.155
NP_442782.1_2 Forward -273 -259 10.4227 0.173
NP_442205.1_9 Forward -195 -179 6.25339 0.117
NP_441414.1_9 Reverse -264 -283 5.211 0.048
NP_441414.1_9 Forward -330 -311 -9.63698 0.264
NP_440800.1_7 Forward -40 -26 12.3893 0.241
NP_441487.1_9 Reverse -263 -282 1.47442 0.198
NP_442937.1_5 Reverse -259 -278 6.29264 0.282
NP_442937.1_5 Reverse -316 -335 6.09597 0.288
NP_441958.1_5 Forward -274 -264 12.2714 0.00183
NP_441958.1_5 Reverse -263 -273 12.2714 0.00183
NP_441958.1_5 Reverse -179 -189 0.275027 0.162
NP_439905.1_1 Reverse -265 -278 11.6223 0.204
NP_440984.1_7 Forward -278 -264 20.0591 0.00473
NP_442911.1_2 Forward -283 -264 11.7008 0.0131
NP_442911.1_2 Reverse -254 -273 -2.26216 0.096
NP_442911.1_2 Forward -199 -180 -10.6203 0.284
NP_441580.1_6 Forward -284 -265 -6.58872 0.235
NP_440153.1_5 Reverse -265 -279 4.42448 0.199
NP_443055.1_6 Reverse -112 -130 -1.84987 0.284
NP_440993.1_3 Reverse -254 -273 -2.26292 0.299
NP_441099.1_5 Reverse -254 -273 -9.63698 0.229
NP_442002.1_9 Forward -274 -267 10.7572 0.185
NP_442002.1_9 Reverse -263 -270 10.7572 0.185
NP_442438.1_10 Reverse -259 -273 12.0943 0.0412
NP_442438.1_10 Forward -278 -264 11.111 0.0463
NP_442438.1_10 Forward -194 -180 8.55439 0.0769
NP_442431.1_10 Reverse -315 -333 -0.964162 0.298
NP_441752.1_6 Forward -346 -327 -0.983855 0.279
NP_441473.1_4 Forward -293 -279 18.2892 0.264
NP_441000.1_6 Forward -274 -260 5.80112 0.0933
NP_441000.1_6 Reverse -263 -277 4.81781 0.0933
NP_442771.1_1 Forward -275 -257 -5.58572 0.166
NP_440147.1_4 Reverse -262 -275 18.1122 0.00478
NP_440147.1_4 Forward -275 -262 9.75405 0.0371
NP_440147.1_4 Reverse -178 -191 4.93583 0.142
NP_441550.1_8 Forward -275 -265 10.501 0.066
NP_441550.1_8 Reverse -178 -188 10.1076 0.0759
NP_441550.1_8 Reverse -262 -272 8.82935 0.112
NP_441916.1_7 Forward -273 -263 18.4663 0.00144
NP_441916.1_7 Reverse -264 -274 18.4663 0.00144
NP_441916.1_7 Forward -189 -179 7.15819 0.0745
NP_441916.1_10 Forward -257 -238 0.294447 0.286
NP_440465.1_4 Forward -274 -255 12.6841 0.21
NP_440465.1_10 Forward -276 -257 -0.0988766 0.29
NP_441041.1_4 Forward -273 -254 -6.98204 0.179
NP_441041.1_7 Forward -276 -264 19.5648 0.00277
NP_441041.1_7 Reverse -261 -273 14.6087 0.0342
NP_440016.1_9 Reverse -258 -277 9.83255 0.278
NP_440509.1_7 Forward -199 -180 6.58763 0.293
NP_440569.1_7 Forward -127 -108 9.43923 0.286
NP_441725.1_4 Reverse -259 -273 12.6836 0.0693
NP_441725.1_5 Reverse -265 -275 9.02648 0.0553
NP_441725.1_5 Forward -272 -262 2.04498 0.115
NP_439966.1_7 Reverse -262 -272 17.9741 0.00631
NP_439966.1_7 Forward -275 -265 17.4824 0.00636
NP_439966.1_7 Forward -122 -112 4.10949 0.289
NP_439966.1_9 Forward -275 -266 10.7178 0.0863
NP_439966.1_9 Reverse -262 -271 0.884706 0.253
NP_442941.1_3 Forward -272 -262 10.7964 0.0116
NP_442941.1_3 Forward -188 -178 6.96153 0.0903
NP_442941.1_3 Reverse -265 -275 2.53664 0.14
NP_440289.1_2 Forward -276 -263 12.999 0.0132
NP_440289.1_2 Reverse -261 -274 4.44418 0.0668
NP_440983.1_5 Reverse -357 -376 -8.45701 0.295
NP_440260.1_8 Reverse -116 -134 -4.60241 0.273
NP_442281.1_1 Reverse -259 -273 18.0918 0.00503
NP_442281.1_1 Forward -278 -264 17.1085 0.00656
NP_442281.1_1 Forward -125 -111 1.67063 0.293
NP_441334.1_7 Forward -275 -256 -19.1751 0.275
NP_442847.1_3 Reverse -126 -145 3.63691 0.29
NP_442575.1_7 Reverse -246 -265 12.0942 0.203
NP_440437.1_1 Reverse -258 -277 2.45773 0.133
NP_442012.1_1 Forward -135 -116 3.83436 0.179
NP_442012.1_1 Forward -279 -260 1.17943 0.222
NP_441081.1_4 Forward -126 -107 6.19431 0.205
NP_441556.1_10 Reverse -259 -273 12.2659 0.195
NP_441644.1_6 Forward -189 -179 11.7793 0.0432
NP_441644.1_6 Forward -273 -263 10.1076 0.0628
NP_441644.1_6 Reverse -264 -274 10.1076 0.0628
NP_442215.1_2 Reverse -262 -278 -2.30141 0.195
NP_442215.1_2 Forward -275 -259 -3.28472 0.213
