Your browser is old and dusty. Try Google Chrome!

Details for slr0581

ORF slr0581
Accession NP_442432.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -307 -293 19.8624 0.0786
NP_441061.1_2 Forward -192 -178 2.16287 0.178
NP_441061.1_2 Reverse -185 -199 0.196253 0.215
NP_440557.1_1 Forward -192 -173 1.67108 0.252
NP_440557.1_1 Reverse -24 -43 -0.688862 0.27
NP_440795.1_7 Forward -192 -185 14.6904 0.0123
NP_440795.1_7 Reverse -185 -192 14.6904 0.0123
NP_441418.1_6 Forward -193 -174 -9.53865 0.0288
NP_441418.1_6 Reverse -184 -203 -9.93197 0.0301
NP_440815.1_5 Reverse -298 -317 3.04771 0.289
NP_442291.1_5 Reverse -183 -199 -4.66135 0.281
NP_440897.1_6 Forward -193 -174 9.43841 0.0705
NP_441453.1_1 Reverse -177 -195 13.3914 0.0938
NP_441453.1_4 Reverse -184 -192 16.539 0.00633
NP_441453.1_4 Forward -193 -185 16.539 0.00633
NP_441453.1_4 Forward -78 -70 4.24765 0.259
NP_441453.1_4 Reverse -298 -306 3.95266 0.275
NP_442151.1_6 Reverse -184 -198 17.2075 0.0113
NP_442151.1_6 Forward -193 -179 16.2242 0.0167
NP_441818.1_1 Reverse -185 -196 15.8894 0.0244
NP_441818.1_1 Reverse -299 -310 11.6612 0.169
NP_441818.1_9 Reverse -326 -345 -7.4737 0.272
NP_440226.1_1 Reverse -184 -203 10.1275 0.0654
NP_441630.1_3 Forward -201 -182 6.39097 0.126
NP_442173.1_1 Forward -192 -184 15.4574 0.00633
NP_442173.1_1 Reverse -185 -193 15.4574 0.00633
NP_442752.1_4 Forward -193 -186 13.8055 0.0199
NP_442752.1_4 Reverse -184 -191 13.8055 0.0199
NP_442752.1_4 Reverse -69 -76 10.8555 0.0846
NP_442752.1_4 Forward -307 -300 10.5605 0.1
NP_443027.1_4 Reverse -182 -192 16.2046 0.0437
NP_443027.1_4 Forward -195 -185 14.0414 0.0452
NP_443027.1_4 Reverse -296 -306 8.63316 0.197
NP_439997.1_4 Forward -185 -166 7.7676 0.261
NP_441812.1_3 Forward -194 -180 11.0127 0.215
NP_442975.1_10 Reverse -180 -194 13.077 0.0459
NP_442975.1_10 Forward -197 -183 12.192 0.0477
NP_440784.1_7 Forward -192 -185 15.9687 0.0123
NP_440784.1_7 Reverse -185 -192 15.9687 0.0123
NP_440784.1_7 Reverse -299 -306 8.59391 0.129
NP_442861.1_1 Forward -183 -164 9.43923 0.298
NP_441934.1_8 Forward -327 -308 13.0775 0.275
NP_440061.1_9 Reverse -182 -196 7.86545 0.189
NP_440110.1_4 Reverse -173 -192 5.211 0.173
NP_440110.1_8 Forward -195 -176 -0.885524 0.232
NP_441054.1_2 Forward -186 -167 16.9124 0.123
NP_441054.1_4 Forward -317 -299 -1.35749 0.198
NP_442062.1_8 Reverse -184 -194 17.3846 0.00193
NP_442062.1_8 Forward -193 -183 10.3048 0.0493
NP_442062.1_8 Forward -78 -68 6.37155 0.127
NP_440761.1_4 Reverse -179 -198 -13.6686 0.257
NP_441900.1_2 Reverse -141 -159 -3.71814 0.288
NP_440304.1_4 Reverse -182 -192 19.9412 0.00364
NP_440304.1_4 Forward -195 -185 10.8948 0.051
NP_442242.1_4 Forward -192 -185 14.3954 0.0124
NP_442242.1_4 Reverse -185 -192 14.3954 0.0124
NP_440044.1_8 Reverse -185 -204 5.11266 0.106
NP_440044.1_8 Reverse -70 -89 1.86774 0.161
NP_442207.1_4 Forward -313 -294 9.83255 0.285
NP_440011.1_1 Forward -195 -176 16.4207 0.153
NP_440916.1_1 Reverse -286 -300 20.7474 0.0296
NP_439918.1_3 Forward -196 -177 6.09597 0.264
NP_441208.1_9 Forward -399 -385 5.30946 0.271
NP_440132.1_1 Forward -195 -177 17.0304 0.0741
NP_442110.1_7 Forward -193 -179 12.586 0.0586
NP_442110.1_7 Reverse -184 -198 1.27789 0.233
NP_441925.1_4 Reverse -294 -313 -17.0125 0.287
NP_440856.1_4 Reverse -177 -196 -3.14714 0.226
NP_441083.1_5 Reverse -184 -194 20.3345 0.00053
NP_441083.1_5 Forward -193 -183 11.2881 0.0159
NP_442827.1_8 Forward -201 -182 17.5998 0.0295
NP_442827.1_8 Reverse -176 -195 -0.29631 0.224
NP_441434.1_6 Forward -180 -170 14.9263 0.277
NP_441738.1_2 Forward -191 -184 15.28 0.0102
NP_441738.1_2 Reverse -186 -193 15.28 0.0102
NP_441558.1_5 Reverse -182 -201 14.0608 0.0523
NP_440209.1_1 Reverse -184 -192 18.1123 0.00295
NP_440209.1_1 Forward -193 -185 18.1123 0.00295
NP_440209.1_1 Reverse -69 -77 5.13263 0.17
NP_442889.1_8 Reverse -181 -195 8.3571 0.123
NP_442889.1_8 Reverse -273 -287 3.24392 0.284
NP_441713.1_1 Reverse -178 -197 -15.3402 0.261
NP_441713.1_1 Reverse -63 -82 -15.3402 0.261
NP_441716.1_1 Forward -193 -179 12.8809 0.0689
NP_441716.1_1 Reverse -69 -83 10.4227 0.0956
NP_441716.1_1 Reverse -184 -198 4.32615 0.256
NP_442111.1_4 Forward -194 -180 20.3541 0.00311
NP_440906.1_5 Forward -192 -185 15.8704 0.0124
NP_440906.1_5 Reverse -185 -192 15.8704 0.0124
NP_440747.1_10 Reverse -181 -193 7.80712 0.00223
NP_440747.1_10 Forward -196 -184 7.4138 0.00422
NP_440747.1_10 Reverse -295 -307 -12.2524 0.254
NP_440747.1_10 Reverse -66 -78 -12.2524 0.254
NP_441130.1_10 Reverse -240 -254 4.81781 0.265
NP_441486.1_1 Forward -196 -182 3.8345 0.0534
NP_441486.1_1 Reverse -181 -195 3.24451 0.0638
NP_442634.1_4 Forward -195 -181 7.86607 0.0479
NP_442634.1_4 Reverse -182 -196 -2.16369 0.149
NP_442634.1_4 Reverse -67 -81 -4.03198 0.179
NP_442634.1_4 Forward -309 -295 -5.60527 0.264
NP_441265.1_3 Reverse -178 -192 4.52282 0.181
NP_441014.1_10 Reverse -183 -202 -2.16459 0.274
NP_441012.1_4 Reverse -180 -193 5.91914 0.286
NP_443018.1_3 Forward -192 -185 14.8871 0.0123
