Your browser is old and dusty. Try Google Chrome!

Details for slr0580

ORF slr0580
Accession NP_442431.1
Symbol
Category Drug and analog sensitivity
Definition aluminum resistance protein homolog
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -361 -347 10.9143 0.0562
NP_441061.1_2 Forward -319 -305 -2.55701 0.296
NP_440795.1_7 Reverse -354 -361 8.00392 0.218
NP_441418.1_3 Reverse -114 -133 10.6469 0.272
NP_441418.1_6 Reverse -353 -372 -29.9915 0.249
NP_442291.1_5 Reverse -239 -255 -4.66135 0.281
NP_441453.1_4 Forward -362 -354 3.85433 0.284
NP_441623.1_1 Reverse -180 -198 -0.374176 0.23
NP_440226.1_1 Reverse -353 -372 2.65439 0.256
NP_442752.1_4 Reverse -353 -360 12.1338 0.0546
NP_443027.1_4 Reverse -351 -361 7.55152 0.24
NP_441812.1_3 Reverse -352 -366 14.4542 0.126
NP_442975.1_10 Forward -366 -352 8.3571 0.0995
NP_440761.1_9 Forward -59 -40 9.93088 0.212
NP_441859.1_3 Forward -396 -377 10.6184 0.119
NP_441859.1_3 Reverse -186 -205 1.96529 0.269
NP_440044.1_8 Reverse -276 -295 -2.75381 0.269
NP_439902.1_9 Forward -135 -117 16.6371 0.276
NP_440370.1_10 Reverse -344 -363 7.07928 0.268
NP_441925.1_2 Forward -156 -137 5.70265 0.262
NP_440769.1_8 Reverse -150 -169 9.24257 0.214
NP_441083.1_5 Reverse -62 -72 4.0116 0.159
NP_441083.1_5 Forward -362 -352 -1.00328 0.289
NP_441558.1_5 Forward -364 -345 10.5209 0.0968
NP_441713.1_1 Reverse -347 -366 -11.8986 0.237
NP_441486.1_1 Forward -192 -178 -4.32697 0.194
NP_441194.1_1 Forward -186 -167 12.3658 0.238
NP_442634.1_4 Reverse -351 -365 -4.4253 0.201
NP_440470.1_5 Reverse -149 -168 11.2199 0.18
NP_442848.1_1 Reverse -347 -361 4.81781 0.095
NP_441012.1_4 Forward -114 -101 5.42749 0.297
NP_443018.1_3 Reverse -354 -361 4.07068 0.299
NP_440376.1_1 Reverse -353 -362 3.83464 0.19
NP_441588.1_4 Reverse -182 -192 6.76487 0.185
NP_442191.1_4 Forward -395 -381 10.9931 0.276
NP_441077.1_6 Forward -23 -7 12.0569 0.136
NP_442485.1_2 Forward -328 -309 8.84924 0.288
NP_441846.1_10 Reverse -342 -361 -15.3402 0.247
NP_440667.1_10 Forward -167 -148 17.404 0.162
NP_442658.1_1 Reverse -385 -395 6.96107 0.214
NP_440141.1_8 Reverse -378 -397 10.5209 0.208
NP_440184.1_1 Forward -222 -203 9.57539 0.105
NP_443061.1_4 Reverse -235 -254 9.24257 0.205
NP_442321.1_4 Forward -49 -30 -6.78538 0.284
NP_439905.1_1 Forward -395 -382 9.75405 0.216
NP_442690.1_1 Reverse -11 -30 -5.21209 0.157
NP_442690.1_1 Forward -171 -152 -10.7186 0.218
NP_442690.1_1 Forward -159 -140 -10.9153 0.22
NP_442690.1_1 Forward -158 -139 -16.6185 0.29
NP_440153.1_5 Reverse -375 -389 0.786239 0.289
NP_440153.1_8 Forward -362 -349 3.95252 0.21
NP_442064.1_4 Reverse -220 -239 4.32522 0.29
NP_440993.1_4 Reverse -245 -262 10.5603 0.213
NP_440496.1_3 Reverse -167 -186 17.4269 0.11