NP_442215.1_2 Reverse -103 -119 -5.93965 0.262
NP_442215.1_2 Reverse -226 -242 -7.11963 0.286
NP_442029.1_6 Reverse -249 -268 4.12936 0.273
NP_442029.1_10 Reverse -104 -123 6.98095 0.283
NP_440253.1_2 Reverse -264 -282 6.31233 0.0823
NP_440929.1_8 Forward -273 -264 19.2726 0.000701
NP_440929.1_8 Reverse -264 -273 19.2726 0.000701
NP_442933.1_10 Forward -273 -264 17.601 0.00325
NP_442933.1_10 Reverse -264 -273 17.601 0.00325
NP_442933.1_10 Forward -189 -180 4.52295 0.24
NP_442933.1_10 Reverse -180 -189 4.12963 0.28
NP_441751.2_8 Forward -272 -258 -2.95034 0.134
NP_441751.2_8 Reverse -265 -279 -5.50694 0.214
NP_442926.1_5 Reverse -259 -278 13.3767 0.16
NP_442554.1_8 Reverse -265 -275 16.008 0.0065
NP_442554.1_8 Forward -272 -262 14.1397 0.0144
NP_442554.1_8 Forward -188 -178 6.46988 0.117
NP_441762.1_7 Reverse -263 -275 21.5735 0.00342
NP_441762.1_7 Forward -274 -262 12.1337 0.0142
NP_442142.1_4 Reverse -261 -274 17.7182 0.0255
NP_442142.1_4 Forward -276 -263 16.4399 0.0264
NP_442142.1_9 Forward -127 -108 7.47261 0.254
NP_442142.1_9 Forward -280 -261 3.34271 0.282
NP_442292.1_1 Forward -272 -263 9.63616 0.0183
NP_442292.1_1 Reverse -265 -274 9.63616 0.0183
NP_442476.1_6 Reverse -265 -279 14.0609 0.0401
NP_442476.1_6 Forward -272 -258 11.6026 0.0558
NP_442381.1_8 Forward -276 -257 4.32602 0.0708
NP_443009.1_5 Reverse -263 -274 11.6612 0.0602
NP_443009.1_5 Forward -274 -263 11.6612 0.0602
NP_443009.1_5 Reverse -179 -190 9.10461 0.0965
NP_442408.2_1 Forward -128 -109 1.17943 0.193
NP_441715.1_4 Forward -272 -262 18.8596 0.00741
NP_441715.1_4 Reverse -265 -275 9.32148 0.097
NP_441715.1_4 Forward -188 -178 7.35486 0.108
NP_440357.1_3 Forward -131 -112 -1.18052 0.297
NP_440183.1_9 Reverse -359 -378 -18.3884 0.276
NP_441198.1_8 Reverse -118 -128 11.1228 0.222
NP_440379.1_5 Reverse -255 -274 -2.95047 0.204
NP_441468.1_1 Forward -272 -265 15.8704 0.0124
NP_441468.1_1 Reverse -265 -272 15.8704 0.0124
NP_441468.1_1 Forward -188 -181 4.07068 0.263
NP_441020.2_6 Forward -275 -258 13.4119 0.0736
NP_441020.2_6 Reverse -262 -279 7.90532 0.215
NP_441015.1_3 Forward -182 -163 7.27595 0.0635
NP_441015.1_10 Forward -377 -358 -9.44032 0.282
NP_441015.1_10 Forward -278 -259 -11.3086 0.294
NP_441015.1_10 Forward -272 -253 -11.6036 0.298
NP_441673.1_1 Forward -273 -264 20.8459 0.000698
NP_441673.1_1 Reverse -264 -273 20.8459 0.000698
NP_441826.1_2 Forward -279 -265 12.0943 0.0315
NP_441826.1_2 Reverse -258 -272 -4.52363 0.296
NP_441330.1_1 Forward -278 -259 -12.1936 0.183
NP_442745.1_5 Reverse -229 -248 14.7491 0.189
NP_442868.1_6 Reverse -262 -272 10.3048 0.038
NP_442868.1_6 Forward -275 -265 8.53483 0.0555
NP_441612.1_2 Forward -168 -158 8.25885 0.228
NP_442808.1_1 Forward -274 -264 18.4657 0.00201
NP_442808.1_1 Reverse -263 -273 18.4657 0.00201
NP_442808.1_1 Forward -130 -120 9.22267 0.0481
NP_442808.1_1 Forward -331 -321 5.48612 0.151
NP_440145.1_3 Reverse -254 -273 -5.9004 0.282
NP_442542.1_2 Forward -275 -262 10.4424 0.126
NP_442050.1_5 Forward -275 -265 8.23937 0.234
NP_442050.1_5 Reverse -262 -272 6.96107 0.27
NP_442342.1_9 Forward -275 -259 2.02515 0.294
NP_440342.1_1 Forward -138 -119 14.2574 0.192
NP_440558.1_2 Reverse -255 -274 -0.4922 0.203
NP_440111.2_8 Reverse -182 -198 19.3314 0.0747
NP_442789.1_4 Forward -275 -256 -7.86702 0.299
NP_441878.1_6 Forward -274 -264 10.4031 0.0176
NP_441878.1_6 Reverse -263 -273 10.4031 0.0176
NP_441878.1_6 Forward -367 -357 -7.0998 0.204
NP_441878.1_6 Reverse -119 -129 -7.59145 0.245
NP_441878.1_6 Forward -190 -180 -7.98478 0.285
NP_441036.1_8 Forward -274 -264 17.7779 0.000554
NP_441036.1_8 Reverse -263 -273 17.7779 0.000554
NP_441557.1_5 Forward -273 -264 19.9609 0.000699
NP_441557.1_5 Reverse -264 -273 19.9609 0.000699
NP_441557.1_5 Reverse -180 -189 -0.983583 0.272
NP_441445.1_1 Reverse -255 -274 -0.39387 0.291