NP_443018.1_3 Reverse -185 -192 14.8871 0.0123
NP_443018.1_3 Reverse -70 -77 4.26735 0.267
NP_443018.1_3 Forward -77 -70 4.07068 0.299
NP_441316.1_7 Forward -195 -180 -1.69173 0.238
NP_440376.1_1 Forward -193 -184 19.4693 0.000692
NP_440376.1_1 Reverse -184 -193 19.4693 0.000692
NP_440376.1_1 Reverse -69 -78 6.48957 0.0963
NP_440376.1_1 Forward -78 -69 -0.0986038 0.285
NP_441588.1_4 Reverse -186 -196 6.37155 0.2
NP_442687.1_7 Reverse -183 -193 9.02648 0.0994
NP_442687.1_7 Forward -194 -184 8.92815 0.0994
NP_442687.1_7 Reverse -68 -78 4.69992 0.238
NP_442191.1_4 Forward -192 -178 18.8467 0.00666
NP_442485.1_3 Reverse -314 -333 0.786102 0.234
NP_441846.1_10 Reverse -326 -345 -20.5517 0.256
NP_441846.1_10 Forward -105 -86 -23.01 0.275
NP_440781.1_1 Reverse -62 -76 11.8976 0.27
NP_442583.1_8 Reverse -299 -318 10.2259 0.225
NP_440642.1_8 Reverse -186 -205 13.803 0.229
NP_441013.1_3 Forward -336 -317 5.89931 0.281
NP_441950.1_7 Forward -110 -91 -8.94866 0.287
NP_442658.1_1 Reverse -182 -192 13.0576 0.04
NP_442658.1_1 Forward -195 -185 6.76441 0.214
NP_442658.1_1 Reverse -67 -77 6.37109 0.231
NP_442198.1_3 Reverse -133 -152 4.32602 0.275
NP_442198.1_7 Forward -196 -177 8.94676 0.286
NP_442782.1_2 Forward -307 -293 5.89945 0.234
NP_442782.1_2 Forward -193 -179 1.67122 0.281
NP_440656.1_8 Forward -89 -70 10.7175 0.0486
NP_441414.1_9 Reverse -184 -203 -3.14714 0.13
NP_442937.1_5 Forward -312 -293 11.4058 0.14
NP_442937.1_5 Forward -104 -85 9.73422 0.183
NP_441958.1_5 Reverse -183 -193 21.2195 0.000805
NP_441958.1_5 Forward -194 -184 12.2714 0.00183
NP_441958.1_5 Forward -79 -69 1.65166 0.0872
NP_440203.1_5 Forward -190 -180 14.9258 0.0886
NP_439905.1_1 Forward -250 -237 7.39411 0.262
NP_440984.1_7 Forward -198 -184 9.83269 0.127
NP_439990.1_5 Reverse -179 -192 17.6205 0.0221
NP_442911.1_2 Forward -203 -184 -0.197208 0.0727
NP_442911.1_2 Reverse -174 -193 -9.24366 0.252
NP_440153.1_6 Forward -194 -175 15.4374 0.222
NP_440858.1_1 Reverse -210 -229 -5.80207 0.281
NP_443055.1_6 Forward -315 -297 -1.84987 0.284
NP_441099.1_5 Reverse -174 -193 -11.3086 0.276
NP_441099.1_6 Forward -297 -278 11.5042 0.282
NP_440809.1_9 Forward -202 -184 -7.749 0.225
NP_440809.1_9 Reverse -175 -193 -7.749 0.225
NP_441646.1_1 Reverse -291 -310 0.0977854 0.254
NP_442438.1_10 Forward -198 -184 1.47456 0.194
NP_442438.1_10 Reverse -179 -193 1.47456 0.194
NP_442438.1_10 Reverse -64 -78 0.392915 0.229
NP_442431.1_10 Forward -310 -292 0.117479 0.281
NP_441000.1_6 Forward -79 -65 -4.03198 0.225
NP_441000.1_6 Forward -335 -321 -4.7203 0.251
NP_442771.1_1 Reverse -70 -88 -4.79907 0.166
NP_442771.1_1 Forward -195 -177 -7.25734 0.17
NP_440147.1_4 Reverse -296 -309 12.0157 0.0326
NP_440147.1_4 Reverse -182 -195 3.65753 0.183
NP_440147.1_4 Forward -195 -182 1.49425 0.226
NP_441550.1_8 Reverse -182 -192 13.0576 0.0273
NP_441550.1_8 Forward -195 -185 12.3692 0.0336
NP_441916.1_7 Forward -193 -183 18.9579 0.00144
NP_441916.1_7 Reverse -184 -194 10.3048 0.0261
NP_441916.1_7 Reverse -69 -79 6.37155 0.0988
NP_441916.1_7 Forward -307 -297 3.81494 0.202
NP_441916.1_10 Forward -150 -131 2.45773 0.246
NP_441041.1_4 Forward -193 -174 0.491109 0.087
NP_441041.1_7 Reverse -181 -193 6.34865 0.211
NP_442396.1_5 Forward -197 -184 9.65572 0.129
NP_441547.1_2 Forward -396 -378 3.16574 0.289
NP_442004.1_6 Forward -193 -179 6.58777 0.171
NP_442004.1_6 Reverse -69 -83 4.03116 0.227
NP_441725.1_4 Reverse -179 -193 4.03056 0.278
NP_441725.1_5 Reverse -185 -195 11.2881 0.0247
NP_441725.1_5 Forward -192 -182 11.1898 0.0247
NP_439966.1_7 Forward -195 -185 15.8108 0.0124
NP_439966.1_7 Reverse -182 -192 14.8275 0.0177
NP_442941.1_3 Forward -192 -182 19.9412 0.00262
NP_442941.1_3 Reverse -185 -195 19.9412 0.00262
NP_442941.1_3 Reverse -70 -80 0.373358 0.212
NP_440289.1_2 Reverse -181 -194 3.85419 0.0735
NP_440289.1_2 Forward -196 -183 -3.02898 0.263
NP_440289.1_2 Forward -136 -123 -3.22564 0.267
NP_440983.1_5 Forward -50 -31 6.29264 0.178
NP_440983.1_5 Forward -130 -111 -4.52377 0.257
NP_440260.1_8 Forward -202 -184 -5.29072 0.273
NP_442281.1_1 Reverse -179 -193 8.84875 0.075
NP_442281.1_1 Forward -198 -184 8.55376 0.0798
NP_442281.1_1 Reverse -293 -307 8.16044 0.0845
NP_441334.1_7 Forward -195 -176 -18.9784 0.275
NP_440437.1_1 Reverse -178 -197 12.2908 0.0354
NP_440437.1_1 Reverse -292 -311 3.04771 0.127
NP_440437.1_5 Reverse -86 -105 13.0766 0.272
NP_441556.1_10 Reverse -143 -157 10.3192 0.27
NP_442982.1_5 Reverse -174 -193 -2.65548 0.287
NP_441644.1_6 Forward -193 -183 19.0557 0.000803
NP_441644.1_6 Reverse -184 -194 17.3841 0.00127
NP_441644.1_6 Reverse -69 -79 13.0576 0.0244
NP_441644.1_6 Reverse -298 -308 10.0093 0.0649
NP_442215.1_2 Forward -195 -179 -2.79306 0.204
NP_442215.1_2 Reverse -60 -76 -6.82463 0.28
NP_442029.1_6 Forward -198 -179 13.2741 0.141
NP_442029.1_6 Forward -312 -293 5.89931 0.248
NP_440253.1_2 Reverse -184 -202 3.06741 0.123
NP_440929.1_8 Forward -193 -184 19.2726 0.000701
NP_440929.1_8 Reverse -184 -193 19.2726 0.000701
NP_440780.1_1 Reverse -156 -175 6.92274 0.289
