Your browser is old and dusty. Try Google Chrome!

Details for slr0587

ORF slr0587
Accession NP_443031.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -274 -267 14.6904 0.0123
NP_440795.1_7 Reverse -267 -274 14.6904 0.0123
NP_441418.1_6 Forward -275 -256 -10.522 0.0362
NP_441418.1_6 Reverse -277 -296 -22.715 0.184
NP_442291.1_5 Forward -276 -260 2.51681 0.123
NP_442291.1_5 Reverse -265 -281 -1.71142 0.202
NP_441453.1_4 Reverse -266 -274 16.6374 0.00633
NP_441453.1_4 Forward -275 -267 16.539 0.00633
NP_441623.1_1 Forward -315 -297 -4.20908 0.274
NP_442151.1_1 Reverse -360 -379 3.14605 0.291
NP_441818.1_1 Reverse -267 -278 8.90795 0.271
NP_440226.1_1 Forward -275 -256 19.6656 0.0109
NP_440226.1_1 Reverse -266 -285 4.52268 0.188
NP_442173.1_1 Forward -274 -266 17.3257 0.00633
NP_442173.1_1 Reverse -267 -275 15.4574 0.00633
NP_442173.1_1 Reverse -278 -286 5.72262 0.203
NP_442173.1_3 Forward -62 -52 16.2046 0.196
NP_442752.1_4 Forward -275 -268 13.8055 0.0199
NP_443027.1_4 Reverse -264 -274 16.303 0.0437
NP_443027.1_4 Forward -277 -267 11.8781 0.0872
NP_441745.1_5 Forward -300 -281 16.3224 0.065
NP_441812.1_3 Forward -276 -262 14.1593 0.137
NP_442975.1_10 Reverse -262 -276 12.9786 0.0459
NP_441675.1_4 Reverse -211 -230 3.24438 0.277
NP_440784.1_7 Forward -274 -267 15.9687 0.0123
NP_440784.1_7 Reverse -267 -274 15.9687 0.0123
NP_440061.1_9 Reverse -44 -58 10.2254 0.126
NP_440061.1_9 Reverse -264 -278 9.04542 0.154
NP_441054.1_4 Forward -285 -267 12.0155 0.0619
NP_442062.1_8 Forward -275 -265 19.1546 0.00121
NP_442062.1_8 Reverse -266 -276 16.9913 0.00317
NP_441900.1_2 Reverse -313 -331 -5.58642 0.288
NP_441859.1_3 Forward -276 -257 2.26028 0.263
NP_440304.1_4 Forward -288 -278 3.71661 0.293
NP_440304.1_4 Forward -277 -267 1.84832 0.299
NP_442242.1_4 Forward -274 -267 14.3954 0.0124
NP_442242.1_4 Reverse -267 -274 14.3954 0.0124
NP_440044.1_8 Forward -274 -255 -3.24547 0.281
NP_441660.1_8 Forward -208 -189 13.2741 0.226
NP_441594.1_6 Forward -329 -310 6.98095 0.181
NP_440856.1_4 Forward -103 -84 -5.31042 0.285
NP_441083.1_5 Reverse -277 -287 5.38824 0.12
NP_441083.1_5 Reverse -266 -276 2.14332 0.195
NP_441083.1_5 Forward -275 -265 1.55333 0.204
NP_441738.1_2 Reverse -268 -275 15.28 0.0102
NP_441738.1_2 Forward -273 -266 11.5435 0.084
NP_441738.1_2 Forward -105 -98 6.03696 0.295
NP_441558.1_5 Reverse -264 -283 10.6192 0.0955
NP_441955.1_8 Forward -281 -264 6.13536 0.281
NP_440209.1_1 Forward -275 -267 18.1123 0.00295
NP_440209.1_1 Reverse -266 -274 8.57422 0.0425
NP_440056.1_6 Forward -370 -351 19.2791 0.149
NP_440178.1_7 Forward -276 -257 -23.01 0.287
NP_441716.1_1 Reverse -317 -331 5.89945 0.211
NP_441716.1_1 Reverse -220 -234 4.42448 0.256
NP_442111.1_4 Forward -392 -378 2.85119 0.263
NP_440343.1_9 Reverse -105 -124 14.1591 0.152
NP_440906.1_5 Forward -274 -267 15.8704 0.0124
NP_440906.1_5 Reverse -267 -274 15.8704 0.0124
NP_440747.1_10 Forward -278 -266 -2.51763 0.0509
NP_440747.1_10 Reverse -263 -275 -11.7607 0.142
NP_440747.1_10 Reverse -274 -286 -12.2524 0.254
NP_441130.1_10 Reverse -264 -278 13.0776 0.0765
NP_441486.1_1 Forward -278 -264 11.2093 0.0168
NP_441486.1_1 Reverse -263 -277 10.7177 0.0189
NP_441880.2_10 Reverse -267 -285 11.1305 0.171
NP_441880.2_10 Forward -274 -256 7.98396 0.284
NP_442634.1_4 Forward -277 -263 -1.37704 0.149
NP_441695.1_8 Reverse -356 -370 11.5043 0.269
NP_441014.1_10 Forward -276 -257 0.883656 0.236
NP_442848.1_1 Reverse -260 -274 -4.52363 0.294
NP_443018.1_3 Forward -274 -267 14.8871 0.0123
NP_443018.1_3 Reverse -267 -274 14.8871 0.0123