NP_441590.1_4 Reverse -358 -377 2.9486 0.29
NP_442066.2_9 Forward -277 -264 17.9155 0.0209
NP_442419.1_2 Reverse -259 -278 1.27776 0.238
NP_441308.1_8 Forward -275 -265 9.22315 0.226
NP_440101.1_3 Forward -278 -259 19.764 0.0316
NP_440101.1_3 Reverse -259 -278 1.27776 0.281
NP_441458.1_10 Reverse -255 -274 15.0441 0.0856
NP_442183.1_1 Reverse -264 -278 12.8809 0.05
NP_442183.1_1 Forward -273 -259 8.06273 0.124
NP_442166.1_7 Forward -272 -258 9.93102 0.19
NP_440440.1_2 Forward -341 -322 21.7297 0.0493
NP_442444.1_6 Forward -112 -94 13.3075 0.25
NP_441549.1_9 Reverse -176 -194 -10.0106 0.268
NP_442347.1_2 Forward -272 -263 11.1111 0.056
NP_442347.1_2 Reverse -265 -274 11.1111 0.056
NP_442645.1_2 Forward -281 -262 -11.2103 0.144
NP_442645.1_2 Reverse -183 -202 -20.2567 0.288
NP_442645.1_2 Reverse -256 -275 -22.3217 0.29
NP_442888.1_6 Forward -284 -265 4.12936 0.228
NP_441037.1_4 Forward -275 -265 16.2838 0.0168
NP_441037.1_4 Reverse -262 -272 6.92787 0.237
NP_442317.1_6 Reverse -268 -287 1.67108 0.298
NP_441633.1_3 Reverse -262 -275 22.8321 0.00371
NP_441633.1_3 Forward -275 -262 3.65753 0.0699
NP_441633.1_3 Forward -70 -57 -2.04567 0.171
NP_440136.1_2 Forward -272 -265 15.9687 0.0123
NP_440136.1_2 Reverse -265 -272 15.9687 0.0123
NP_442590.1_10 Forward -279 -260 3.83436 0.283
NP_442998.1_5 Forward -391 -381 7.15819 0.299
NP_442998.1_10 Forward -271 -264 15.5754 0.0102
NP_442998.1_10 Reverse -266 -273 15.5754 0.0102
NP_440299.1_1 Reverse -260 -273 18.1116 0.00453
NP_441799.1_1 Forward -277 -263 13.8636 0.0293
NP_441799.1_1 Reverse -260 -274 7.86545 0.13
NP_441799.1_1 Reverse -176 -190 5.60385 0.201
NP_441007.1_10 Forward -278 -265 12.999 0.0499
NP_440256.1_1 Forward -276 -257 1.0811 0.0789
NP_440256.1_1 Reverse -261 -280 -3.83545 0.14
NP_440256.1_1 Reverse -177 -196 -7.27704 0.232
NP_440456.1_7 Forward -196 -182 10.521 0.292
NP_441559.1_8 Reverse -259 -273 12.291 0.0574
NP_441559.1_8 Forward -133 -119 -2.36035 0.191
NP_441559.1_8 Forward -268 -254 -5.01529 0.245
NP_440915.1_6 Reverse -260 -274 12.4876 0.0208
NP_440915.1_6 Forward -277 -263 6.29277 0.0828
NP_440915.1_6 Forward -193 -179 -0.197071 0.186
NP_442866.1_1 Forward -278 -259 -7.4737 0.266
NP_441464.1_8 Forward -129 -115 3.93283 0.283
NP_440306.1_8 Reverse -39 -58 -3.34455 0.281
NP_441939.1_3 Reverse -120 -139 5.80098 0.263
NP_441939.1_3 Reverse -265 -284 5.211 0.284
NP_442993.1_1 Reverse -264 -280 -9.47957 0.186
NP_442386.1_9 Reverse -263 -272 15.7322 0.0144
NP_442386.1_9 Forward -274 -265 15.7322 0.0144
NP_442386.1_9 Forward -121 -112 8.06244 0.209
NP_442386.1_9 Forward -331 -322 4.62087 0.294
NP_440570.1_5 Reverse -311 -330 0.0977854 0.258
NP_441340.1_5 Forward -272 -265 15.6737 0.0124
NP_441340.1_5 Reverse -265 -272 15.6737 0.0124
NP_441297.1_3 Forward -172 -153 19.5673 0.108
NP_442484.1_2 Reverse -253 -272 1.17943 0.238
NP_442240.1_2 Reverse -265 -284 -4.52377 0.0843
NP_442240.1_2 Reverse -229 -248 -17.4051 0.264
NP_440586.1_1 Reverse -257 -276 -5.40875 0.285
NP_440586.1_8 Forward -272 -265 13.2151 0.026
NP_440586.1_8 Reverse -265 -272 13.2151 0.026
NP_440586.1_8 Forward -188 -181 7.41359 0.251
NP_440586.1_8 Forward -329 -322 5.64364 0.297
NP_440586.1_9 Forward -85 -66 4.52268 0.288
NP_442251.1_6 Forward -272 -265 15.2804 0.0124
NP_442251.1_6 Reverse -265 -272 15.2804 0.0124
NP_442251.1_6 Reverse -60 -67 7.11894 0.274
NP_441262.1_3 Reverse -264 -271 14.7888 0.0223
NP_441262.1_3 Forward -273 -266 14.7888 0.0223
NP_440027.1_3 Forward -273 -255 8.3765 0.193
NP_440027.1_3 Forward -283 -265 8.08151 0.196
NP_440027.1_3 Reverse -254 -272 1.69003 0.299
NP_443051.1_1 Reverse -263 -272 10.4228 0.00754
NP_443051.1_1 Forward -274 -265 10.4228 0.00754
NP_443051.1_1 Reverse -179 -188 -0.0986038 0.256
NP_439937.1_8 Forward -275 -256 7.07928 0.191