NP_442933.1_10 Forward -193 -184 17.601 0.00325
NP_442933.1_10 Reverse -184 -193 17.601 0.00325
NP_442933.1_10 Reverse -69 -78 10.6195 0.0484
NP_442933.1_10 Forward -307 -298 10.6195 0.0484
NP_441751.2_8 Forward -192 -178 6.3911 0.0354
NP_442554.1_8 Forward -192 -182 16.9913 0.0065
NP_442554.1_8 Reverse -185 -195 15.9097 0.00747
NP_442554.1_8 Reverse -299 -309 7.25653 0.0955
NP_442554.1_8 Reverse -70 -80 6.37155 0.12
NP_442554.1_8 Forward -77 -67 3.32329 0.23
NP_441762.1_7 Reverse -324 -336 -3.89426 0.14
NP_441762.1_7 Reverse -297 -309 -5.95921 0.258
NP_441762.1_7 Reverse -183 -195 -6.74586 0.284
NP_441762.1_7 Forward -194 -182 -6.94252 0.284
NP_442142.1_4 Reverse -181 -194 14.8666 0.0302
NP_442142.1_4 Forward -81 -68 8.37683 0.116
NP_442142.1_4 Forward -254 -241 7.78685 0.13
NP_442142.1_4 Forward -196 -183 6.80355 0.154
NP_442142.1_4 Reverse -295 -308 4.05029 0.234
NP_442142.1_4 Reverse -66 -79 3.46031 0.255
NP_442292.1_1 Reverse -185 -194 18.486 0.00229
NP_442292.1_1 Forward -192 -183 17.5026 0.00435
NP_442292.1_1 Reverse -299 -308 5.80125 0.129
NP_443009.1_5 Forward -79 -68 14.7094 0.02
NP_443009.1_5 Forward -194 -183 14.5128 0.02
NP_443009.1_5 Reverse -183 -194 10.1862 0.0792
NP_443009.1_5 Forward -308 -297 3.99143 0.268
NP_442408.2_1 Reverse -184 -203 -6.49039 0.282
NP_441715.1_4 Reverse -185 -195 14.828 0.0268
NP_441715.1_4 Forward -192 -182 14.238 0.0295
NP_441198.1_8 Reverse -182 -192 13.2713 0.108
NP_440379.1_5 Reverse -175 -194 -7.4737 0.245
NP_441468.1_1 Forward -192 -185 15.8704 0.0124
NP_441468.1_1 Reverse -185 -192 15.8704 0.0124
NP_441468.1_1 Forward -306 -299 4.26735 0.246
NP_441468.1_1 Reverse -70 -77 3.97235 0.277
NP_440920.1_1 Forward -308 -289 23.4022 0.00882
NP_440920.1_3 Forward -255 -236 24.8772 0.0164
NP_440920.1_8 Forward -216 -197 23.3039 0.0171
NP_441020.2_6 Forward -195 -178 8.20031 0.205
NP_441020.2_6 Reverse -182 -199 7.31533 0.235
NP_441015.1_8 Reverse -375 -394 0.392778 0.278
NP_441015.1_10 Forward -312 -293 18.7807 0.0218
NP_441015.1_10 Reverse -179 -198 -9.63698 0.282
NP_441015.1_10 Forward -162 -143 -11.0136 0.29
NP_441673.1_1 Forward -193 -184 20.8459 0.000698
NP_441673.1_1 Reverse -184 -193 20.8459 0.000698
NP_441673.1_1 Forward -78 -69 1.27803 0.155
NP_441673.1_1 Reverse -69 -78 1.27803 0.155
NP_441731.1_1 Forward -189 -171 15.9491 0.264
NP_441826.1_2 Forward -199 -185 -2.26202 0.269
NP_441826.1_2 Reverse -178 -192 -2.85201 0.277
NP_441826.1_2 Reverse -292 -306 -4.62196 0.298
NP_441330.1_1 Forward -198 -179 -13.3736 0.186
NP_442490.1_9 Forward -93 -74 -5.70374 0.273
NP_442868.1_6 Forward -195 -185 9.91146 0.038
NP_442868.1_6 Reverse -182 -192 1.06167 0.205
NP_441612.1_2 Reverse -184 -194 8.54929 0.21
NP_441612.1_2 Forward -84 -74 7.19391 0.26
NP_442227.1_2 Reverse -300 -319 -2.36049 0.272
NP_442361.1_3 Reverse -178 -191 10.1474 0.272
NP_442808.1_1 Reverse -183 -193 8.73102 0.0481
NP_442808.1_1 Forward -194 -184 8.63269 0.0481
NP_442808.1_1 Forward -79 -69 4.89613 0.185
NP_442808.1_1 Reverse -147 -157 4.10949 0.207
NP_440145.1_3 Reverse -59 -78 -0.983855 0.145
NP_440145.1_4 Reverse -299 -309 13.9425 0.264
NP_442050.1_5 Reverse -182 -192 18.0724 0.00365
NP_442050.1_5 Forward -195 -185 16.4991 0.00812
NP_442342.1_9 Forward -195 -179 3.79511 0.258
NP_440342.1_1 Forward -102 -83 10.1275 0.288
NP_440558.1_2 Reverse -175 -194 -1.37718 0.214
NP_440558.1_2 Forward -87 -68 -1.37718 0.214
NP_442789.1_4 Forward -195 -176 -8.26035 0.299
NP_441518.1_3 Forward -203 -184 -6.29373 0.134
NP_442792.1_6 Forward -315 -296 9.0459 0.187
NP_441878.1_6 Reverse -183 -193 10.5014 0.0176
NP_441878.1_6 Forward -194 -184 10.4031 0.0176
NP_441878.1_6 Reverse -68 -78 1.55333 0.0937
NP_441878.1_6 Forward -79 -69 -0.216628 0.169
NP_441878.1_10 Reverse -165 -179 11.0127 0.289
NP_441036.1_8 Reverse -183 -193 15.713 0.00724
NP_441036.1_8 Forward -194 -184 8.33817 0.174
NP_440614.1_1 Forward -180 -161 14.3558 0.178
NP_441557.1_5 Forward -193 -184 19.9609 0.000699
NP_441557.1_5 Reverse -184 -193 19.9609 0.000699
NP_441557.1_5 Forward -78 -69 0.393051 0.166
NP_441557.1_5 Reverse -69 -78 0.393051 0.166
NP_441557.1_5 Forward -307 -298 -0.885252 0.26
NP_441445.1_1 Forward -202 -183 1.76941 0.247
NP_442066.2_4 Forward -193 -174 -9.14533 0.296
NP_441433.1_8 Forward -192 -173 9.0459 0.159
NP_442419.1_2 Reverse -293 -312 -1.08219 0.246
NP_441308.1_8 Reverse -182 -192 13.353 0.218
NP_441458.1_10 Reverse -175 -194 5.99764 0.208
NP_442183.1_1 Forward -193 -179 9.04604 0.103
NP_442183.1_1 Reverse -184 -198 7.86607 0.131
NP_442166.1_7 Forward -192 -178 12.1926 0.176
NP_441549.1_9 Forward -197 -179 -5.68405 0.198
NP_441549.1_9 Reverse -74 -92 -10.2073 0.273
NP_442347.1_2 Reverse -185 -194 12.4878 0.056
NP_442347.1_2 Forward -192 -183 3.34298 0.284
NP_442888.1_9 Forward -346 -327 17.109 0.171
NP_441037.1_4 Reverse -182 -192 7.31769 0.237
NP_442594.1_8 Reverse -336 -355 5.60432 0.244
NP_442594.1_8 Forward -159 -140 2.0644 0.295
NP_442594.1_9 Forward -183 -164 9.43841 0.228
NP_441633.1_3 Reverse -296 -309 -3.32397 0.177