NP_441634.1_8 Forward -277 -263 -2.85201 0.295
NP_440376.1_1 Reverse -266 -275 9.73449 0.0365
NP_440376.1_1 Forward -275 -266 9.63616 0.0385
NP_440376.1_1 Reverse -115 -124 2.06468 0.236
NP_441588.1_4 Forward -273 -263 7.64985 0.178
NP_442687.1_7 Forward -276 -266 14.828 0.0247
NP_442687.1_7 Forward -287 -277 6.56821 0.159
NP_442687.1_7 Reverse -265 -275 6.27322 0.175
NP_442485.1_3 Reverse -255 -274 -0.590531 0.253
NP_442485.1_3 Forward -376 -357 -2.45882 0.262
NP_442485.1_3 Reverse -50 -69 -4.32711 0.28
NP_441846.1_10 Forward -340 -321 -23.305 0.282
NP_441846.1_10 Forward -336 -317 -23.6983 0.295
NP_442958.1_3 Forward -286 -267 20.8456 0.0172
NP_441013.1_2 Reverse -50 -68 1.88744 0.242
NP_440360.1_10 Reverse -313 -327 6.58777 0.227
NP_442658.1_1 Forward -277 -267 17.0891 0.00615
NP_442658.1_1 Reverse -264 -274 15.0242 0.0188
NP_442782.1_2 Forward -310 -296 1.47456 0.281
NP_442782.1_2 Forward -275 -261 1.08123 0.282
NP_440656.1_8 Reverse -255 -274 11.1109 0.0486
NP_441414.1_9 Reverse -266 -285 5.50599 0.0471
NP_441487.1_6 Forward -294 -275 6.68596 0.216
NP_441487.1_9 Forward -276 -257 0.294447 0.235
NP_441487.1_9 Reverse -268 -287 -1.96717 0.29
NP_442937.1_5 Reverse -28 -47 9.93088 0.177
NP_441958.1_5 Forward -276 -266 10.9931 0.00875
NP_441958.1_5 Reverse -265 -275 2.53664 0.0409
NP_441958.1_5 Forward -287 -277 -1.29827 0.236
NP_442836.1_5 Forward -281 -262 1.76941 0.273
NP_440203.1_5 Reverse -157 -167 14.2375 0.0886
NP_440203.1_5 Forward -121 -111 9.616 0.25
NP_439905.1_1 Reverse -267 -280 22.4387 0.00648
NP_440984.1_7 Forward -280 -266 20.6491 0.00337
NP_442911.1_2 Forward -285 -266 2.55606 0.0499
NP_442911.1_2 Reverse -256 -275 -7.37537 0.208
NP_442911.1_2 Reverse -267 -286 -8.16202 0.228
NP_440153.1_5 Reverse -267 -281 5.60446 0.191
NP_442119.1_9 Reverse -265 -284 15.1424 0.21
NP_443055.1_6 Reverse -258 -276 1.10005 0.237
NP_440993.1_3 Reverse -237 -256 -1.67294 0.29
NP_440602.1_8 Forward -275 -261 18.0925 0.0898
NP_442002.1_9 Forward -287 -280 12.4288 0.185
NP_442002.1_9 Forward -276 -269 10.7572 0.185
NP_440809.1_9 Forward -238 -220 -8.92897 0.287
NP_441646.1_1 Reverse -307 -326 -0.197208 0.259
NP_442438.1_10 Forward -25 -11 5.99778 0.123
NP_442438.1_10 Reverse -261 -275 0.88457 0.213
NP_441398.1_9 Reverse -56 -75 12.4867 0.288
NP_441000.1_6 Forward -276 -262 12.9793 0.0396
NP_441000.1_6 Reverse -265 -279 6.78443 0.0933
NP_441674.1_2 Reverse -187 -206 3.83436 0.299
NP_440147.1_4 Reverse -264 -277 7.6891 0.064
NP_440147.1_4 Forward -277 -264 6.60746 0.0881
NP_440147.1_4 Forward -288 -275 4.54251 0.157
NP_441550.1_8 Forward -277 -267 8.82935 0.112
NP_441916.1_7 Reverse -266 -276 19.1546 0.00144
NP_441916.1_7 Forward -275 -265 16.4013 0.00539
NP_441916.1_10 Reverse -158 -177 6.98095 0.199
NP_440206.1_9 Reverse -339 -358 8.94757 0.272
NP_441041.1_4 Forward -275 -256 -10.4236 0.232
NP_441041.1_7 Reverse -263 -275 10.0414 0.103
NP_441041.1_7 Forward -278 -266 5.27969 0.265
NP_441725.1_5 Forward -274 -264 2.24165 0.115
NP_441725.1_5 Reverse -267 -277 2.04498 0.115
NP_439966.1_7 Forward -277 -267 17.9741 0.00631
NP_439966.1_7 Reverse -264 -274 10.206 0.0958
NP_439966.1_9 Reverse -264 -273 0.983037 0.253
NP_439966.1_9 Forward -277 -268 0.884706 0.253
NP_442941.1_3 Reverse -267 -277 10.7964 0.0116
NP_442941.1_3 Forward -274 -264 8.92815 0.0326
NP_440289.1_2 Reverse -263 -276 5.72248 0.0616
NP_440289.1_2 Forward -368 -355 -0.964025 0.218
NP_440289.1_2 Forward -278 -265 -4.79893 0.294
NP_442281.1_1 Reverse -261 -275 21.3367 0.00192
NP_442281.1_1 Forward -280 -266 6.29216 0.13
NP_001035871.2_7 Reverse -112 -122 16.4013 0.14
