Your browser is old and dusty. Try Google Chrome!

Details for slr0582

ORF slr0582
Accession NP_442433.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -332 -351 -0.688862 0.27
NP_440795.1_7 Forward -283 -276 10.2655 0.154
NP_440795.1_7 Reverse -220 -227 8.8889 0.188
NP_442100.1_1 Reverse -299 -318 8.54611 0.24
NP_441418.1_6 Reverse -85 -104 -29.5982 0.23
NP_441418.1_6 Forward -39 -20 -30.1882 0.262
NP_442291.1_5 Forward -229 -213 0.845183 0.158
NP_441453.1_4 Forward -228 -220 4.73931 0.252
NP_441453.1_4 Forward -386 -378 4.24765 0.259
NP_441623.1_1 Reverse -78 -96 7.09898 0.139
NP_440561.1_4 Reverse -27 -46 17.7819 0.132
NP_441818.1_9 Reverse -82 -101 -3.44213 0.226
NP_441630.1_3 Reverse -77 -96 3.83436 0.183
NP_442173.1_3 Forward -276 -266 15.8113 0.251
NP_442173.1_6 Forward -242 -228 12.9793 0.147
NP_442752.1_4 Reverse -377 -384 10.8555 0.0846
NP_442909.1_7 Forward -17 -3 7.3738 0.219
NP_442062.1_8 Forward -386 -376 6.37155 0.127
NP_441900.1_1 Forward -36 -17 12.5021 0.222
NP_441900.1_3 Forward -36 -19 15.6735 0.242
NP_440044.1_8 Reverse -378 -397 1.86774 0.161
NP_441208.1_9 Forward -128 -114 6.09611 0.253
NP_442742.1_9 Forward -218 -199 -13.5702 0.274
NP_440856.1_7 Reverse -123 -142 -9.047 0.282
NP_440209.1_1 Reverse -377 -385 5.13263 0.17
NP_441713.1_1 Reverse -371 -390 -15.3402 0.261
NP_441770.1_4 Forward -116 -97 -6.88371 0.228
NP_441716.1_1 Reverse -377 -391 10.4227 0.0956
NP_441624.1_7 Reverse -21 -35 7.9644 0.241
NP_441163.1_1 Forward -28 -11 3.87303 0.299
NP_440747.1_10 Reverse -374 -386 -12.2524 0.254
NP_440747.1_10 Forward -221 -209 -12.5474 0.297
NP_440747.1_10 Reverse -206 -218 -12.5474 0.297
NP_441854.1_10 Reverse -28 -47 0.58944 0.282
NP_441486.1_1 Reverse -216 -230 -4.62196 0.204
NP_442634.1_4 Reverse -375 -389 -4.03198 0.179
NP_440842.1_10 Forward -47 -33 13.0776 0.251
NP_441014.1_10 Forward -61 -42 -3.34455 0.298
NP_442848.1_4 Reverse -34 -48 6.78443 0.283
NP_443018.1_3 Reverse -378 -385 4.26735 0.267
NP_443018.1_3 Forward -385 -378 4.07068 0.299
NP_440376.1_1 Reverse -377 -386 6.48957 0.0963
NP_440376.1_1 Forward -386 -377 -0.0986038 0.285
NP_440376.1_1 Forward -283 -274 -0.295266 0.286
NP_442687.1_7 Reverse -376 -386 4.69992 0.238
NP_442687.1_7 Forward -95 -85 4.60159 0.243
NP_441846.1_10 Reverse -274 -293 -22.9117 0.271
NP_440781.1_1 Reverse -370 -384 11.8976 0.27
NP_440533.1_6 Forward -28 -9 8.45592 0.276
NP_442296.1_9 Reverse -220 -239 -4.42544 0.273
NP_442658.1_1 Reverse -375 -385 6.37109 0.231
NP_442658.1_1 Forward -37 -27 5.58445 0.262
NP_440656.1_8 Forward -397 -378 10.7175 0.0486
NP_440607.1_8 Forward -286 -267 0.196116 0.28
NP_441958.1_5 Forward -387 -377 1.65166 0.0872
NP_440984.1_7 Reverse -204 -218 10.3243 0.126
NP_442690.1_5 Forward -32 -13 21.5339 0.0689