NP_441633.1_3 Forward -195 -182 -6.17557 0.238
NP_441633.1_3 Forward -345 -332 -6.86388 0.277
NP_440136.1_2 Forward -192 -185 15.9687 0.0123
NP_440136.1_2 Reverse -185 -192 15.9687 0.0123
NP_442590.1_10 Reverse -62 -81 3.83436 0.283
NP_442998.1_5 Forward -144 -134 9.12481 0.252
NP_442998.1_10 Forward -191 -184 15.5754 0.0102
NP_442998.1_10 Reverse -186 -193 15.5754 0.0102
NP_442998.1_10 Forward -76 -69 6.13563 0.181
NP_440731.1_2 Forward -319 -300 5.01433 0.293
NP_440899.1_2 Reverse -173 -192 6.88182 0.25
NP_440299.1_1 Reverse -180 -193 13.195 0.0319
NP_440299.1_1 Forward -197 -184 13.0967 0.0319
NP_440299.1_1 Reverse -294 -307 3.85363 0.228
NP_440299.1_1 Forward -82 -69 2.96866 0.265
NP_441799.1_1 Forward -197 -183 11.012 0.0629
NP_441799.1_1 Forward -82 -68 9.34041 0.0942
NP_441799.1_1 Reverse -180 -194 6.48882 0.17
NP_442802.1_6 Forward -115 -96 1.27776 0.204
NP_442802.1_6 Reverse -183 -202 -0.39387 0.204
NP_441007.1_10 Forward -312 -299 1.69091 0.203
NP_441007.1_10 Forward -198 -185 -0.767364 0.293
NP_442201.1_10 Forward -204 -185 -13.3736 0.274
NP_440256.1_1 Reverse -181 -200 17.0107 0.00566
NP_440256.1_1 Forward -196 -177 -0.4922 0.0936
NP_440256.1_1 Reverse -66 -85 -3.04881 0.126
NP_440256.1_1 Forward -81 -62 -3.44213 0.133
NP_441957.1_10 Forward -155 -136 13.5691 0.263
NP_440087.1_1 Forward -87 -68 -6.68705 0.256
NP_441559.1_8 Reverse -179 -193 10.7177 0.0574
NP_441559.1_8 Reverse -64 -78 -0.688726 0.179
NP_440915.1_6 Reverse -65 -79 9.93102 0.0369
NP_440915.1_6 Reverse -180 -194 3.8345 0.1
NP_440915.1_6 Forward -197 -183 3.04785 0.109
NP_440915.1_6 Reverse -230 -244 -0.393733 0.193
NP_441704.1_8 Forward -204 -185 13.47 0.112
NP_441704.1_8 Reverse -173 -192 12.0933 0.122
NP_442452.1_1 Reverse -293 -312 10.1275 0.131
NP_442452.1_8 Reverse -178 -192 15.0436 0.273
NP_441464.1_1 Forward -82 -63 9.63589 0.24
NP_441464.1_10 Forward -305 -291 11.5043 0.22
NP_441939.1_3 Forward -192 -173 5.11266 0.288
NP_441199.1_6 Reverse -68 -87 1.57275 0.214
NP_442993.1_1 Forward -193 -177 -9.47957 0.186
NP_440677.1_1 Reverse -175 -194 6.29264 0.275
NP_440677.1_6 Reverse -175 -194 12.3892 0.196
NP_442386.1_9 Forward -194 -185 13.8639 0.0289
NP_442386.1_9 Reverse -183 -192 6.39082 0.219
NP_442386.1_9 Reverse -297 -306 5.70251 0.241
NP_441750.1_4 Reverse -180 -199 6.78429 0.159
NP_441750.1_7 Forward -304 -294 13.353 0.267
NP_441340.1_5 Forward -192 -185 15.6737 0.0124
NP_441340.1_5 Reverse -185 -192 15.6737 0.0124
NP_441947.1_4 Reverse -173 -192 15.5357 0.147
NP_441947.1_10 Forward -195 -177 8.67227 0.182
NP_440168.1_9 Forward -309 -290 -0.983855 0.273
NP_442240.1_2 Forward -306 -287 -13.7669 0.173
NP_440161.1_3 Forward -80 -61 11.3075 0.217
NP_440586.1_8 Forward -192 -185 13.2151 0.026
NP_440586.1_8 Reverse -185 -192 13.2151 0.026
NP_440586.1_8 Reverse -299 -306 9.28187 0.164
NP_440586.1_8 Reverse -70 -77 7.70858 0.227
NP_442251.1_6 Forward -192 -185 15.2804 0.0124
NP_442251.1_6 Reverse -185 -192 15.2804 0.0124
NP_441262.1_3 Reverse -184 -191 14.7888 0.0223
NP_441262.1_3 Forward -193 -186 14.7888 0.0223
NP_441262.1_3 Reverse -69 -76 5.25066 0.215
NP_443051.1_1 Reverse -183 -192 19.5676 0.00335
NP_443051.1_1 Forward -194 -185 10.4228 0.00754
NP_443051.1_1 Forward -79 -70 -0.000272808 0.245
NP_439937.1_9 Forward -79 -62 -9.89323 0.215
NP_442294.1_3 Reverse -33 -47 15.3386 0.213
NP_442294.1_3 Forward -400 -386 13.7653 0.252
NP_440439.1_1 Reverse -181 -194 9.06573 0.0475
NP_440439.1_1 Forward -196 -183 -0.275709 0.211
NP_440439.1_1 Forward -81 -68 -0.767364 0.236
NP_439943.1_1 Forward -373 -354 -6.68705 0.237
NP_440372.1_2 Forward -192 -185 16.3621 0.0124
NP_440372.1_2 Reverse -185 -192 16.3621 0.0124
NP_440171.1_3 Forward -310 -291 4.22769 0.284
NP_441789.1_7 Forward -345 -326 -3.83621 0.28
NP_440819.1_5 Forward -145 -137 17.424 0.185
NP_440819.1_5 Reverse -386 -394 7.59091 0.272
NP_441803.1_2 Forward -221 -202 2.0644 0.22
NP_439977.1_5 Reverse -178 -197 -0.0988766 0.217
NP_440139.1_1 Forward -199 -180 6.88182 0.139
NP_440139.1_1 Forward -257 -238 0.490334 0.291
NP_440210.1_8 Forward -341 -325 8.31834 0.274
NP_442384.1_10 Forward -193 -180 15.4572 0.00986
NP_442384.1_10 Reverse -184 -197 8.77074 0.0608
NP_442384.1_10 Forward -307 -294 7.49244 0.0807
NP_442384.1_10 Reverse -69 -82 5.42749 0.13
NP_442790.1_3 Forward -174 -155 7.57094 0.233
NP_442262.1_10 Forward -192 -185 14.1988 0.0123
NP_442262.1_10 Reverse -185 -192 14.1988 0.0123
NP_441689.1_5 Reverse -182 -192 17.8758 0.0158
NP_441689.1_5 Forward -195 -185 15.3192 0.0403
NP_440163.1_10 Forward -196 -186 10.4031 0.201
NP_440163.1_10 Reverse -328 -338 9.81313 0.222
NP_440344.1_10 Reverse -177 -194 8.69197 0.0101
NP_440344.1_10 Forward -27 -10 -10.1876 0.17
NP_440282.1_10 Forward -203 -184 -6.39206 0.25
NP_440282.1_10 Forward -88 -69 -6.88371 0.25
NP_440531.1_8 Forward -312 -293 1.96607 0.298
NP_441965.1_10 Forward -196 -180 8.80999 0.123
NP_441965.1_10 Forward -310 -294 3.40179 0.265
NP_441640.1_1 Forward -312 -293 5.01433 0.273