NP_440437.1_1 Reverse -260 -279 1.17943 0.155
NP_442049.1_10 Forward -283 -264 4.52268 0.289
NP_440498.1_1 Forward -284 -266 10.6389 0.0786
NP_440498.1_1 Forward -244 -226 -2.43913 0.241
NP_441644.1_6 Reverse -266 -276 7.74772 0.117
NP_441644.1_6 Reverse -160 -170 4.60114 0.233
NP_442215.1_2 Forward -177 -161 5.36841 0.0796
NP_442215.1_2 Forward -128 -112 -6.23465 0.266
NP_442029.1_1 Forward -334 -315 -9.63698 0.194
NP_442247.1_8 Forward -277 -263 10.9143 0.247
NP_440253.1_2 Forward -275 -257 23.7169 0.00199
NP_440929.1_8 Reverse -266 -275 9.93116 0.0249
NP_440929.1_8 Forward -275 -266 9.83282 0.0254
NP_442933.1_2 Forward -47 -29 8.1188 0.257
NP_442933.1_10 Forward -275 -266 17.601 0.00325
NP_442933.1_10 Reverse -266 -275 17.601 0.00325
NP_442554.1_8 Reverse -267 -277 14.1397 0.0144
NP_442554.1_8 Forward -274 -264 4.20827 0.193
NP_441762.1_7 Reverse -265 -277 13.9036 0.0142
NP_441762.1_7 Forward -276 -264 4.5622 0.0462
NP_442142.1_4 Reverse -52 -65 16.0466 0.0264
NP_442142.1_4 Reverse -263 -276 11.5234 0.0552
NP_442142.1_4 Forward -278 -265 7.00021 0.151
NP_442142.1_4 Reverse -320 -333 4.14862 0.231
NP_442142.1_4 Forward -172 -159 4.05029 0.234
NP_442292.1_1 Reverse -267 -276 9.63616 0.0183
NP_442292.1_1 Forward -274 -265 0.688044 0.23
NP_440919.1_1 Forward -245 -226 -2.75381 0.221
NP_442476.1_6 Reverse -267 -281 24.3857 0.00448
NP_442381.1_8 Forward -278 -259 -14.4552 0.28
NP_443009.1_5 Forward -276 -265 10.5796 0.0792
NP_443009.1_5 Reverse -265 -276 7.62965 0.124
NP_442092.1_6 Reverse -318 -337 11.405 0.268
NP_441715.1_4 Reverse -267 -277 18.8596 0.00741
NP_441715.1_4 Forward -274 -264 15.0247 0.0268
NP_441198.1_5 Reverse -13 -26 12.2117 0.228
NP_440379.1_8 Forward -286 -267 13.1758 0.244
NP_441468.1_1 Forward -274 -267 15.8704 0.0124
NP_441468.1_1 Reverse -267 -274 15.8704 0.0124
NP_441020.2_6 Forward -277 -260 8.49531 0.197
NP_441020.2_6 Forward -325 -308 6.13536 0.275
NP_441673.1_1 Reverse -266 -275 11.1111 0.0121
NP_441673.1_1 Forward -275 -266 11.0128 0.018
NP_441320.1_9 Forward -304 -285 21.3187 0.0476
NP_442868.1_6 Forward -277 -267 10.3048 0.038
NP_442868.1_6 Forward -125 -115 2.04498 0.205
NP_441251.1_7 Forward -211 -198 10.7374 0.283
NP_441056.1_1 Reverse -98 -117 -7.08038 0.271
NP_442808.1_1 Reverse -265 -275 9.91099 0.0481
NP_442808.1_1 Forward -276 -266 8.63269 0.0481
NP_442808.1_1 Reverse -322 -332 2.73286 0.256
NP_440145.1_3 Reverse -105 -124 -5.11376 0.258
NP_442542.1_2 Forward -288 -275 7.39411 0.182
NP_442542.1_2 Forward -277 -264 6.90245 0.201
NP_442542.1_9 Forward -282 -268 4.8172 0.285
NP_442050.1_5 Reverse -264 -274 8.23937 0.234
NP_442050.1_5 Forward -277 -267 6.96107 0.27
NP_442050.1_5 Forward -109 -99 6.76441 0.282
NP_440558.1_2 Reverse -244 -263 -1.57384 0.215
NP_441518.1_3 Reverse -256 -275 -12.8819 0.264
NP_442792.1_4 Forward -310 -291 11.6025 0.288
NP_441878.1_6 Forward -366 -356 0.668351 0.139
NP_441878.1_6 Reverse -265 -275 0.668351 0.139
NP_441878.1_6 Forward -276 -266 0.57002 0.14
NP_441878.1_6 Reverse -276 -286 -7.59145 0.245
NP_441036.1_8 Reverse -265 -275 17.4829 0.0012
NP_441036.1_8 Forward -276 -266 13.8447 0.0353
NP_441557.1_5 Forward -275 -266 18.6826 0.0015
NP_441557.1_5 Reverse -266 -275 10.5211 0.00695
NP_441557.1_8 Reverse -335 -345 11.9759 0.236
NP_441590.1_4 Reverse -319 -338 2.9486 0.29
NP_442066.2_4 Forward -357 -338 -6.68705 0.254
NP_442066.2_9 Forward -279 -266 9.16406 0.181
NP_440738.1_5 Reverse -200 -219 2.85105 0.277
NP_440101.1_3 Forward -280 -261 1.67108 0.269
NP_442183.1_1 Forward -275 -261 11.406 0.0702
NP_441467.1_5 Forward -11 -1 17.9746 0.199