NP_439937.1_9 Forward -274 -257 -10.1882 0.224
NP_439937.1_9 Reverse -179 -196 -16.1864 0.287
NP_441657.1_5 Reverse -181 -200 -0.295539 0.238
NP_440439.1_1 Reverse -261 -274 17.4239 0.0105
NP_440439.1_1 Forward -276 -263 9.65572 0.0447
NP_440439.1_1 Forward -114 -101 -1.94734 0.288
NP_440372.1_2 Forward -272 -265 16.3621 0.0124
NP_440372.1_2 Reverse -265 -272 16.3621 0.0124
NP_441803.1_2 Reverse -259 -278 12.3892 0.0604
NP_439977.1_5 Reverse -258 -277 7.96426 0.111
NP_440139.1_1 Reverse -258 -277 2.45694 0.233
NP_441572.1_7 Forward -279 -260 5.50599 0.0867
NP_442384.1_10 Forward -273 -260 19.1938 0.00338
NP_442384.1_10 Forward -189 -176 12.8023 0.0249
NP_442384.1_10 Reverse -264 -277 0.412608 0.291
NP_442114.1_4 Reverse -264 -275 12.1534 0.107
NP_442114.1_4 Forward -273 -262 9.20345 0.17
NP_441877.1_7 Reverse -259 -278 4.12856 0.218
NP_441018.1_7 Forward -277 -258 11.1109 0.192
NP_442790.1_4 Reverse -255 -274 -5.40875 0.142
NP_442262.1_10 Forward -272 -265 14.1988 0.0123
NP_442262.1_10 Reverse -265 -272 14.1988 0.0123
NP_440344.1_10 Reverse -257 -274 9.57695 0.00836
NP_440344.1_10 Forward -280 -263 -8.31929 0.125
NP_440531.1_6 Forward -281 -262 0.196116 0.197
NP_440531.1_6 Reverse -103 -122 -3.14714 0.262
NP_442832.1_2 Forward -248 -229 15.9291 0.239
NP_441965.1_10 Forward -276 -260 10.4816 0.107
NP_440297.1_9 Forward -272 -262 -0.118297 0.282
NP_440297.1_9 Reverse -265 -275 -0.216628 0.282
NP_442280.1_10 Reverse -244 -262 8.76604 0.249
NP_441592.1_4 Forward -134 -115 -3.83545 0.29
NP_441896.1_3 Forward -282 -263 7.57094 0.0933
NP_441896.1_3 Reverse -255 -274 -0.000545616 0.231
NP_441896.1_3 Reverse -320 -339 -2.36049 0.281
NP_440894.1_10 Forward -278 -259 11.1109 0.151
NP_440999.1_9 Forward -277 -263 11.6026 0.0438
NP_440999.1_9 Reverse -260 -274 10.9143 0.0483
NP_440888.1_2 Reverse -264 -278 17.3052 0.00418
NP_440888.1_2 Forward -273 -259 15.1419 0.0122
NP_440888.1_2 Reverse -180 -194 9.83206 0.113
NP_440888.1_2 Reverse -254 -268 7.76712 0.184
NP_440052.1_5 Reverse -253 -272 -0.688862 0.191
NP_442948.1_2 Forward -274 -255 9.14423 0.182
NP_442033.1_10 Forward -275 -256 -7.4737 0.186
NP_441543.1_2 Forward -272 -263 18.486 0.00236
NP_441543.1_2 Reverse -265 -274 18.486 0.00236
NP_442845.1_2 Forward -195 -181 6.29277 0.212
NP_441319.1_5 Forward -272 -253 7.57094 0.3
NP_441469.1_8 Reverse -263 -272 16.126 0.00797
NP_441469.1_8 Forward -274 -265 16.126 0.00797
NP_442315.1_1 Reverse -319 -337 2.77242 0.294
NP_443064.1_6 Reverse -59 -69 11.9852 0.107
NP_442337.1_8 Reverse -247 -266 1.67108 0.233
NP_442578.1_7 Forward -272 -265 14.5921 0.026
NP_442578.1_7 Reverse -265 -272 14.5921 0.026
NP_440071.1_6 Forward -365 -351 13.2231 0.297
NP_440220.1_4 Forward -41 -22 -3.63955 0.293
NP_441462.1_2 Forward -273 -263 11.5831 0.00406
NP_441462.1_2 Reverse -264 -274 11.5831 0.00406
NP_441462.1_2 Reverse -180 -190 -0.41329 0.225
NP_441621.1_7 Forward -275 -261 15.9292 0.0266
NP_441621.1_7 Reverse -262 -276 5.99778 0.068
NP_443062.1_1 Reverse -264 -282 7.47334 0.175
NP_443062.1_1 Forward -273 -255 5.03566 0.242
NP_443062.1_6 Reverse -256 -275 3.24438 0.243
NP_442204.1_1 Reverse -260 -271 11.5634 0.0565
NP_442204.1_5 Reverse -254 -273 1.0811 0.246
NP_442204.1_5 Forward -283 -264 -0.4922 0.289
NP_441351.1_8 Forward -275 -256 2.94938 0.236
NP_440516.1_8 Forward -273 -264 16.9127 0.00442
NP_440516.1_8 Reverse -264 -273 16.9127 0.00442
NP_442428.1_5 Forward -272 -265 15.8704 0.0124
NP_442428.1_5 Reverse -265 -272 15.8704 0.0124
NP_442428.1_5 Forward -188 -181 4.56234 0.249
NP_441790.1_3 Reverse -265 -284 -5.21209 0.291
NP_442823.1_8 Reverse -180 -199 16.0274 0.177
NP_440603.1_9 Forward -272 -253 5.01433 0.278
NP_440673.1_3 Forward -271 -264 12.4288 0.0426
NP_440673.1_3 Reverse -266 -273 12.4288 0.0426
NP_440673.1_3 Reverse -182 -189 10.9539 0.106