NP_440297.1_9 Reverse -185 -195 9.32148 0.0917
NP_440297.1_9 Forward -192 -182 9.22315 0.0917
NP_440297.1_9 Reverse -70 -80 -0.904945 0.298
NP_440894.1_10 Reverse -67 -86 2.75272 0.283
NP_440999.1_9 Reverse -294 -308 8.45605 0.075
NP_440999.1_9 Reverse -180 -194 3.44117 0.13
NP_440888.1_2 Reverse -184 -198 18.4851 0.00237
NP_440888.1_2 Forward -193 -179 14.9452 0.0137
NP_440888.1_2 Forward -78 -64 6.78381 0.22
NP_440888.1_2 Reverse -298 -312 5.89884 0.258
NP_440600.1_4 Forward -201 -183 -2.0458 0.183
NP_441748.1_9 Reverse -130 -149 10.4217 0.185
NP_442277.1_4 Reverse -139 -158 5.40686 0.175
NP_442277.1_4 Reverse -289 -308 3.83357 0.213
NP_441759.1_2 Forward -86 -67 3.04771 0.166
NP_441543.1_2 Reverse -185 -194 16.9127 0.00359
NP_441543.1_2 Forward -192 -183 15.9293 0.00518
NP_441543.1_2 Reverse -299 -308 11.6028 0.0504
NP_441543.1_2 Forward -77 -68 6.48957 0.145
NP_442845.1_2 Forward -199 -185 6.29277 0.212
NP_442845.1_2 Reverse -178 -192 4.03116 0.271
NP_442845.1_2 Forward -313 -299 3.8345 0.275
NP_441551.1_5 Forward -197 -181 7.43266 0.247
NP_441469.1_8 Reverse -183 -192 6.5879 0.227
NP_441469.1_8 Forward -194 -185 6.48957 0.227
NP_441469.1_8 Reverse -68 -77 5.11294 0.289
NP_443064.1_6 Reverse -184 -194 12.5669 0.0796
NP_443064.1_6 Forward -193 -183 10.8217 0.13
NP_442578.1_7 Forward -192 -185 14.5921 0.026
NP_442578.1_7 Reverse -185 -192 14.5921 0.026
NP_440710.1_1 Forward -201 -183 -8.83064 0.282
NP_441462.1_2 Forward -193 -183 20.2362 0.000805
NP_441462.1_2 Reverse -184 -194 11.5831 0.00406
NP_441462.1_2 Reverse -69 -79 1.06167 0.103
NP_441621.1_7 Reverse -323 -337 -3.54032 0.19
NP_441621.1_7 Forward -195 -181 -5.21195 0.248
NP_443062.1_6 Reverse -61 -80 0.687771 0.291
NP_441601.1_4 Forward -338 -319 -3.73712 0.293
NP_442204.1_1 Reverse -180 -191 19.2332 0.0136
NP_442204.1_2 Forward -203 -184 5.70265 0.295
NP_442600.1_6 Reverse -56 -75 11.9958 0.291
NP_441351.1_8 Reverse -277 -296 5.50599 0.202
NP_442487.1_5 Forward -79 -60 2.26028 0.3
NP_440516.1_8 Forward -193 -184 16.9127 0.00442
NP_440516.1_8 Reverse -184 -193 16.9127 0.00442
NP_440516.1_8 Reverse -69 -78 5.89959 0.103
NP_442428.1_5 Forward -192 -185 15.8704 0.0124
NP_442428.1_5 Reverse -185 -192 15.8704 0.0124
NP_442428.1_5 Forward -306 -299 11.4455 0.062
NP_442428.1_5 Reverse -70 -77 4.36568 0.271
NP_441068.1_1 Reverse -21 -40 18.4959 0.274
NP_440618.1_1 Forward -148 -129 -4.81876 0.213
NP_442120.1_10 Reverse -163 -182 -15.6352 0.294
NP_440673.1_2 Forward -203 -184 10.3896 0.212
NP_440673.1_3 Forward -191 -184 12.4288 0.0426
NP_440673.1_3 Reverse -186 -193 12.4288 0.0426
NP_440673.1_3 Forward -76 -69 11.6422 0.0724
NP_440673.1_3 Forward -249 -242 9.67555 0.179
NP_440865.1_9 Forward -313 -294 -7.57203 0.247
NP_441052.1_2 Reverse -184 -194 19.9412 0.00106
NP_441052.1_2 Forward -193 -183 10.4031 0.0285
NP_441052.1_2 Reverse -298 -308 5.38824 0.12
NP_441052.1_2 Forward -20 -10 5.28991 0.124
NP_442219.1_9 Reverse -185 -194 17.7976 0.00718
NP_442219.1_9 Forward -192 -183 8.25953 0.0681
NP_440436.1_4 Reverse -185 -194 17.2072 0.00233
NP_440436.1_4 Forward -77 -68 11.9957 0.0435
NP_440436.1_4 Forward -192 -183 9.24241 0.0871
NP_440436.1_4 Reverse -299 -308 4.7192 0.244
NP_441884.1_9 Reverse -181 -200 -22.0267 0.275
NP_442864.1_3 Forward -199 -180 9.43923 0.203
NP_440648.1_1 Forward -193 -174 4.32602 0.226
NP_440041.1_2 Forward -195 -176 -4.72043 0.293
NP_442907.1_2 Reverse -299 -317 14.0805 0.169
NP_441719.1_4 Forward -192 -185 16.3621 0.0124
NP_441719.1_4 Reverse -185 -192 16.3621 0.0124
NP_441733.1_10 Reverse -231 -244 3.75586 0.288
NP_441004.1_1 Forward -313 -294 -11.6036 0.24
NP_442366.1_3 Forward -194 -176 4.9357 0.0899
NP_442694.1_4 Forward -398 -389 13.8644 0.217
NP_442206.1_10 Forward -193 -178 6.37141 0.178
NP_443054.1_2 Reverse -362 -376 2.16287 0.245
NP_441851.1_10 Forward -194 -184 15.8113 0.00552
NP_441851.1_10 Reverse -183 -193 8.53483 0.114
NP_441851.1_10 Forward -308 -298 6.17489 0.182
NP_441851.1_10 Reverse -68 -78 4.79825 0.247
NP_442208.1_5 Forward -309 -290 -9.83364 0.295
NP_440611.1_6 Reverse -149 -168 14.8474 0.112
NP_442856.1_7 Reverse -289 -308 -0.295539 0.207
NP_442515.1_1 Reverse -183 -197 10.1277 0.0563
NP_442515.1_1 Forward -194 -180 -4.91696 0.298
NP_441982.1_6 Reverse -217 -226 12.6763 0.274
NP_440463.1_8 Reverse -68 -87 7.30627 0.264
NP_441046.1_2 Reverse -353 -372 -0.000545616 0.275
NP_440940.1_7 Reverse -174 -192 3.36165 0.274
NP_441349.1_10 Forward -203 -184 -5.60541 0.207
NP_441349.1_10 Forward -88 -69 -7.86702 0.261
NP_442024.1_9 Forward -236 -223 17.3255 0.182
NP_441409.1_6 Reverse -178 -197 10.7175 0.024
NP_440432.1_9 Reverse -185 -200 8.92802 0.0427
NP_442843.1_1 Forward -186 -167 -9.14533 0.264
NP_440474.1_1 Forward -268 -249 16.5182 0.144
NP_440474.1_8 Reverse -185 -199 4.91554 0.263
NP_442450.1_5 Reverse -182 -192 9.41981 0.115
NP_442450.1_5 Forward -195 -185 9.32148 0.115
NP_440588.1_2 Reverse -175 -194 -2.36049 0.164
NP_442006.1_2 Forward -166 -149 -15.1041 0.215
NP_441570.1_1 Reverse -184 -202 8.47561 0.0138