NP_442170.1_5 Forward -275 -256 -2.75381 0.267
NP_442347.1_2 Reverse -267 -276 11.1111 0.056
NP_442347.1_2 Reverse -155 -164 3.7363 0.284
NP_442645.1_2 Reverse -258 -277 -22.9117 0.299
NP_441037.1_4 Forward -277 -267 6.92787 0.237
NP_442594.1_8 Forward -344 -325 7.17762 0.214
NP_441633.1_3 Forward -277 -264 3.16588 0.0738
NP_441633.1_3 Reverse -264 -277 -3.71729 0.177
NP_440136.1_2 Forward -274 -267 15.9687 0.0123
NP_440136.1_2 Reverse -267 -274 15.9687 0.0123
NP_442998.1_10 Reverse -268 -275 15.5754 0.0102
NP_442998.1_10 Reverse -279 -286 9.28223 0.117
NP_442998.1_10 Forward -273 -266 5.74231 0.255
NP_440299.1_1 Forward -279 -266 6.11523 0.152
NP_441799.1_1 Forward -279 -265 17.7968 0.0105
NP_441799.1_1 Reverse -262 -276 10.422 0.0747
NP_442528.1_2 Reverse -202 -221 17.8957 0.169
NP_441007.1_10 Forward -280 -267 1.88757 0.203
NP_442334.1_2 Forward -296 -279 -14.4158 0.3
NP_442201.1_10 Forward -286 -267 -4.91709 0.152
NP_440256.1_1 Forward -278 -259 -2.75381 0.122
NP_440256.1_1 Reverse -263 -282 -2.75381 0.122
NP_440087.1_1 Forward -284 -265 -7.86702 0.276
NP_441090.1_2 Forward -299 -280 2.26107 0.231
NP_441559.1_8 Forward -280 -266 -7.17857 0.287
NP_440915.1_6 Forward -290 -276 0.88457 0.151
NP_440329.1_3 Forward -52 -33 13.3784 0.298
NP_442452.1_10 Reverse -363 -382 12.1925 0.297
NP_442866.1_1 Forward -280 -261 -3.93378 0.222
NP_441464.1_10 Reverse -23 -37 14.8476 0.166
NP_440787.1_5 Forward -204 -190 9.14437 0.287
NP_440306.1_8 Forward -138 -119 4.42355 0.204
NP_441939.1_3 Reverse -267 -286 10.3242 0.126
NP_441494.1_6 Reverse -343 -356 6.4108 0.289
NP_441494.1_6 Forward -245 -232 5.72248 0.294
NP_442993.1_1 Forward -275 -259 2.91013 0.0502
NP_442386.1_9 Reverse -265 -274 16.7155 0.0144
NP_442386.1_9 Forward -276 -267 15.7322 0.0144
NP_441340.1_5 Forward -274 -267 15.6737 0.0124
NP_441340.1_5 Reverse -267 -274 15.6737 0.0124
NP_440168.1_9 Reverse -275 -294 -4.42544 0.296
NP_442240.1_1 Reverse -239 -258 5.2102 0.264
NP_442240.1_2 Reverse -369 -388 -13.5702 0.171
NP_442240.1_2 Reverse -267 -286 -14.0619 0.174
NP_440586.1_8 Forward -274 -267 13.2151 0.026
NP_440586.1_8 Reverse -267 -274 13.2151 0.026
NP_442251.1_6 Forward -274 -267 15.2804 0.0124
NP_442251.1_6 Reverse -267 -274 15.2804 0.0124
NP_441262.1_3 Forward -275 -268 14.7888 0.0223
NP_441262.1_3 Reverse -266 -273 13.9038 0.0336
NP_443051.1_1 Forward -276 -267 10.4228 0.00754
NP_443051.1_1 Reverse -265 -274 1.08137 0.123
NP_439937.1_9 Reverse -285 -302 -9.49991 0.192
NP_439937.1_9 Reverse -286 -303 -13.5315 0.287
NP_439937.1_9 Reverse -276 -293 -17.3663 0.298
NP_442294.1_3 Forward -271 -257 11.7003 0.298
NP_440439.1_1 Forward -278 -265 20.3738 0.0105
NP_440439.1_1 Reverse -263 -276 -1.35735 0.263
NP_440921.1_2 Forward -331 -312 24.8772 0.0115
NP_440372.1_2 Forward -274 -267 16.3621 0.0124
NP_440372.1_2 Reverse -267 -274 16.3621 0.0124
NP_441789.1_7 Reverse -325 -344 4.62021 0.193
NP_440819.1_5 Forward -244 -236 7.8859 0.266
NP_440316.1_10 Forward -366 -356 8.53483 0.239
NP_440316.1_10 Forward -65 -55 8.04317 0.24
NP_440139.1_1 Forward -281 -262 4.03023 0.193
NP_441572.1_7 Reverse -271 -290 -1.57384 0.188
NP_440267.1_2 Reverse -261 -275 11.4053 0.125
NP_442384.1_10 Reverse -266 -279 18.4072 0.00476
NP_442114.1_4 Reverse -266 -277 17.0699 0.107
NP_442262.1_10 Forward -274 -267 14.1988 0.0123
NP_442262.1_10 Reverse -267 -274 14.1988 0.0123
NP_442262.1_10 Reverse -278 -285 7.90559 0.266
NP_441689.1_5 Reverse -264 -274 10.796 0.132
NP_440163.1_10 Reverse -263 -273 11.3864 0.169
NP_440344.1_10 Reverse -259 -276 -0.649475 0.0444