NP_443055.1_6 Forward -53 -35 -0.571569 0.263
NP_440411.1_10 Forward -242 -223 15.5316 0.194
NP_442438.1_10 Reverse -372 -386 0.392915 0.229
NP_441000.1_6 Forward -387 -373 -4.03198 0.225
NP_442771.1_1 Reverse -378 -396 -4.79907 0.166
NP_441916.1_7 Reverse -377 -387 6.37155 0.0988
NP_440569.1_5 Forward -32 -13 11.7992 0.217
NP_442004.1_6 Reverse -377 -391 4.03116 0.227
NP_441725.1_4 Forward -212 -198 5.1122 0.278
NP_442941.1_3 Reverse -378 -388 0.373358 0.212
NP_440289.1_2 Forward -97 -84 -3.91395 0.273
NP_440983.1_5 Forward -358 -339 6.29264 0.178
NP_441678.1_6 Forward -133 -114 11.8975 0.235
NP_441566.1_3 Forward -23 -4 13.4708 0.241
NP_440177.1_9 Reverse -166 -185 10.7175 0.299
NP_440437.1_1 Forward -100 -81 5.30933 0.0881
NP_442012.1_1 Reverse -269 -288 1.37609 0.217
NP_441556.1_10 Forward -289 -275 14.2126 0.178
NP_442982.1_5 Forward -49 -30 -1.47551 0.266
NP_441644.1_6 Reverse -377 -387 13.0576 0.0244
NP_442215.1_2 Forward -286 -270 -6.23465 0.266
NP_442215.1_2 Reverse -368 -384 -6.82463 0.28
NP_442177.1_5 Forward -237 -223 8.84938 0.267
NP_442933.1_10 Reverse -377 -386 10.6195 0.0484
NP_442554.1_8 Reverse -378 -388 6.37155 0.12
NP_442554.1_8 Forward -385 -375 3.32329 0.23
NP_442142.1_4 Forward -389 -376 8.37683 0.116
NP_442142.1_4 Reverse -374 -387 3.46031 0.255
NP_442292.1_5 Forward -25 -6 -2.36049 0.29
NP_443009.1_5 Forward -387 -376 14.7094 0.02
NP_443009.1_5 Reverse -274 -285 8.61296 0.104
NP_443009.1_5 Reverse -58 -69 5.56471 0.197
NP_441468.1_1 Reverse -378 -385 3.97235 0.277
NP_441015.1_10 Forward -23 -4 -2.45882 0.178
NP_441015.1_10 Forward -29 -10 -11.3086 0.294
NP_441673.1_1 Forward -386 -377 1.27803 0.155
NP_441673.1_1 Reverse -377 -386 1.27803 0.155
NP_441731.1_3 Forward -134 -115 -0.688862 0.284
NP_441876.1_9 Forward -188 -178 11.8776 0.269
NP_442868.1_6 Reverse -273 -283 6.76487 0.101
NP_441612.1_2 Forward -392 -382 7.19391 0.26
NP_441612.1_2 Reverse -99 -109 7.09709 0.266
NP_441612.1_2 Reverse -209 -219 6.61303 0.283
NP_442808.1_1 Forward -387 -377 4.89613 0.185
NP_442808.1_1 Forward -210 -200 1.94622 0.281
NP_440145.1_3 Forward -228 -209 2.65439 0.115
NP_440145.1_3 Reverse -367 -386 -0.983855 0.145
NP_442820.1_3 Reverse -29 -39 14.8275 0.277
NP_441114.1_3 Forward -217 -208 7.86621 0.231
NP_440558.1_2 Forward -395 -376 -1.37718 0.214
NP_440558.1_2 Reverse -266 -285 -6.88371 0.283
NP_440558.1_2 Forward -216 -197 -7.57203 0.296
NP_441878.1_6 Reverse -376 -386 1.55333 0.0937
NP_441878.1_6 Forward -387 -377 -0.216628 0.169
NP_441036.1_8 Forward -285 -275 14.533 0.0219
NP_441036.1_8 Forward -19 -9 9.51814 0.174
NP_441534.1_1 Forward -110 -91 11.9958 0.13
NP_441557.1_5 Forward -386 -377 0.393051 0.166
NP_441557.1_5 Reverse -377 -386 0.393051 0.166