NP_441570.1_1 Forward -193 -175 1.10079 0.0331
NP_441570.1_1 Reverse -69 -87 -8.14232 0.104
NP_441078.1_4 Forward -193 -184 19.6659 0.0007
NP_441078.1_4 Reverse -184 -193 19.6659 0.0007
NP_441078.1_4 Reverse -69 -78 7.57121 0.0591
NP_441078.1_4 Forward -78 -69 0.589713 0.174
NP_442729.1_8 Forward -197 -184 10.1474 0.125
NP_442388.1_4 Reverse -294 -313 12.4867 0.23
NP_441528.1_5 Reverse -290 -304 20.5501 0.0856
NP_440526.1_3 Reverse -299 -310 11.0712 0.0646
NP_440526.1_3 Reverse -185 -196 0.943182 0.267
NP_441432.1_8 Reverse -183 -192 16.8143 0.00595
NP_441432.1_8 Forward -194 -185 16.8143 0.00595
NP_441432.1_8 Reverse -10 -19 4.91628 0.196
NP_441432.1_8 Forward -308 -299 4.22796 0.235
NP_442320.1_8 Forward -199 -185 11.8976 0.0175
NP_442320.1_8 Forward -313 -299 5.1128 0.0437
NP_442344.1_7 Reverse -185 -204 -8.35868 0.211
NP_441732.1_2 Reverse -180 -196 11.4649 0.00863
NP_441732.1_2 Forward -220 -204 -8.20127 0.124
NP_440313.1_1 Reverse -155 -174 15.4374 0.237
NP_442797.1_7 Reverse -177 -195 3.3624 0.234
NP_440199.1_10 Forward -196 -186 7.64985 0.231
NP_440578.1_10 Reverse -70 -89 11.7992 0.246
NP_440461.1_3 Forward -161 -142 17.5024 0.145
NP_440713.1_4 Reverse -174 -193 10.3242 0.13
NP_442489.1_2 Reverse -179 -198 0.58944 0.297
NP_442489.1_7 Forward -193 -184 20.1576 0.000695
NP_442489.1_7 Reverse -184 -193 20.1576 0.000695
NP_442489.1_7 Reverse -69 -78 8.06287 0.0371
NP_442489.1_7 Forward -78 -69 0.786375 0.152
NP_442489.1_7 Forward -307 -298 -1.77023 0.247
NP_440565.1_7 Forward -186 -167 1.0811 0.246
NP_442079.1_6 Reverse -176 -195 17.0107 0.244
NP_442079.1_7 Forward -192 -173 4.71934 0.187
NP_442079.1_7 Reverse -185 -204 1.37609 0.253
NP_440559.1_1 Reverse -185 -194 17.4043 0.00658
NP_440559.1_1 Forward -192 -183 8.65285 0.0586
NP_441659.2_8 Forward -193 -183 20.9245 0.000805
NP_441659.2_8 Reverse -184 -194 18.1713 0.00133
NP_441659.2_8 Reverse -69 -79 7.84651 0.054
NP_441659.2_8 Reverse -298 -308 4.10993 0.144
NP_441659.2_8 Forward -78 -68 0.373358 0.268
NP_442749.1_5 Reverse -234 -251 9.47698 0.21
NP_439956.1_7 Reverse -63 -82 1.96607 0.276
NP_442346.1_5 Forward -194 -184 16.6963 0.00248
NP_442346.1_5 Reverse -183 -193 16.303 0.00248
NP_442346.1_5 Forward -308 -298 10.9931 0.078
NP_442346.1_5 Reverse -68 -78 6.8632 0.188
NP_442346.1_5 Forward -79 -69 5.38824 0.248
NP_440352.1_5 Forward -305 -286 19.4693 0.0454
NP_440352.1_5 Forward -191 -172 10.6116 0.27
NP_440545.1_3 Forward -197 -180 3.97208 0.0764
NP_440545.1_3 Forward -82 -65 -7.04099 0.295
NP_441856.1_3 Forward -196 -177 3.24438 0.185
NP_441629.1_3 Forward -200 -181 -0.492971 0.245
NP_440555.1_1 Reverse -173 -192 1.47442 0.294
NP_441653.1_2 Forward -204 -185 3.23971 0.274
NP_440010.1_1 Forward -309 -290 17.7974 0.0775
NP_440010.1_10 Forward -205 -186 8.84924 0.213
NP_442603.1_7 Reverse -184 -198 12.0937 0.106
NP_442603.1_7 Forward -193 -179 10.5204 0.125
NP_441888.1_7 Reverse -293 -307 3.63784 0.225
NP_441948.1_4 Reverse -226 -244 -4.99573 0.25
NP_441948.1_4 Forward -200 -182 -5.38906 0.264
NP_441833.1_4 Forward -192 -185 15.9687 0.0124
NP_441833.1_4 Reverse -185 -192 15.9687 0.0124
NP_441112.1_6 Reverse -174 -193 -4.6221 0.297
NP_442699.1_8 Forward -303 -284 -11.5053 0.238
NP_442162.1_9 Forward -192 -185 16.2637 0.0124
NP_442162.1_9 Reverse -185 -192 16.2637 0.0124
NP_440671.1_4 Reverse -178 -192 10.1277 0.164
NP_440671.1_4 Reverse -325 -339 9.2427 0.184
NP_442140.1_3 Reverse -185 -195 4.40493 0.243
NP_442021.1_3 Forward -199 -180 -6.58872 0.257
NP_440875.1_9 Forward -76 -66 12.9469 0.0911
NP_440875.1_9 Forward -305 -295 9.44274 0.233
NP_440875.1_9 Forward -191 -181 8.27469 0.233
NP_441813.1_5 Reverse -182 -192 15.9097 0.01
NP_441813.1_5 Forward -195 -185 15.9097 0.01
NP_441813.1_5 Reverse -67 -77 -0.118297 0.234
NP_440073.1_6 Reverse -334 -353 18.584 0.155
NP_440590.1_4 Forward -77 -64 1.19926 0.13
NP_440590.1_4 Reverse -185 -198 1.00259 0.136
NP_440590.1_4 Reverse -63 -76 -2.24233 0.239
NP_440590.1_4 Forward -192 -179 -2.24233 0.239
NP_440567.1_1 Reverse -185 -199 5.30946 0.104
NP_440567.1_1 Forward -192 -178 5.01447 0.108
NP_440567.1_1 Reverse -12 -26 0.491246 0.244
NP_442497.1_10 Forward -192 -183 17.601 0.00813
NP_442497.1_10 Reverse -185 -194 10.4228 0.0087
NP_440821.1_4 Forward -195 -185 18.2696 0.00448
NP_440821.1_4 Reverse -182 -192 11.0914 0.0146
NP_441239.1_9 Reverse -182 -194 12.1337 0.0494
NP_441239.1_9 Forward -80 -68 6.03717 0.202
NP_441239.1_9 Reverse -240 -252 5.25052 0.223
NP_441239.1_9 Forward -195 -183 4.36554 0.253
NP_441239.1_9 Reverse -67 -79 3.87389 0.272
NP_441239.1_9 Reverse -296 -308 3.48056 0.285
NP_441009.1_4 Forward -193 -174 10.0292 0.285
NP_441892.1_1 Reverse -175 -192 -0.256152 0.181
NP_441892.1_1 Reverse -240 -257 -5.07437 0.273
NP_440604.1_6 Forward -193 -174 5.70265 0.115
NP_442643.1_1 Forward -199 -180 -10.4236 0.231
NP_442138.1_10 Reverse -184 -203 2.0644 0.12
NP_442809.1_6 Reverse -325 -344 0.58944 0.288
NP_440546.1_4 Forward -193 -183 13.5365 0.0459
NP_440546.1_4 Reverse -69 -79 10.9186 0.101