NP_440344.1_10 Reverse -307 -324 -13.8258 0.296
NP_440531.1_6 Forward -283 -264 -2.0655 0.244
NP_441335.1_8 Forward -297 -278 8.16093 0.264
NP_440562.1_1 Reverse -270 -289 12.1917 0.269
NP_440562.1_5 Reverse -189 -208 4.12936 0.261
NP_441965.1_3 Forward -285 -266 -1.47551 0.285
NP_441965.1_10 Reverse -263 -279 13.8249 0.0977
NP_440297.1_9 Forward -69 -59 3.61828 0.263
NP_440297.1_9 Forward -274 -264 0.766681 0.282
NP_440297.1_9 Reverse -267 -277 -0.118297 0.282
NP_440999.1_9 Forward -279 -265 -2.95034 0.281
NP_440888.1_2 Reverse -266 -280 13.372 0.0297
NP_440888.1_2 Forward -275 -261 10.1271 0.104
NP_440888.1_2 Reverse -314 -328 7.27547 0.202
NP_440792.1_5 Forward -274 -255 8.16093 0.237
NP_441543.1_2 Reverse -267 -276 18.486 0.00236
NP_441543.1_2 Forward -274 -265 15.4377 0.00784
NP_441551.1_5 Forward -279 -263 9.69426 0.207
NP_441469.1_8 Forward -276 -267 16.126 0.00797
NP_441469.1_8 Reverse -265 -274 8.06287 0.227
NP_442315.1_2 Reverse -110 -122 11.1504 0.291
NP_442315.1_2 Forward -327 -315 9.18376 0.291
NP_442578.1_7 Forward -274 -267 14.5921 0.026
NP_442578.1_7 Reverse -267 -274 14.5921 0.026
NP_441462.1_2 Forward -275 -265 10.5998 0.0068
NP_441462.1_2 Reverse -266 -276 1.84832 0.081
NP_441462.1_2 Forward -286 -276 -1.19994 0.291
NP_441621.1_7 Forward -322 -308 -5.9986 0.27
NP_443062.1_1 Forward -275 -257 10.0085 0.122
NP_443062.1_1 Reverse -266 -284 9.22847 0.138
NP_443062.1_1 Forward -124 -106 3.86557 0.282
NP_443062.1_6 Forward -283 -264 7.86593 0.159
NP_442204.1_1 Forward -381 -370 8.7118 0.0852
NP_442204.1_1 Forward -279 -268 -0.0396598 0.285
NP_442872.1_1 Reverse -318 -337 -0.885524 0.184
NP_440516.1_6 Reverse -55 -69 8.84875 0.246
NP_440516.1_8 Forward -275 -266 9.4395 0.0183
NP_440516.1_8 Reverse -266 -275 7.17789 0.0754
NP_441785.1_1 Forward -275 -261 13.514 0.211
NP_442428.1_5 Forward -274 -267 15.8704 0.0124
NP_442428.1_5 Reverse -267 -274 15.8704 0.0124
NP_440673.1_3 Forward -273 -266 14.0021 0.0426
NP_440673.1_3 Reverse -268 -275 12.4288 0.0426
NP_441052.1_2 Reverse -323 -333 2.53664 0.201
NP_441052.1_2 Reverse -266 -276 2.04498 0.22
NP_441052.1_2 Forward -275 -265 0.668351 0.256
NP_442219.1_1 Forward -300 -281 19.764 0.219
NP_442219.1_9 Forward -274 -265 9.04618 0.0681
NP_442219.1_9 Reverse -267 -276 8.35786 0.0681
NP_440436.1_4 Reverse -267 -276 18.1905 0.00233
NP_440436.1_4 Forward -274 -265 16.9122 0.00357
NP_441884.1_9 Forward -291 -272 -19.2734 0.146
NP_441884.1_9 Reverse -43 -62 -21.535 0.25
NP_441884.1_9 Reverse -263 -282 -24.2883 0.286
NP_442864.1_7 Forward -292 -274 5.03403 0.295
NP_440314.1_9 Reverse -291 -310 -9.047 0.258
NP_440314.1_9 Reverse -324 -343 -10.3253 0.295
NP_442577.1_1 Reverse -104 -123 -2.75381 0.283
NP_441719.1_4 Forward -274 -267 16.3621 0.0124
NP_441719.1_4 Reverse -267 -274 16.3621 0.0124
NP_441733.1_10 Reverse -263 -276 8.37742 0.14
NP_441004.1_1 Forward -326 -307 -9.63698 0.21
NP_441004.1_1 Forward -338 -319 -13.9635 0.263
NP_441004.1_5 Forward -336 -322 15.8309 0.22
NP_442366.1_3 Forward -276 -258 10.6389 0.0449
NP_441115.1_4 Reverse -265 -283 11.2281 0.148
NP_442206.1_10 Forward -275 -260 5.97809 0.178
NP_442312.1_1 Forward -217 -198 10.7175 0.275
NP_443054.1_2 Forward -277 -263 0.982901 0.251
NP_441851.1_10 Forward -276 -266 17.188 0.00552
NP_441851.1_10 Reverse -265 -275 6.76487 0.156
NP_442622.1_1 Forward -276 -257 -11.8986 0.257
NP_441396.1_5 Forward -328 -319 8.65285 0.21
NP_440940.1_7 Forward -296 -278 2.77167 0.295
NP_440432.1_9 Forward -274 -259 5.78142 0.0512
NP_440432.1_9 Reverse -267 -282 -5.32998 0.245
NP_442843.1_1 Forward -293 -274 -11.5053 0.291