NP_441557.1_5 Forward -284 -275 -1.77023 0.299
NP_442066.2_4 Reverse -275 -294 -8.94866 0.296
NP_440738.1_5 Reverse -223 -242 6.98095 0.246
NP_442397.1_9 Reverse -219 -238 5.60432 0.246
NP_441574.1_1 Reverse -81 -100 -4.22878 0.252
NP_441549.1_9 Reverse -382 -400 -10.2073 0.273
NP_442347.1_2 Forward -189 -180 6.29291 0.175
NP_440547.1_8 Forward -257 -238 11.8975 0.298
NP_441037.1_4 Reverse -273 -283 13.0677 0.0753
NP_441633.1_3 Forward -286 -273 -4.20895 0.185
NP_440136.1_2 Forward -283 -276 4.26735 0.218
NP_442590.1_10 Reverse -370 -389 3.83436 0.283
NP_442998.1_5 Reverse -98 -108 12.1731 0.176
NP_442998.1_10 Forward -384 -377 6.13563 0.181
NP_440299.1_1 Forward -232 -219 3.16532 0.256
NP_440299.1_1 Forward -390 -377 2.96866 0.265
NP_441799.1_1 Forward -390 -376 9.34041 0.0942
NP_440256.1_1 Reverse -374 -393 -3.04881 0.126
NP_440256.1_1 Forward -389 -370 -3.44213 0.133
NP_440087.1_1 Forward -395 -376 -6.68705 0.256
NP_441559.1_8 Reverse -372 -386 -0.688726 0.179
NP_441559.1_8 Forward -288 -274 -4.81863 0.238
NP_440915.1_6 Reverse -373 -387 9.93102 0.0369
NP_441464.1_1 Forward -390 -371 9.63589 0.24
NP_441464.1_10 Forward -243 -229 13.4709 0.199
NP_441199.1_6 Reverse -376 -395 1.57275 0.214
NP_441494.1_6 Forward -155 -142 6.90245 0.272
NP_441340.1_9 Reverse -258 -268 8.93007 0.256
NP_441340.1_9 Forward -309 -299 8.06241 0.256
NP_440161.1_3 Reverse -57 -76 12.7825 0.168
NP_440161.1_3 Forward -388 -369 11.3075 0.217
NP_440161.1_3 Forward -38 -19 8.16093 0.276
NP_440586.1_8 Reverse -378 -385 7.70858 0.227
NP_441262.1_3 Reverse -377 -384 5.25066 0.215
NP_440027.1_3 Forward -45 -27 3.95163 0.263
NP_443051.1_1 Forward -387 -378 -0.000272808 0.245
NP_439937.1_9 Forward -387 -370 -9.89323 0.215
NP_439937.1_9 Reverse -10 -27 -12.1548 0.27
NP_442294.1_3 Reverse -341 -355 15.3386 0.213
NP_440439.1_1 Forward -389 -376 -0.767364 0.236
NP_439977.1_7 Forward -179 -160 12.29 0.262
NP_442384.1_10 Forward -218 -205 5.91914 0.116
NP_442384.1_10 Reverse -377 -390 5.42749 0.13
NP_442384.1_10 Forward -190 -177 1.78924 0.247
NP_442384.1_10 Reverse -30 -43 1.59258 0.253
NP_440344.1_10 Forward -335 -318 -10.1876 0.17
NP_440344.1_10 Forward -101 -84 -12.8425 0.267
NP_440282.1_10 Forward -396 -377 -6.88371 0.25
NP_442910.1_1 Reverse -268 -287 1.67108 0.129
NP_440297.1_9 Reverse -378 -388 -0.904945 0.298
NP_441896.1_5 Forward -240 -233 12.2322 0.273
NP_440894.1_10 Reverse -375 -394 2.75272 0.283
NP_440937.1_8 Reverse -85 -104 7.37428 0.264
NP_442067.1_4 Forward -295 -276 5.40766 0.236
NP_440999.1_5 Forward -67 -48 7.17681 0.291
NP_440888.1_2 Forward -386 -372 6.78381 0.22
NP_441759.1_2 Forward -394 -375 3.04771 0.166
NP_441543.1_2 Forward -385 -376 6.48957 0.145
NP_442845.1_2 Forward -234 -220 7.66941 0.195