NP_440865.1_9 Forward -279 -260 -7.08038 0.24
NP_441052.1_2 Forward -273 -263 10.5014 0.0285
NP_441052.1_2 Reverse -264 -274 10.5014 0.0285
NP_441052.1_2 Forward -330 -320 4.99491 0.135
NP_442219.1_9 Forward -272 -263 8.35786 0.0681
NP_442219.1_9 Reverse -265 -274 8.35786 0.0681
NP_440436.1_4 Forward -272 -263 18.1905 0.00233
NP_440436.1_4 Reverse -265 -274 18.1905 0.00233
NP_441884.1_8 Forward -274 -255 -9.44032 0.268
NP_441884.1_9 Forward -276 -257 -12.6852 0.138
NP_441884.1_9 Reverse -261 -280 -24.3866 0.286
NP_441719.1_4 Forward -272 -265 16.3621 0.0124
NP_441719.1_4 Reverse -265 -272 16.3621 0.0124
NP_441733.1_10 Forward -276 -263 19.9805 0.0151
NP_441733.1_10 Reverse -261 -274 7.6891 0.152
NP_441004.1_1 Forward -279 -260 -9.53865 0.209
NP_441004.1_5 Reverse -116 -130 10.4227 0.248
NP_442366.1_3 Forward -274 -256 0.904127 0.161
NP_442873.1_3 Forward -383 -364 6.78348 0.22
NP_441115.1_4 Reverse -263 -281 8.17984 0.257
NP_442206.1_10 Forward -273 -258 1.06154 0.238
NP_443054.1_2 Reverse -262 -276 20.0591 0.0121
NP_442308.1_4 Reverse -360 -379 2.55606 0.267
NP_440508.1_2 Forward -151 -132 14.5459 0.234
NP_441851.1_9 Reverse -108 -127 9.83255 0.239
NP_441851.1_10 Forward -274 -264 16.008 0.00552
NP_441851.1_10 Reverse -263 -273 16.008 0.00552
NP_442622.1_5 Forward -275 -256 -2.65548 0.171
NP_442856.1_7 Reverse -255 -274 7.66927 0.112
NP_441668.1_4 Forward -376 -357 -0.688862 0.261
NP_442515.1_1 Reverse -263 -277 -2.16369 0.271
NP_441396.1_2 Forward -97 -80 0.82479 0.287
NP_441683.1_5 Reverse -269 -288 8.75091 0.248
NP_440593.1_3 Forward -278 -259 0.392778 0.194
NP_440593.1_3 Reverse -223 -242 -3.54046 0.236
NP_442709.1_3 Forward -280 -261 11.1109 0.117
NP_440940.1_7 Reverse -254 -272 5.91824 0.225
NP_440940.1_7 Forward -247 -229 2.87 0.29
NP_441349.1_10 Reverse -254 -273 0.491109 0.0886
NP_441349.1_10 Forward -78 -59 -6.49039 0.23
NP_440432.1_9 Reverse -265 -280 5.48643 0.055
NP_442843.1_1 Reverse -112 -131 -3.54046 0.223
NP_439960.1_5 Reverse -222 -241 15.8307 0.151
NP_439960.1_6 Reverse -258 -277 7.96426 0.28
NP_439960.1_10 Reverse -257 -275 14.0805 0.0769
NP_440474.1_8 Reverse -265 -279 9.93039 0.151
NP_441596.1_5 Forward -377 -358 16.5191 0.274
NP_441477.1_10 Forward -280 -262 1.69077 0.255
NP_442450.1_3 Forward -220 -202 5.72158 0.259
NP_440588.1_2 Reverse -255 -274 6.19431 0.0594
NP_440588.1_2 Reverse -116 -135 -1.57384 0.155
NP_442006.1_2 Reverse -321 -338 -17.5624 0.279
NP_441003.1_9 Reverse -372 -391 5.30933 0.266
NP_443047.1_7 Reverse -330 -349 5.89931 0.228
NP_442243.1_1 Reverse -53 -71 -0.0799167 0.239
NP_441570.1_1 Forward -273 -255 -9.0273 0.127
NP_441078.1_4 Forward -273 -264 19.6659 0.0007
NP_441078.1_4 Reverse -264 -273 19.6659 0.0007
NP_441078.1_4 Reverse -120 -129 3.53964 0.136
NP_441078.1_4 Forward -189 -180 -1.86856 0.272
NP_442729.1_8 Forward -277 -264 9.75405 0.125
NP_440526.1_3 Reverse -265 -276 11.7595 0.0646
NP_441432.1_8 Reverse -263 -272 8.25953 0.0755
NP_441432.1_8 Forward -274 -265 8.25953 0.0755
NP_442320.1_8 Reverse -258 -272 8.45605 0.0184
NP_442320.1_8 Forward -279 -265 5.99778 0.0309
NP_441732.1_2 Reverse -260 -276 -6.33298 0.0495
NP_440760.1_1 Reverse -264 -283 -2.65548 0.0332
NP_440760.1_1 Forward -273 -254 -14.3569 0.129
NP_440713.1_4 Forward -199 -180 4.42435 0.23
NP_440713.1_4 Reverse -254 -273 2.75272 0.257
NP_442489.1_7 Forward -273 -264 20.1576 0.000695
NP_442489.1_7 Reverse -264 -273 20.1576 0.000695
NP_442489.1_7 Reverse -59 -68 5.01461 0.0832
NP_442489.1_7 Forward -189 -180 -1.57357 0.213
NP_440559.1_1 Reverse -265 -274 8.75118 0.0586
NP_440559.1_1 Forward -272 -263 8.75118 0.0586
NP_441659.2_8 Forward -273 -263 11.9764 0.0147
NP_441659.2_8 Reverse -264 -274 11.9764 0.0147
NP_441659.2_8 Reverse -357 -367 1.35667 0.242
NP_441022.1_1 Forward -37 -28 12.3136 0.238