NP_440474.1_8 Forward -274 -260 8.45543 0.186
NP_440474.1_8 Reverse -267 -281 4.03056 0.294
NP_440588.1_2 Forward -284 -265 -2.16383 0.161
NP_442006.1_2 Forward -64 -47 -14.3175 0.203
NP_442243.1_1 Reverse -241 -259 -2.24319 0.288
NP_441570.1_1 Forward -275 -257 -17.3854 0.273
NP_441078.1_4 Reverse -266 -275 9.93116 0.0203
NP_441078.1_4 Forward -275 -266 9.83282 0.0226
NP_440707.1_6 Forward -283 -264 13.8633 0.172
NP_442443.1_1 Reverse -340 -359 2.0644 0.194
NP_441432.1_8 Forward -276 -267 8.25953 0.0755
NP_441432.1_8 Forward -257 -248 5.40793 0.158
NP_442320.1_8 Reverse -260 -274 12.586 0.0175
NP_442320.1_8 Forward -281 -267 -2.26202 0.0871
NP_442447.1_2 Forward -287 -268 20.7473 0.154
NP_440629.1_4 Reverse -285 -304 9.63589 0.247
NP_440629.1_7 Reverse -360 -379 19.0757 0.202
NP_441057.1_4 Reverse -276 -294 -2.63579 0.275
NP_441328.2_8 Reverse -44 -63 14.8466 0.268
NP_442400.1_1 Forward -278 -259 -3.63879 0.243
NP_442489.1_7 Reverse -266 -275 10.4228 0.0151
NP_442489.1_7 Forward -275 -266 10.3245 0.0193
NP_442489.1_7 Reverse -277 -286 -1.77023 0.247
NP_440757.1_7 Reverse -306 -324 -2.14413 0.276
NP_440559.1_1 Forward -274 -265 8.84951 0.0586
NP_440559.1_1 Reverse -267 -276 8.75118 0.0586
NP_442763.1_10 Reverse -363 -382 9.14423 0.251
NP_441659.2_8 Reverse -266 -276 9.7148 0.0271
NP_441659.2_8 Forward -275 -265 2.33998 0.205
NP_442913.1_10 Reverse -238 -257 9.73422 0.0439
NP_440118.1_5 Forward -188 -169 6.68596 0.112
NP_442346.1_5 Forward -276 -266 8.53483 0.133
NP_442346.1_5 Reverse -265 -275 6.8632 0.188
NP_440545.1_3 Forward -290 -273 -4.18939 0.22
NP_440545.1_3 Forward -324 -307 -6.05768 0.268
NP_441856.1_3 Reverse -263 -282 0.786102 0.213
NP_440025.1_1 Forward -279 -260 10.8159 0.158
NP_440459.1_2 Reverse -264 -281 8.69197 0.253
NP_441653.1_2 Forward -251 -232 5.94546 0.235
NP_442603.1_7 Reverse -266 -280 6.0955 0.259
NP_441888.1_7 Forward -280 -266 5.21113 0.225
NP_441888.1_7 Reverse -261 -275 1.76955 0.239
NP_441948.1_4 Reverse -259 -277 -1.84914 0.154
NP_441358.1_2 Forward -347 -328 15.7324 0.171
NP_441833.1_4 Forward -274 -267 15.9687 0.0124
NP_441833.1_4 Reverse -267 -274 15.9687 0.0124
NP_442162.1_9 Forward -274 -267 16.2637 0.0124
NP_442162.1_9 Reverse -267 -274 16.2637 0.0124
NP_440671.1_1 Forward -138 -119 6.32247 0.244
NP_440671.1_4 Reverse -260 -274 6.88276 0.233
NP_440671.1_4 Forward -387 -373 5.89945 0.27
NP_442140.1_3 Reverse -267 -277 14.238 0.0486
NP_442140.1_3 Forward -274 -264 8.04317 0.124
NP_442723.1_1 Reverse -42 -61 1.86696 0.292
NP_440875.1_9 Reverse -268 -278 14.3096 0.0453
NP_441813.1_5 Forward -277 -267 19.4496 0.00647
NP_441813.1_5 Reverse -264 -274 16.4013 0.01
NP_440594.1_6 Reverse -308 -327 12.6833 0.169
NP_440590.1_4 Reverse -267 -280 12.3107 0.0148
NP_440567.1_1 Reverse -267 -281 10.816 0.0323
NP_440567.1_1 Forward -274 -260 6.09611 0.0894
NP_440567.1_4 Reverse -377 -396 -0.0988766 0.281
NP_442497.1_10 Reverse -267 -276 10.4228 0.0087
NP_442497.1_10 Forward -274 -265 8.55452 0.0294
NP_440821.1_4 Reverse -264 -274 10.3048 0.0163
NP_440821.1_4 Forward -277 -267 10.2065 0.0163
NP_441239.1_9 Reverse -264 -276 14.297 0.0288
NP_441239.1_9 Forward -277 -265 12.6253 0.0446
NP_441239.1_9 Reverse -284 -296 6.82381 0.175
NP_441951.1_3 Reverse -265 -284 16.9124 0.286
NP_440156.1_4 Forward -204 -194 16.7941 0.176
NP_440665.1_1 Reverse -154 -173 -0.4922 0.177
NP_440354.1_7 Forward -281 -263 6.60732 0.278
NP_442138.1_9 Forward -288 -269 7.27514 0.299
NP_440546.1_4 Forward -275 -265 13.5365 0.0459
NP_440546.1_4 Reverse -266 -276 12.6639 0.0641