NP_441469.1_8 Forward -285 -276 5.40793 0.272
NP_441469.1_8 Reverse -376 -385 5.11294 0.289
NP_442286.1_1 Forward -228 -209 11.1109 0.204
NP_441462.1_2 Reverse -377 -387 1.06167 0.103
NP_443062.1_6 Reverse -369 -388 0.687771 0.291
NP_442600.1_6 Reverse -364 -383 11.9958 0.291
NP_442487.1_5 Forward -387 -368 2.26028 0.3
NP_440516.1_8 Reverse -377 -386 5.89959 0.103
NP_442428.1_5 Reverse -378 -385 4.36568 0.271
NP_441068.1_1 Reverse -329 -348 18.4959 0.274
NP_441032.1_6 Forward -125 -106 12.0942 0.0936
NP_440783.1_3 Reverse -12 -31 3.04771 0.264
NP_441443.1_10 Forward -107 -89 1.19838 0.284
NP_441867.1_2 Reverse -193 -212 -14.4552 0.287
NP_440673.1_3 Forward -384 -377 11.6422 0.0724
NP_440673.1_3 Reverse -61 -68 10.5605 0.123
NP_441052.1_2 Forward -328 -318 5.28991 0.124
NP_441052.1_2 Forward -218 -208 3.22496 0.182
NP_442219.1_9 Forward -227 -218 5.80125 0.113
NP_440436.1_4 Forward -385 -376 11.9957 0.0435
NP_440436.1_4 Reverse -60 -69 7.47246 0.129
NP_442864.1_7 Reverse -123 -141 7.09898 0.274
NP_441004.1_1 Forward -29 -10 -11.2103 0.234
NP_441004.1_2 Reverse -89 -108 -4.6221 0.293
NP_442366.1_5 Reverse -272 -282 12.5659 0.118
NP_442873.1_5 Reverse -254 -273 8.16011 0.265
NP_440296.1_10 Reverse -123 -142 -15.4385 0.298
NP_441851.1_10 Reverse -274 -284 6.07655 0.187
NP_441851.1_10 Reverse -376 -386 4.79825 0.247
NP_442208.1_5 Forward -95 -76 -4.81876 0.259
NP_442622.1_1 Forward -40 -21 -2.75381 0.177
NP_441396.1_5 Reverse -175 -184 7.27622 0.29
NP_440463.1_8 Reverse -376 -395 7.30627 0.264
NP_441349.1_10 Forward -396 -377 -7.86702 0.261
NP_442314.1_2 Reverse -198 -217 1.96607 0.289
NP_442843.1_1 Forward -29 -10 -11.5053 0.291
NP_439960.1_10 Forward -31 -13 11.3272 0.0912
NP_441124.1_5 Forward -309 -299 12.1487 0.23
NP_442450.1_5 Reverse -273 -283 6.46988 0.174
NP_442168.1_5 Reverse -220 -239 -1.96717 0.264
NP_442168.1_5 Forward -283 -264 -3.93378 0.297
NP_440588.1_2 Reverse -266 -285 -3.24547 0.182
NP_442335.1_7 Forward -292 -278 15.3386 0.182
NP_442006.1_2 Reverse -42 -59 -15.3008 0.221
NP_442006.1_2 Reverse -115 -132 -16.7758 0.264
NP_441570.1_1 Reverse -377 -395 -8.14232 0.104
NP_440078.1_10 Reverse -275 -294 5.30933 0.226
NP_441078.1_4 Reverse -377 -386 7.57121 0.0591
NP_441078.1_4 Forward -218 -209 3.53964 0.136
NP_441078.1_4 Forward -386 -377 0.589713 0.174
NP_442729.1_7 Forward -236 -218 5.03403 0.297
NP_441528.1_2 Forward -112 -93 17.1082 0.0823
NP_441432.1_8 Reverse -318 -327 4.91628 0.196
NP_440313.1_5 Forward -102 -84 11.1298 0.28
NP_442797.1_7 Forward -101 -83 3.85406 0.234
NP_440199.1_10 Reverse -48 -58 7.64985 0.231
NP_440578.1_10 Reverse -378 -397 11.7992 0.246
NP_441945.1_10 Reverse -35 -54 14.7491 0.168
NP_441057.1_4 Reverse -165 -183 -1.84914 0.272