NP_440546.1_4 Reverse -184 -194 10.046 0.109
NP_441230.1_6 Reverse -212 -231 15.5357 0.175
NP_440675.1_1 Forward -196 -177 5.70265 0.213
NP_440462.1_6 Reverse -182 -192 16.893 0.00853
NP_440462.1_6 Forward -195 -185 7.74818 0.0699
NP_442611.1_1 Forward -193 -174 -3.04881 0.297
NP_440868.1_4 Reverse -180 -192 6.1355 0.0878
NP_440868.1_4 Forward -197 -185 5.84051 0.0879
NP_441848.1_4 Forward -150 -134 6.97771 0.3
NP_441084.1_6 Reverse -182 -196 12.8346 0.152
NP_441084.1_6 Forward -80 -66 9.63499 0.273
NP_440653.1_10 Reverse -185 -204 4.12936 0.252
NP_441843.2_9 Reverse -186 -204 13.1181 0.205
NP_442039.1_4 Forward -192 -185 15.1821 0.0124
NP_442039.1_4 Reverse -185 -192 15.1821 0.0124
NP_442039.1_7 Reverse -215 -225 15.3197 0.211
NP_441180.1_8 Reverse -233 -251 13.0964 0.0952
NP_442837.1_3 Forward -192 -185 15.7721 0.0124
NP_442837.1_3 Reverse -185 -192 15.7721 0.0124
NP_442053.1_1 Forward -193 -184 18.3876 0.0007
NP_442053.1_1 Reverse -184 -193 18.3876 0.0007
NP_440505.1_3 Forward -195 -185 16.303 0.00696
NP_440505.1_3 Reverse -182 -192 15.123 0.014
NP_440505.1_3 Reverse -67 -77 5.5849 0.222
NP_440351.1_8 Reverse -321 -339 7.59063 0.244
NP_441102.1_10 Reverse -201 -220 10.1275 0.193
NP_441203.1_1 Forward -192 -173 -12.8819 0.146
NP_441203.1_1 Reverse -185 -204 -14.7502 0.202
NP_440308.1_6 Reverse -325 -344 0.392778 0.296
NP_442471.1_1 Forward -30 -11 6.09597 0.29
NP_440914.1_1 Reverse -184 -194 17.5935 0.000537
NP_440914.1_1 Forward -193 -183 16.3248 0.00196
NP_441011.1_8 Forward -192 -183 16.6177 0.00602
NP_441011.1_8 Forward -306 -297 11.8978 0.0614
NP_441011.1_8 Forward -333 -324 8.35786 0.144
NP_441011.1_8 Reverse -185 -194 8.25953 0.144
NP_442101.1_10 Forward -201 -182 -5.99873 0.181
NP_442101.1_10 Reverse -176 -195 -7.17871 0.209
NP_442533.1_1 Forward -312 -293 -6.78538 0.182
NP_442533.1_1 Forward -196 -177 -15.7335 0.257
NP_442533.1_6 Forward -193 -184 17.2076 0.00137
NP_442533.1_6 Reverse -184 -193 17.2076 0.00137
NP_442533.1_6 Forward -78 -69 7.96454 0.0838
NP_442533.1_6 Reverse -69 -78 6.39124 0.111
NP_442533.1_6 Reverse -298 -307 5.21127 0.15
NP_442533.1_6 Forward -307 -298 4.32629 0.184
NP_441482.1_7 Reverse -178 -192 8.16106 0.0189
NP_441482.1_7 Forward -199 -185 -11.0135 0.229
NP_439944.1_9 Reverse -185 -195 19.0562 0.00329
NP_439944.1_9 Forward -192 -182 17.6796 0.00347
NP_439944.1_9 Reverse -70 -80 13.2547 0.0649
NP_441028.1_6 Reverse -136 -146 4.7978 0.277
NP_440116.1_8 Reverse -185 -204 -5.31042 0.19
NP_441527.1_4 Forward -150 -131 -13.0351 0.298
NP_440115.1_6 Reverse -181 -191 7.45319 0.147
NP_440007.1_9 Reverse -180 -194 11.996 0.163
NP_439965.1_7 Reverse -56 -75 12.8504 0.287
NP_441059.1_2 Reverse -354 -373 0.196116 0.242
NP_441972.1_5 Reverse -299 -318 1.47442 0.135
NP_441972.1_5 Reverse -185 -204 -2.0655 0.178
NP_441106.1_1 Reverse -183 -192 18.486 0.0028
NP_441106.1_1 Forward -194 -185 9.63616 0.0311
NP_441106.1_1 Forward -79 -70 5.3096 0.162
NP_441106.1_1 Reverse -68 -77 5.21127 0.167
NP_440480.1_2 Reverse -14 -28 20.2551 0.154
NP_439903.1_6 Forward -196 -177 6.58682 0.167
NP_439903.1_6 Reverse -181 -200 6.1935 0.172
NP_439903.1_6 Reverse -93 -112 -1.27961 0.295
NP_442306.1_10 Forward -214 -195 -15.3402 0.197
NP_442306.1_10 Reverse -179 -198 -19.3717 0.197
NP_441286.1_1 Forward -194 -182 14.3953 0.00424
NP_441286.1_1 Reverse -183 -195 11.937 0.0108
NP_441286.1_1 Reverse -10 -22 -6.05754 0.245
NP_440670.1_8 Forward -193 -184 18.3876 0.000699
NP_440670.1_8 Reverse -184 -193 18.3876 0.000699
NP_440670.1_8 Forward -78 -69 6.68623 0.105
NP_441479.1_9 Forward -193 -175 12.3105 0.297
NP_441705.1_3 Forward -38 -19 -0.885524 0.279
NP_440886.1_7 Reverse -297 -307 8.14104 0.0805
NP_440886.1_7 Reverse -183 -193 8.04271 0.0805
NP_440886.1_7 Forward -194 -184 7.94438 0.0805
NP_440886.1_7 Reverse -68 -78 4.10949 0.253
NP_442614.1_2 Reverse -257 -271 7.37441 0.275
NP_440028.1_6 Reverse -326 -344 11.2289 0.265
NP_441808.1_8 Forward -193 -174 6.19431 0.291
NP_442022.1_4 Forward -101 -82 6.4893 0.271
NP_440907.2_8 Forward -192 -182 9.51767 0.103
NP_442264.1_2 Forward -197 -180 10.0686 0.188
NP_441021.1_1 Reverse -299 -318 1.17943 0.0848
NP_440841.1_4 Reverse -182 -201 -9.34199 0.258
NP_440176.1_3 Reverse -143 -157 12.782 0.264
NP_441463.1_3 Forward -317 -298 2.65439 0.113
NP_441463.1_3 Forward -203 -184 1.47442 0.127
NP_441463.1_6 Reverse -182 -196 13.2769 0.2
NP_441463.1_6 Forward -195 -181 8.44524 0.25
NP_441626.1_2 Forward -192 -185 15.7721 0.0124
NP_441626.1_2 Reverse -185 -192 15.7721 0.0124
NP_442365.1_7 Reverse -180 -199 -3.54046 0.221
NP_442794.1_1 Reverse -180 -192 10.2654 0.0721
NP_442794.1_1 Forward -197 -185 7.11881 0.148
NP_442615.1_1 Forward -202 -184 6.70565 0.034
NP_442615.1_1 Reverse -175 -193 -0.669169 0.12
NP_441962.1_4 Forward -25 -6 -1.96717 0.127
NP_440387.1_1 Forward -193 -177 6.35172 0.0282
NP_440387.1_1 Reverse -184 -200 -2.5964 0.148
NP_441431.1_2 Reverse -295 -309 6.48882 0.269
NP_441431.1_2 Forward -213 -199 5.70218 0.291
NP_441488.1_7 Forward -163 -144 5.70265 0.155