NP_440546.1_6 Forward -213 -194 9.24257 0.251
NP_440675.1_10 Reverse -279 -298 12.6841 0.247
NP_440462.1_6 Forward -277 -267 17.2863 0.00752
NP_440462.1_6 Reverse -264 -274 14.7297 0.0186
NP_440868.1_4 Forward -279 -267 22.1634 0.00629
NP_440868.1_4 Reverse -262 -274 0.530633 0.21
NP_441474.1_1 Reverse -322 -341 -2.95123 0.29
NP_442402.1_4 Reverse -305 -324 -7.76943 0.278
NP_442402.1_10 Reverse -49 -59 11.4843 0.251
NP_442358.1_1 Reverse -258 -276 13.3922 0.285
NP_442039.1_4 Forward -274 -267 15.1821 0.0124
NP_442039.1_4 Reverse -267 -274 15.1821 0.0124
NP_441811.1_1 Reverse -277 -296 7.47261 0.28
NP_442837.1_3 Forward -274 -267 15.7721 0.0124
NP_442837.1_3 Reverse -267 -274 15.7721 0.0124
NP_442053.1_1 Forward -275 -266 9.24284 0.068
NP_442053.1_1 Reverse -266 -275 8.94785 0.07
NP_440505.1_3 Forward -277 -267 15.9097 0.00857
NP_440505.1_3 Forward -258 -248 5.97822 0.202
NP_440505.1_7 Reverse -61 -80 0.294447 0.259
NP_441701.1_3 Forward -167 -150 7.80699 0.257
NP_440914.1_1 Reverse -266 -276 7.34642 0.241
NP_441011.1_8 Forward -274 -265 18.191 0.00602
NP_441011.1_8 Reverse -267 -276 16.9127 0.00602
NP_442101.1_6 Forward -148 -129 12.7825 0.231
NP_442533.1_1 Forward -338 -319 3.83436 0.0838
NP_442533.1_1 Forward -329 -310 -14.4552 0.243
NP_442533.1_6 Forward -275 -266 15.1427 0.00675
NP_442533.1_6 Reverse -266 -275 7.47288 0.0898
NP_439944.1_9 Forward -274 -264 8.63316 0.105
NP_440115.1_6 Forward -289 -279 7.94484 0.146
NP_440115.1_6 Forward -278 -268 6.66654 0.172
NP_440007.1_9 Reverse -162 -176 6.29277 0.229
NP_441602.1_3 Forward -280 -261 -4.42544 0.265
NP_441972.1_5 Reverse -267 -286 -10.227 0.3
NP_441106.1_1 Forward -276 -267 18.191 0.0028
NP_441106.1_1 Reverse -265 -274 17.306 0.00607
NP_441420.1_2 Reverse -311 -330 18.1907 0.268
NP_442306.1_10 Forward -280 -261 -20.2567 0.202
NP_441286.1_1 Forward -276 -264 -4.28759 0.154
NP_440670.1_8 Reverse -91 -100 9.73449 0.0528
NP_440670.1_8 Forward -275 -266 8.94785 0.0606
NP_440670.1_8 Reverse -266 -275 8.84951 0.0606
NP_440670.1_8 Forward -286 -277 5.11294 0.171
NP_442463.1_3 Forward -76 -57 11.7992 0.275
NP_440886.1_7 Reverse -319 -329 10.6976 0.0805
NP_440886.1_7 Reverse -265 -275 9.02601 0.0805
NP_440886.1_7 Forward -276 -266 8.43603 0.0805
NP_440828.1_1 Reverse -268 -287 -0.886293 0.28
NP_440083.1_8 Forward -240 -221 14.5524 0.0954
NP_441399.1_10 Forward -302 -283 18.4857 0.209
NP_442072.1_9 Reverse -265 -283 -21.8103 0.212
NP_442213.1_6 Forward -283 -264 5.01433 0.285
NP_441753.1_10 Reverse -257 -276 9.93088 0.163
NP_440907.2_8 Reverse -267 -277 7.94438 0.117
NP_440907.2_8 Forward -274 -264 4.99446 0.228
NP_441021.1_8 Forward -280 -262 7.4923 0.187
NP_441021.1_8 Reverse -261 -279 1.78911 0.258
NP_441463.1_3 Reverse -256 -275 -5.9004 0.235
NP_441463.1_5 Forward -276 -262 11.3077 0.235
NP_441626.1_2 Forward -274 -267 15.7721 0.0124
NP_441626.1_2 Reverse -267 -274 15.7721 0.0124
NP_441962.1_4 Forward -325 -306 -11.2103 0.238
NP_440387.1_1 Forward -275 -259 -2.69473 0.148
NP_441431.1_2 Forward -278 -264 10.6187 0.158
NP_441431.1_2 Forward -368 -354 6.58715 0.266
NP_442084.1_6 Forward -200 -182 7.39397 0.221
NP_441174.1_4 Forward -165 -155 9.7148 0.298
NP_442805.1_5 Reverse -145 -164 -6.88445 0.297
NP_440114.1_10 Reverse -266 -280 13.2743 0.0609
NP_440114.1_10 Forward -275 -261 13.1759 0.0632
NP_440114.1_10 Reverse -356 -370 5.70279 0.296
NP_441510.2_7 Reverse -260 -274 11.897 0.28
NP_440766.1_4 Reverse -262 -276 1.37622 0.236
NP_440766.1_4 Forward -279 -265 0.491246 0.28
NP_440766.1_5 Reverse -120 -132 18.2554 0.0839
NP_439988.1_7 Reverse -313 -327 13.372 0.292