NP_439900.1_4 Reverse -7 -21 14.3553 0.217
NP_441072.1_2 Forward -239 -220 7.96426 0.246
NP_442489.1_7 Reverse -377 -386 8.06287 0.0371
NP_442489.1_7 Forward -386 -377 0.786375 0.152
NP_441659.2_8 Reverse -377 -387 7.84651 0.054
NP_441659.2_8 Forward -386 -376 0.373358 0.268
NP_441040.1_3 Forward -239 -220 7.7676 0.291
NP_439956.1_7 Reverse -371 -390 1.96607 0.276
NP_442346.1_5 Reverse -376 -386 6.8632 0.188
NP_442346.1_5 Forward -387 -377 5.38824 0.248
NP_440545.1_3 Reverse -271 -288 1.41547 0.119
NP_440545.1_3 Reverse -109 -126 -4.87771 0.235
NP_440545.1_3 Forward -390 -373 -7.04099 0.295
NP_441923.1_6 Forward -29 -15 8.45605 0.278
NP_441585.1_5 Reverse -20 -39 11.11 0.211
NP_440875.1_9 Forward -384 -374 12.9469 0.0911
NP_441813.1_5 Reverse -375 -385 -0.118297 0.234
NP_440590.1_4 Forward -385 -372 1.19926 0.13
NP_440590.1_4 Reverse -371 -384 -2.24233 0.239
NP_440567.1_1 Reverse -320 -334 0.491246 0.244
NP_442497.1_10 Forward -283 -274 0.688044 0.141
NP_441239.1_9 Forward -388 -376 6.03717 0.202
NP_441239.1_9 Reverse -375 -387 3.87389 0.272
NP_441239.1_9 Forward -286 -274 3.08724 0.296
NP_441951.1_6 Reverse -12 -31 18.4857 0.0721
NP_440665.1_2 Reverse -91 -110 10.7175 0.0715
NP_442138.1_10 Reverse -21 -40 -6.49039 0.285
NP_442809.1_6 Forward -80 -61 5.11266 0.256
NP_440546.1_4 Reverse -377 -387 10.9186 0.101
NP_442041.1_2 Reverse -35 -53 8.18062 0.293
NP_441497.1_3 Reverse -134 -153 -9.44032 0.294
NP_442402.1_4 Reverse -63 -82 -10.326 0.299
NP_441848.1_4 Forward -313 -297 11.0839 0.232
NP_441848.1_4 Forward -314 -298 6.97771 0.3
NP_441084.1_6 Forward -388 -374 9.63499 0.273
NP_441084.1_6 Reverse -57 -71 9.44108 0.282
NP_442039.1_4 Forward -227 -220 8.59391 0.193
NP_440505.1_3 Reverse -207 -217 6.76487 0.169
NP_440505.1_3 Reverse -375 -385 5.5849 0.222
NP_441959.1_5 Forward -113 -94 8.75091 0.212
NP_442471.1_1 Forward -338 -319 6.09597 0.29
NP_442532.1_7 Forward -20 -6 2.45787 0.24
NP_442533.1_6 Forward -386 -377 7.96454 0.0838
NP_442533.1_6 Reverse -377 -386 6.39124 0.111
NP_439944.1_9 Reverse -378 -388 13.2547 0.0649
NP_441028.1_6 Forward -105 -95 5.78111 0.243
NP_440115.1_6 Reverse -272 -282 5.38824 0.25
NP_439965.1_7 Reverse -364 -383 12.8504 0.287
NP_442673.1_5 Reverse -38 -56 12.3105 0.272
NP_441106.1_1 Forward -387 -378 5.3096 0.162
NP_441106.1_1 Reverse -376 -385 5.21127 0.167
NP_440480.1_2 Reverse -322 -336 20.2551 0.154
NP_001035870.1_3 Reverse -24 -43 -5.31042 0.279
NP_441286.1_1 Reverse -318 -330 -6.05754 0.245
NP_440670.1_8 Forward -386 -377 6.68623 0.105
NP_441705.1_3 Forward -346 -327 -0.885524 0.279
NP_440886.1_7 Reverse -376 -386 4.10949 0.253
NP_441753.1_10 Reverse -176 -195 0.982764 0.282
NP_442963.1_7 Reverse -82 -101 14.4541 0.204
NP_440907.2_8 Forward -283 -273 3.8145 0.297