NP_442913.1_10 Forward -282 -263 1.86774 0.133
NP_441040.1_5 Forward -267 -248 9.83255 0.226
NP_442346.1_5 Reverse -179 -189 10.2065 0.103
NP_442346.1_5 Forward -190 -180 10.0098 0.11
NP_442346.1_5 Forward -274 -264 9.02648 0.118
NP_442346.1_5 Reverse -263 -273 9.02648 0.118
NP_442346.1_10 Forward -131 -112 -2.0655 0.294
NP_440545.1_3 Forward -277 -260 -0.944468 0.161
NP_440545.1_3 Reverse -260 -277 -1.63279 0.171
NP_440545.1_3 Reverse -121 -138 -1.92778 0.177
NP_440545.1_3 Forward -193 -176 -4.68105 0.23
NP_440025.1_4 Reverse -110 -129 10.3242 0.262
NP_440831.1_3 Reverse -255 -274 10.2702 0.179
NP_440555.1_4 Forward -195 -176 7.7676 0.214
NP_441126.1_6 Reverse -195 -209 15.4641 0.248
NP_440459.1_2 Reverse -262 -279 9.77361 0.219
NP_441888.1_7 Reverse -259 -273 13.6676 0.0743
NP_441948.1_4 Reverse -257 -275 -0.177514 0.139
NP_441948.1_4 Forward -280 -262 -1.65248 0.148
NP_441833.1_4 Forward -272 -265 15.9687 0.0124
NP_441833.1_4 Reverse -265 -272 15.9687 0.0124
NP_442060.1_10 Reverse -104 -123 11.7008 0.244
NP_442162.1_9 Forward -272 -265 16.2637 0.0124
NP_442162.1_9 Reverse -265 -272 16.2637 0.0124
NP_440671.1_4 Reverse -258 -272 11.7993 0.125
NP_442045.1_5 Reverse -255 -274 0.786102 0.266
NP_442199.1_5 Forward -197 -178 4.32602 0.108
NP_442199.1_5 Reverse -256 -275 -1.18052 0.18
NP_442140.1_3 Reverse -265 -275 17.4829 0.0159
NP_442140.1_3 Forward -272 -262 14.238 0.0486
NP_441696.1_4 Forward -199 -186 12.114 0.267
NP_440875.1_9 Reverse -266 -276 17.619 0.0104
NP_440875.1_9 Forward -271 -261 17.327 0.0126
NP_440875.1_9 Forward -118 -108 11.5841 0.162
NP_441813.1_5 Reverse -262 -272 19.4496 0.00647
NP_441813.1_5 Forward -275 -265 10.0098 0.0208
NP_440590.1_4 Forward -272 -259 13.4906 0.013
NP_440590.1_4 Reverse -265 -278 12.0157 0.0166
NP_440567.1_1 Forward -272 -258 10.7177 0.033
NP_440567.1_1 Reverse -265 -279 9.63603 0.0422
NP_440567.1_1 Reverse -181 -195 3.93283 0.134
NP_442497.1_10 Forward -272 -263 10.4228 0.0087
NP_442497.1_10 Reverse -265 -274 10.4228 0.0087
NP_440821.1_4 Forward -275 -265 18.7612 0.00422
NP_440821.1_4 Reverse -262 -272 10.2065 0.0163
NP_441239.1_9 Forward -275 -263 18.6235 0.0114
NP_441239.1_9 Reverse -262 -274 16.7552 0.0157
NP_441239.1_9 Forward -122 -110 8.6921 0.125
NP_441239.1_9 Forward -191 -179 3.08724 0.296
NP_442897.1_6 Forward -372 -354 19.9803 0.179
NP_442044.1_1 Forward -134 -115 -6.49039 0.206
NP_442629.1_3 Forward -277 -258 -0.39387 0.294
NP_440546.1_4 Forward -273 -263 11.8882 0.0679
NP_440546.1_4 Reverse -264 -274 11.8882 0.0679
NP_440546.1_6 Forward -199 -180 8.45592 0.256
NP_440546.1_6 Reverse -254 -273 7.37428 0.273
NP_441230.1_5 Forward -278 -259 7.37428 0.166
NP_440675.1_3 Reverse -354 -373 9.83255 0.186
NP_440462.1_6 Forward -275 -265 17.9746 0.00578
NP_440462.1_6 Reverse -262 -272 17.2863 0.00752
NP_442340.1_3 Reverse -71 -90 -5.40875 0.223
NP_442611.1_1 Forward -273 -254 2.85105 0.216
NP_440868.1_4 Forward -277 -265 12.0354 0.0254
NP_440868.1_4 Reverse -260 -272 10.5604 0.0364
NP_442402.1_4 Reverse -63 -82 -9.63771 0.292
NP_442460.1_7 Reverse -252 -271 1.96607 0.249
NP_440696.1_3 Reverse -254 -272 1.69077 0.217
NP_442039.1_4 Forward -272 -265 15.1821 0.0124
NP_442039.1_4 Reverse -265 -272 15.1821 0.0124
NP_441811.1_8 Reverse -153 -167 6.29277 0.28
NP_442837.1_3 Forward -272 -265 15.7721 0.0124
NP_442837.1_3 Reverse -265 -272 15.7721 0.0124
NP_442053.1_1 Forward -273 -264 18.3876 0.0007
NP_442053.1_1 Reverse -264 -273 18.3876 0.0007
NP_440505.1_3 Reverse -262 -272 15.9097 0.00857
NP_440505.1_3 Forward -275 -265 14.1397 0.0235
NP_440505.1_7 Reverse -260 -279 -0.983855 0.271
NP_441252.1_6 Forward -196 -189 11.6422 0.288
NP_441203.1_1 Forward -272 -253 -11.6036 0.139
NP_442532.1_7 Reverse -321 -335 1.86788 0.261
NP_440914.1_1 Forward -189 -179 12.0308 0.0684
NP_440914.1_1 Forward -273 -263 8.6151 0.186