NP_442743.1_4 Reverse -267 -286 -5.01543 0.257
NP_442930.1_1 Reverse -177 -187 12.9592 0.239
NP_439910.1_2 Reverse -258 -275 7.217 0.00636
NP_439910.1_2 Forward -283 -266 -22.2823 0.22
NP_440457.1_1 Forward -290 -278 1.7106 0.227
NP_440457.1_1 Forward -279 -267 1.12062 0.245
NP_440798.1_6 Reverse -267 -280 6.21414 0.14
NP_441332.1_8 Reverse -114 -128 18.3875 0.119
NP_441436.1_8 Forward -287 -268 7.37428 0.293
NP_440473.1_9 Reverse -275 -294 -5.70374 0.22
NP_442509.1_9 Forward -388 -378 11.8776 0.111
NP_442509.1_9 Forward -275 -265 6.86274 0.248
NP_442509.1_9 Reverse -266 -276 6.66608 0.259
NP_440554.1_4 Forward -274 -264 16.6963 0.0189
NP_440554.1_4 Reverse -267 -277 16.4996 0.0189
NP_441885.1_5 Forward -275 -265 10.2065 0.012
NP_441885.1_5 Reverse -266 -276 1.74999 0.0991
NP_441428.1_8 Forward -328 -309 2.94938 0.261
NP_441428.1_8 Reverse -355 -374 2.26107 0.275
NP_441756.1_5 Reverse -274 -293 2.45773 0.209
NP_441173.1_9 Forward -178 -170 14.0803 0.17
NP_440423.1_6 Reverse -258 -277 -14.8485 0.229
NP_443000.1_3 Forward -64 -45 12.2012 0.248
NP_443000.1_7 Forward -277 -267 11.5831 0.0344
NP_443000.1_7 Reverse -264 -274 8.04317 0.0553
NP_442513.1_5 Forward -383 -364 10.1267 0.266
NP_441842.1_1 Reverse -268 -281 20.0782 0.0111
NP_440275.1_3 Forward -277 -267 15.418 0.0178
NP_440091.1_1 Reverse -262 -274 20.5902 0.00953
NP_440091.1_1 Forward -279 -267 0.727295 0.233
NP_442451.1_2 Forward -364 -345 -3.54046 0.195
NP_441207.1_7 Forward -48 -34 13.9992 0.199
NP_440149.1_8 Reverse -266 -285 -5.50708 0.228
NP_441105.1_3 Forward -376 -357 -4.13045 0.192
NP_440216.1_1 Reverse -266 -280 8.65272 0.00592
NP_440216.1_1 Forward -286 -272 -2.75368 0.0574
NP_440216.1_1 Forward -275 -261 -3.54032 0.0833
NP_440172.1_1 Forward -275 -265 10.9931 0.0445
NP_442015.1_10 Forward -279 -266 2.18257 0.199
NP_441226.1_7 Forward -274 -267 14.4934 0.0123
NP_441226.1_7 Reverse -267 -274 14.4934 0.0123
NP_441226.1_7 Forward -123 -116 8.29857 0.205
NP_441111.1_7 Reverse -267 -275 18.7023 0.00294
NP_441111.1_7 Forward -274 -266 8.86921 0.0589
NP_440244.1_1 Forward -330 -311 -0.000545616 0.187
NP_441766.1_2 Forward -275 -266 17.896 0.00297
NP_441766.1_2 Reverse -266 -275 9.4395 0.0285
NP_441766.1_9 Reverse -19 -38 -2.16383 0.276
NP_442252.1_3 Reverse -259 -277 22.9303 0.0311
NP_440416.1_9 Reverse -259 -278 -11.9969 0.155
NP_440416.1_9 Reverse -306 -325 -18.5851 0.26
NP_443052.1_8 Reverse -256 -275 8.84924 0.023
NP_443052.1_8 Forward -285 -266 -11.7019 0.236
NP_440072.1_5 Forward -64 -46 -0.0791831 0.236
NP_442154.1_1 Forward -358 -340 -15.9105 0.228
NP_442154.1_1 Forward -331 -313 -17.9754 0.273
NP_440261.1_5 Reverse -267 -280 14.6706 0.0199
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGCGACACTAACGATAAACCCCGGTTGATGGAACGGGCCCTAGCGGAATTACCTCCGGCGGATAGTGTGTGGATGGTGGGGGACACCGAAGCGGATATTTTGGCGGCCCAGCGGGGCAATCTGCCGGCGATCGCTGTTTTGTCTGGCATTCGTAACCGGGAACAATTGGAACGTTATCAACCGGATTTTATTGTGGACAATTTAGCCGAAGCAGTGAATTTGTTTTACCAACACCATGGGGTTGAATAGGGATTAGTAGCAGTTGAATAAGTTTTGTGCCAACCCCTAGAAATCCAGTTCGCAAATCGTCCATACTAAATACTAGGGACTAACTAAGGCCCTGGTGGGGAGTGAAAATCAATAACACCAAAGCACCGAGTTGAGATCCTAGGAGCAAAAT

CDS

ATGATTACCGTCGCACGAAAAACTACCATAACCTTAGGGCTAATGGCGATCGCCGTTAGTTCAGTGTGGCCAGCCCAAGCCCAAATGATGACCGAAGAAAATCTTAATCCCTTGCCCCAATCGGAAGGCAGTGCGGCGGATTTGGCCGGTATTTTGCCCAAGGATAGTGCCCTTTGGCTGGGAGGCGTGGGGGGAGAAGGGGATATCGATGCCGAGGGAGACTATAGTCCCTACGAAATCCGTTCCGACCAATTTGAAGGACAACTAACGGAAATGGAGGAACAGCAGTTACTAGAAAGCTCCCAACTACGCTTGGGTGTTGGCAGATTCTAG

Protein

MITVARKTTITLGLMAIAVSSVWPAQAQMMTEENLNPLPQSEGSAADLAGILPKDSALWLGGVGGEGDIDAEGDYSPYEIRSDQFEGQLTEMEEQQLLESSQLRLGVGRF