NP_442615.1_1 Forward -237 -219 1.00246 0.0926
NP_441962.1_4 Forward -333 -314 -1.96717 0.127
NP_440114.1_10 Forward -94 -80 10.3243 0.148
NP_440114.1_10 Forward -386 -372 6.29277 0.276
NP_440114.1_10 Reverse -377 -391 5.80112 0.292
NP_441425.1_2 Forward -176 -157 13.4144 0.247
NP_441206.1_6 Reverse -37 -56 16.8141 0.232
NP_442743.1_1 Reverse -11 -30 10.6184 0.241
NP_440457.1_1 Reverse -373 -385 -0.74767 0.273
NP_442509.1_9 Forward -386 -376 6.46942 0.268
NP_442509.1_9 Forward -94 -84 6.27276 0.279
NP_441253.1_1 Reverse -20 -39 3.53937 0.297
NP_442514.1_5 Forward -53 -34 -2.95123 0.222
NP_441440.1_8 Forward -90 -77 15.0639 0.299
NP_440554.1_4 Forward -385 -375 4.0116 0.205
NP_441885.1_5 Reverse -219 -229 -1.10161 0.25
NP_442703.1_4 Reverse -219 -238 0.686995 0.287
NP_442341.1_9 Forward -286 -272 13.8636 0.0744
NP_441173.1_9 Forward -105 -97 12.0154 0.214
NP_441173.1_9 Reverse -18 -26 11.0321 0.228
NP_442932.1_9 Forward -24 -5 4.81767 0.276
NP_441307.1_4 Forward -254 -235 3.73603 0.218
NP_440216.1_1 Forward -386 -372 -1.77037 0.0383
NP_440216.1_1 Reverse -377 -391 -11.9968 0.236
NP_440172.1_1 Reverse -377 -387 4.99491 0.157
NP_440172.1_1 Reverse -85 -95 2.04498 0.286
NP_442015.1_10 Forward -129 -116 3.46087 0.182
NP_442015.1_10 Forward -288 -275 0.904263 0.216
NP_442834.1_10 Forward -125 -106 15.8307 0.0749
NP_441111.1_7 Forward -283 -275 -0.472234 0.131
NP_440244.1_1 Forward -242 -223 -9.53865 0.287
NP_441766.1_2 Forward -284 -275 3.24465 0.227
NP_440416.1_9 Forward -235 -216 -19.0768 0.269
NP_440416.1_9 Forward -300 -281 -20.4534 0.285
NP_443052.1_8 Reverse -41 -60 -10.522 0.21
NP_442116.1_6 Reverse -300 -317 6.64108 0.273
NP_440845.1_1 Forward -95 -76 -3.93378 0.206
NP_440261.1_5 Forward -217 -204 -4.9956 0.183
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGCAGGGCTAGGAAGACCATCGCCGGTCATAGAATCAGGGTAGCTGGTCAAAACAGCCACAGTATTTGGAGGCGTGATTGACACGATTAGTTATGAAAAATTCCTATTCCGCTCTCTGGGGTCGCCCAGCTAAAGTTGTCCTAGTGGCCCTAATTCTTGGTGGCTTGGGTTTAGCGATACCTAGCTATGCCCAGGAGACCCAAACTTACTACTGCTCCCCAACCGAAACATTGACAATTAAAATGGTGGAAGGATCTGCCATTCAGGTTACCCTGCCGGATGGTCGCACAGTGGTTTTACCCCAAGCGGAATCGGCCTCTGGGAATAAATACAGCAATGGTTTCATCACCGTTTGGTCCAAGGGCAACACTGCCTTGGTGGAAGAGGGCGGCAACGTTAA

CDS

ATGGCAGGATTGCGTCAAAATTTGATCATGTTCATCCCTTCAGAGGACATTAACGCCATGGTTACTACTTCCACCGATCAAACCCGGCGATCGCCTACTTTTTTGTTGGTAACTTTACTGAGTTTGTTAACTGCGGCGTTGGTGTTCTTTCCCGTGCTGGCCCAGGCGGGAGAAGAGGAAAATCCCAATAATCCCATGGGTTACGAAGATGCGGACCGGAAGGATTACGAAAATATGAATCAGGAAAATTATCAGGATTTAACTGACGAAAAATCCGTCGATGATAATAGCTTAGATTACGAACAAGACGATCAGTATGAGAATGACAACCAGTATGAATATGAAAATCAAGATGATGTAAAGTACCGCAATATGAACTAA

Protein

MAGLRQNLIMFIPSEDINAMVTTSTDQTRRSPTFLLVTLLSLLTAALVFFPVLAQAGEEENPNNPMGYEDADRKDYENMNQENYQDLTDEKSVDDNSLDYEQDDQYENDNQYEYENQDDVKYRNMN