NP_440914.1_1 Reverse -264 -274 8.6151 0.186
NP_441011.1_8 Forward -272 -263 16.9127 0.00602
NP_441011.1_8 Reverse -265 -274 16.9127 0.00602
NP_441011.1_8 Reverse -181 -190 5.50626 0.256
NP_442533.1_6 Forward -273 -264 17.2076 0.00137
NP_442533.1_6 Reverse -264 -273 17.2076 0.00137
NP_442533.1_6 Reverse -180 -189 5.60459 0.137
NP_442533.1_6 Forward -189 -180 3.93297 0.197
NP_442541.1_10 Reverse -346 -360 0.883986 0.295
NP_443050.1_2 Forward -238 -219 8.25926 0.265
NP_442232.1_3 Forward -197 -178 -7.08038 0.194
NP_442229.1_1 Forward -275 -261 10.6187 0.18
NP_441482.1_7 Reverse -258 -272 8.75105 0.0162
NP_441482.1_7 Reverse -174 -188 -7.37523 0.193
NP_441482.1_7 Forward -243 -229 -9.44018 0.202
NP_439944.1_9 Reverse -265 -275 10.4031 0.0887
NP_440115.1_6 Reverse -261 -271 7.64985 0.146
NP_440007.1_9 Forward -138 -124 0.982901 0.29
NP_439965.1_1 Reverse -255 -274 16.3224 0.0126
NP_441602.1_3 Reverse -259 -278 8.65258 0.117
NP_441602.1_3 Forward -278 -259 -1.37718 0.226
NP_441972.1_5 Forward -272 -253 -4.91709 0.212
NP_441106.1_1 Reverse -263 -272 18.191 0.0028
NP_441106.1_1 Forward -274 -265 18.191 0.0028
NP_441106.1_1 Forward -190 -181 4.71961 0.21
NP_441106.1_1 Forward -135 -126 3.04799 0.244
NP_440429.1_2 Reverse -259 -278 15.2408 0.176
NP_441815.1_6 Reverse -353 -372 6.39016 0.187
NP_441286.1_1 Reverse -263 -275 5.25052 0.0259
NP_441286.1_1 Forward -274 -262 -3.50094 0.145
NP_440670.1_8 Forward -273 -264 18.3876 0.000699
NP_440670.1_8 Reverse -264 -273 18.3876 0.000699
NP_439955.1_10 Reverse -348 -367 10.7167 0.299
NP_440886.1_7 Forward -274 -264 17.7774 0.0011
NP_440886.1_7 Reverse -263 -273 17.7774 0.0011
NP_440886.1_7 Forward -331 -321 7.94438 0.0805
NP_441001.1_10 Reverse -320 -339 6.19431 0.255
NP_442614.1_2 Reverse -264 -278 6.3911 0.291
NP_442072.1_9 Reverse -263 -281 5.52568 0.0162
NP_440907.2_8 Reverse -265 -275 17.4824 0.00685
NP_440907.2_8 Forward -272 -262 7.94438 0.117
NP_441021.1_8 Reverse -259 -277 10.3439 0.127
NP_442893.1_4 Reverse -1 -20 -2.16459 0.281
NP_441626.1_2 Forward -272 -265 15.7721 0.0124
NP_441626.1_2 Reverse -265 -272 15.7721 0.0124
NP_442211.1_3 Reverse -73 -92 8.05558 0.275
NP_440107.1_2 Reverse -259 -278 6.88262 0.299
NP_442794.1_1 Reverse -260 -272 10.4621 0.0721
NP_442615.1_1 Reverse -255 -273 0.904127 0.0943
NP_442615.1_1 Forward -282 -264 -6.4707 0.248
NP_441962.1_4 Reverse -259 -278 2.0644 0.103
NP_441962.1_4 Forward -194 -175 -10.0303 0.223
NP_441962.1_9 Reverse -67 -86 10.4225 0.258
NP_440387.1_1 Reverse -264 -280 4.58176 0.0407
NP_440387.1_1 Forward -273 -257 -2.00642 0.145
NP_441431.1_2 Reverse -261 -275 17.0102 0.0303
NP_441431.1_2 Forward -276 -262 9.53707 0.183
NP_441836.1_1 Reverse -253 -272 15.5901 0.147
NP_441836.1_2 Forward -195 -176 0.58944 0.202
NP_441836.1_6 Reverse -231 -250 15.3391 0.298
NP_441993.1_1 Forward -366 -347 8.86616 0.136
NP_441993.1_1 Reverse -264 -283 1.16703 0.284
NP_441174.1_2 Reverse -261 -275 16.9125 0.0602
NP_440814.1_8 Forward -263 -244 2.0644 0.269
NP_440114.1_10 Reverse -264 -278 14.7492 0.0346
NP_441858.1_3 Forward -156 -137 19.6648 0.0807
NP_442437.1_8 Reverse -112 -131 6.29264 0.242
NP_442698.1_10 Forward -271 -252 2.0644 0.285
NP_440293.1_3 Reverse -112 -131 -0.4922 0.23
NP_440766.1_4 Reverse -260 -274 9.04604 0.0871
NP_440766.1_4 Forward -277 -263 8.16106 0.0871
NP_440422.1_10 Reverse -131 -150 4.40189 0.289
NP_442743.1_4 Forward -272 -253 -6.29373 0.279
NP_442930.1_1 Forward -323 -313 10.206 0.278
NP_439910.1_2 Forward -281 -264 -13.3342 0.162
NP_440457.1_1 Reverse -260 -272 7.61046 0.101
NP_440798.1_6 Reverse -265 -278 3.85419 0.147
NP_441801.1_4 Forward -303 -293 3.42162 0.231
NP_441332.1_6 Forward -331 -321 11.0659 0.277
NP_441436.1_8 Reverse -295 -314 9.83255 0.262
NP_442509.1_9 Forward -273 -263 16.2041 0.00739