NP_441993.1_1 Forward -313 -294 19.7814 0.0297
NP_441993.1_1 Forward -105 -86 15.7856 0.0663
NP_441993.1_1 Reverse -243 -262 2.8238 0.25
NP_442352.1_1 Reverse -236 -249 14.1955 0.27
NP_440114.1_10 Reverse -184 -198 6.6861 0.26
NP_440114.1_10 Forward -78 -64 6.29277 0.276
NP_440114.1_10 Reverse -69 -83 5.80112 0.292
NP_442323.1_7 Forward -198 -179 4.03023 0.224
NP_440293.1_3 Forward -101 -82 6.88262 0.188
NP_440766.1_4 Reverse -180 -194 6.98109 0.097
NP_439988.1_3 Forward -306 -292 9.5377 0.247
NP_440422.1_10 Forward -136 -117 4.59551 0.281
NP_439910.1_2 Forward -201 -184 -21.7906 0.19
NP_440457.1_1 Reverse -180 -192 8.39711 0.101
NP_440457.1_1 Forward -197 -185 0.0389777 0.25
NP_440457.1_1 Reverse -65 -77 -0.74767 0.273
NP_442680.1_5 Forward -147 -128 7.39901 0.193
NP_442297.1_4 Forward -197 -178 12.3352 0.274
NP_441436.1_6 Forward -310 -291 11.0125 0.253
NP_441436.1_8 Reverse -330 -349 8.55425 0.283
NP_440473.1_1 Reverse -150 -169 11.8359 0.264
NP_442509.1_9 Reverse -184 -194 8.14104 0.192
NP_442509.1_9 Forward -193 -183 8.04271 0.192
NP_442509.1_9 Forward -78 -68 6.46942 0.268
NP_441253.1_1 Reverse -300 -319 7.27595 0.215
NP_440554.1_4 Forward -192 -182 16.1063 0.0189
NP_440554.1_4 Reverse -185 -195 7.05986 0.106
NP_440554.1_4 Forward -77 -67 4.0116 0.205
NP_442862.1_3 Reverse -116 -133 5.25038 0.279
NP_441885.1_5 Reverse -184 -194 20.9245 0.000538
NP_441885.1_5 Forward -193 -183 11.3864 0.00668
NP_440478.1_4 Reverse -180 -199 11.7008 0.244
NP_442341.1_7 Forward -194 -180 8.55439 0.0864
NP_442341.1_9 Reverse -182 -196 9.04542 0.159
NP_442341.1_9 Forward -195 -181 6.68548 0.217
NP_441756.1_5 Forward -338 -319 -2.16383 0.271
NP_441173.1_9 Forward -225 -217 13.2937 0.17
NP_440423.1_6 Reverse -241 -260 -11.7019 0.181
NP_443000.1_7 Reverse -182 -192 17.4829 0.00719
NP_443000.1_7 Forward -195 -185 17.0896 0.00865
NP_443059.1_10 Reverse -176 -195 1.6703 0.239
NP_442513.1_5 Forward -201 -182 9.14342 0.266
NP_441842.1_10 Forward -200 -186 10.0294 0.175
NP_440275.1_3 Reverse -182 -192 9.12481 0.055
NP_440275.1_3 Forward -195 -185 8.1415 0.0602
NP_440091.1_1 Forward -197 -185 7.11881 0.0874
NP_442275.1_1 Reverse -80 -99 0.491109 0.285
NP_439962.1_4 Reverse -290 -309 -2.95047 0.242
NP_442495.1_5 Forward -104 -85 7.96426 0.291
NP_440149.1_8 Reverse -184 -203 12.7825 0.0312
NP_440149.1_8 Forward -193 -174 -3.73712 0.196
NP_442214.1_7 Forward -250 -231 20.5124 0.0818
NP_441105.1_3 Reverse -287 -306 -6.88371 0.243
NP_441105.1_3 Forward -198 -179 -7.57203 0.255
NP_440216.1_1 Reverse -184 -198 6.98109 0.0111
NP_440216.1_1 Forward -78 -64 -1.77037 0.0383
NP_440216.1_1 Forward -193 -179 -2.45868 0.0513
NP_440216.1_1 Reverse -242 -256 -11.8985 0.228
NP_440216.1_1 Forward -307 -293 -11.9968 0.236
NP_440216.1_1 Reverse -69 -83 -11.9968 0.236
NP_440216.1_9 Reverse -215 -224 7.57121 0.286
NP_440172.1_1 Forward -193 -183 17.5813 0.00421
NP_440172.1_1 Reverse -184 -194 15.0247 0.00945
NP_440172.1_1 Reverse -69 -79 4.99491 0.157
NP_442015.1_10 Reverse -180 -193 11.229 0.0372
NP_442015.1_10 Reverse -294 -307 1.78924 0.204
NP_442015.1_10 Forward -197 -184 0.510939 0.224
NP_441226.1_7 Forward -192 -185 14.4934 0.0123
NP_441226.1_7 Reverse -185 -192 14.4934 0.0123
NP_441226.1_7 Forward -258 -251 6.82361 0.246
NP_441757.1_3 Reverse -183 -202 10.2259 0.0935
NP_441757.1_3 Forward -194 -175 -0.0988766 0.209
NP_441111.1_7 Forward -192 -184 18.7023 0.00294
NP_441111.1_7 Reverse -185 -193 18.7023 0.00294
NP_442379.1_10 Forward -200 -183 -3.69774 0.265
NP_441766.1_2 Forward -193 -184 17.5026 0.00297
NP_441766.1_2 Reverse -184 -193 17.5026 0.00297
NP_442417.1_5 Forward -193 -179 9.73436 0.127
NP_442417.1_5 Forward -319 -305 6.3911 0.222
NP_440416.1_9 Forward -200 -181 -17.7985 0.247
NP_440416.1_9 Reverse -177 -196 -21.6334 0.295
NP_443052.1_8 Forward -203 -184 -0.983855 0.0754
NP_441019.1_9 Forward -210 -191 15.5349 0.243
NP_440591.1_5 Reverse -284 -303 13.3716 0.207
NP_442154.1_1 Forward -106 -88 -9.91228 0.195
NP_442154.1_1 Reverse -326 -344 -17.5821 0.26
NP_440261.1_5 Forward -192 -179 -3.02898 0.108
NP_440261.1_5 Reverse -185 -198 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTGGCTTTTTGCCGGGCTCTACAAGGAGCTTCCCCCATTAGTTCCTATCTTCAACCCGTACCCGCCGCTATGCCTGGTTACGCCAGTGAAGTGGTGATGGCTGGGGGCACATTTATTGACGGCAGTACTTCCGAGTTGTCCGCCGACGGACCATTGCGGGAACCCTACACCGTTTTTTGCCAAGGAGGCACCCACTGGACCCATATGGCGATCGCCTTGGAGGAAATTTTGGCCGCCTTTGAGGAGTTGGAGGACGGGAAAAAAGCCTAGATCGTCAACATATCAGCCGTTTAGGGAAGTGGTCTGTGGCAGGGCTAGGAAGACCATCGCCGGTCATAGAATCAGGGTAGCTGGTCAAAACAGCCACAGTATTTGGAGGCGTGATTGACACGATTAGTT

CDS

ATGAAAAATTCCTATTCCGCTCTCTGGGGTCGCCCAGCTAAAGTTGTCCTAGTGGCCCTAATTCTTGGTGGCTTGGGTTTAGCGATACCTAGCTATGCCCAGGAGACCCAAACTTACTACTGCTCCCCAACCGAAACATTGACAATTAAAATGGTGGAAGGATCTGCCATTCAGGTTACCCTGCCGGATGGTCGCACAGTGGTTTTACCCCAAGCGGAATCGGCCTCTGGGAATAAATACAGCAATGGTTTCATCACCGTTTGGTCCAAGGGCAACACTGCCTTGGTGGAAGAGGGCGGCAACGTTAAATGGCAGGATTGCGTCAAAATTTGA

Protein

MKNSYSALWGRPAKVVLVALILGGLGLAIPSYAQETQTYYCSPTETLTIKMVEGSAIQVTLPDGRTVVLPQAESASGNKYSNGFITVWSKGNTALVEEGGNVKWQDCVKI