NP_442509.1_9 Reverse -264 -274 16.2041 0.00739
NP_440554.1_4 Forward -272 -262 16.4996 0.0189
NP_440554.1_4 Reverse -265 -275 13.943 0.0218
NP_440554.1_4 Reverse -181 -191 4.89658 0.171
NP_441885.1_5 Forward -273 -263 11.4848 0.00668
NP_441885.1_5 Reverse -264 -274 11.4848 0.00668
NP_440478.1_10 Forward -275 -261 8.25939 0.257
NP_440478.1_10 Forward -86 -72 8.06273 0.257
NP_442341.1_7 Reverse -263 -277 18.2892 0.0111
NP_442341.1_7 Forward -274 -260 10.9143 0.0591
NP_442341.1_9 Reverse -123 -137 10.8154 0.133
NP_441173.1_9 Forward -43 -35 11.7204 0.226
NP_441173.1_9 Forward -333 -325 10.2454 0.261
NP_442395.2_4 Forward -274 -255 10.3234 0.101
NP_440409.1_1 Forward -281 -262 7.17762 0.158
NP_440423.1_6 Forward -281 -262 -13.9635 0.224
NP_443000.1_7 Reverse -262 -272 11.5831 0.0344
NP_443000.1_7 Reverse -178 -188 7.64985 0.0734
NP_443000.1_7 Forward -275 -265 2.04498 0.226
NP_443000.1_7 Reverse -319 -329 1.94665 0.226
NP_441561.1_7 Forward -349 -330 6.29183 0.274
NP_440275.1_3 Forward -275 -265 17.9746 0.0082
NP_440275.1_3 Reverse -262 -272 15.418 0.0178
NP_440091.1_1 Forward -277 -265 12.6253 0.0353
NP_440091.1_1 Forward -193 -181 -0.256015 0.273
NP_441902.1_3 Forward -195 -185 12.6902 0.236
NP_442451.1_2 Reverse -256 -275 1.86774 0.143
NP_442451.1_2 Forward -281 -262 -1.08219 0.168
NP_439962.1_4 Reverse -256 -275 11.5042 0.134
NP_439962.1_4 Forward -128 -109 -6.88371 0.285
NP_442495.1_5 Reverse -181 -200 5.11266 0.293
NP_440149.1_8 Forward -273 -254 -0.787193 0.154
NP_439929.1_4 Forward -42 -28 19.4334 0.234
NP_441105.1_3 Reverse -253 -272 3.04771 0.0936
NP_441105.1_3 Forward -200 -181 -2.85214 0.169
NP_440216.1_1 Reverse -264 -278 8.25939 0.0061
NP_440216.1_1 Forward -273 -259 7.57108 0.00935
NP_440172.1_1 Forward -273 -263 8.73149 0.0586
NP_440172.1_1 Reverse -264 -274 8.73149 0.0586
NP_440172.1_1 Forward -189 -179 2.24165 0.279
NP_442015.1_10 Reverse -260 -273 21.4554 0.00329
NP_442015.1_10 Forward -267 -254 2.08423 0.202
NP_441226.1_7 Forward -272 -265 14.4934 0.0123
NP_441226.1_7 Reverse -265 -272 14.4934 0.0123
NP_441111.1_7 Forward -272 -264 18.7023 0.00294
NP_441111.1_7 Reverse -265 -273 18.7023 0.00294
NP_441766.1_2 Forward -273 -264 17.5026 0.00297
NP_441766.1_2 Reverse -264 -273 17.5026 0.00297
NP_442417.1_5 Forward -273 -259 9.43936 0.132
NP_440416.1_9 Reverse -257 -276 -5.70374 0.0814
NP_440416.1_9 Forward -280 -261 -16.3235 0.212
NP_443052.1_8 Forward -283 -264 -5.50708 0.13
NP_443052.1_8 Reverse -254 -273 -11.5053 0.231
NP_443052.1_9 Forward -302 -283 -2.16383 0.233
NP_443052.1_9 Forward -337 -318 -5.21209 0.265
NP_442154.1_1 Reverse -319 -337 -14.2388 0.217
NP_442154.1_1 Reverse -112 -130 -18.8604 0.286
NP_442564.1_9 Reverse -180 -194 18.4712 0.0651
NP_440261.1_5 Reverse -265 -278 8.37742 0.0263
NP_440261.1_5 Forward -272 -259 -2.63565 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAATGCTGCTGGTCAAATCCACATTGGTGAACTGGGCGGTGAGCAGGTCTTGGTCCCGAAAATCCGTTTCCGCCAACACCATATTTTCGAAAGCTGAAGCTCCCCCGGTTACGGAAGAAGAACTAGCGGCGATCGCCGGGGCAGACCAAATCAAACAAGCCACGGTGAGCACAACAAGGAAGGACTGACGAAACACTTTCAGCATTGGGGAAGCGATGACCTGAATTCAATGTGGCATAGACACCAACTAGATTATCAGTAATCAAGGCGCGGGCATACCCCCAATGGCAGGGAGAGGTTATGTTCCACTGATTTCCTCGGCGGCAAGAATTGGTAATCGACTCCGGAAGTAACTCATTCAACCAAAGATTTGTCCGGGTAAATTAAGTCTGACCTTGCT

CDS

ATGATCAGGGATGTCTTTTATCTTCTTTCATTAAATATGTACTATTTGCCCCAGCCTCCCTATTTTTTAATTGCGGTAGGGCTTTTTGTTGGGATTACCTGTGGCGCGGCCTTTGAAGCCACCTTAAAACAGAAAGTGAAGCTTTGGTTAAATACCCCCGCCAGCACACTAGCCGACCTGGATTTACAACTACCTTTCATGGGTATTTGTGTAGGGGTTTGTGTATTCCTAGCTTCTGGAGTGCAAATTTTTTTGGGTAATGGTTGGATTTCCTACGCCATTTCTTTGCCCATTACCGTTTTTATTGCAGCATTGGTGTGGCGACAATTAGATAGCTTACTAAAACAATTAAAAAGCGGTGGATCTGCGGCCATTGATTTAGATATTTTCTAG

Protein

MIRDVFYLLSLNMYYLPQPPYFLIAVGLFVGITCGAAFEATLKQKVKLWLNTPASTLADLDLQLPFMGICVGVCVFLASGVQIFLGNGWISYAISLPITVFIAALVWRQLDSLLKQLKSGGSAAIDLDIF