NP_440809.1_9 Forward -371 -353 -7.35568 0.225
NP_442431.1_1 Forward -354 -335 23.9913 0.0281
NP_442431.1_2 Forward -328 -309 27.4338 0.0000125
NP_442431.1_6 Forward -238 -219 19.174 0.111
NP_441752.1_7 Reverse -109 -128 16.7149 0.16
NP_440147.1_4 Forward -364 -351 -0.669033 0.294
NP_441916.1_7 Reverse -353 -363 4.40493 0.178
NP_441041.1_4 Reverse -381 -400 -2.85214 0.117
NP_441041.1_4 Reverse -347 -366 -7.37537 0.186
NP_442996.1_1 Forward -20 -1 5.20389 0.246
NP_439966.1_9 Forward -109 -100 4.42462 0.253
NP_442941.1_2 Forward -219 -200 12.4613 0.292
NP_442941.1_2 Forward -174 -155 12.4613 0.292
NP_442941.1_3 Reverse -354 -364 5.38824 0.115
NP_440983.1_8 Forward -332 -313 15.5357 0.227
NP_440260.1_7 Forward -268 -249 -2.16383 0.241
NP_441514.1_6 Forward -42 -35 12.8221 0.252
NP_442281.1_1 Forward -367 -353 3.8339 0.217
NP_442281.1_1 Reverse -102 -116 3.53891 0.228
NP_441644.1_6 Forward -362 -352 3.61784 0.272
NP_442933.1_10 Reverse -353 -362 4.62128 0.227
NP_442554.1_4 Forward -228 -209 8.06259 0.291
NP_442554.1_8 Forward -361 -351 7.15819 0.0975
NP_442970.1_3 Reverse -139 -157 11.3603 0.29
NP_442142.1_4 Forward -320 -307 4.44361 0.222
NP_442292.1_1 Forward -361 -352 5.70292 0.135
NP_441264.1_10 Reverse -305 -319 16.1259 0.278
NP_443009.1_5 Reverse -30 -41 7.53132 0.126
NP_441865.1_3 Forward -116 -98 13.3922 0.249
NP_440620.1_4 Forward -156 -142 14.1444 0.278
NP_441198.1_8 Forward -364 -354 12.0017 0.167
NP_441198.1_8 Forward -42 -32 10.4392 0.271
NP_441468.1_1 Reverse -354 -361 10.2655 0.0906
NP_441764.1_4 Forward -185 -168 15.2337 0.116
NP_443058.1_7 Forward -357 -338 6.4893 0.233
NP_442808.1_1 Forward -327 -317 2.43787 0.266
NP_440871.1_7 Reverse -219 -238 9.3409 0.265
NP_440558.1_2 Forward -399 -380 -5.01543 0.251
NP_440162.1_2 Reverse -325 -344 6.58763 0.282
NP_442576.1_2 Forward -167 -148 7.47261 0.263
NP_441557.1_5 Reverse -353 -362 -0.786921 0.239
NP_441445.1_1 Forward -198 -179 1.96607 0.245
NP_440084.1_8 Reverse -190 -204 8.89237 0.299
NP_440101.1_10 Reverse -347 -366 7.37428 0.193
NP_440190.1_4 Forward -366 -349 21.0817 0.0547
NP_440157.1_5 Forward -220 -201 16.09 0.265
NP_442347.1_2 Forward -361 -352 5.89959 0.21
NP_442645.1_2 Forward -197 -178 -17.4051 0.254
NP_442645.1_2 Forward -124 -105 -22.6167 0.292
NP_442047.1_2 Reverse -310 -324 14.6509 0.19
NP_440136.1_2 Reverse -354 -361 4.26735 0.218
NP_441728.2_4 Forward -186 -167 12.5568 0.273
NP_440899.1_1 Forward -265 -246 7.04116 0.267
NP_441799.1_1 Forward -366 -352 4.52221 0.247
NP_441007.1_10 Reverse -348 -361 1.69091 0.203
NP_442333.2_1 Forward -109 -90 6.78429 0.101
NP_441559.1_8 Forward -111 -97 14.7492 0.0574
NP_441559.1_8 Forward -388 -374 -6.78525 0.279
NP_441559.1_8 Reverse -382 -396 -7.17857 0.287
NP_440915.1_6 Reverse -349 -363 10.226 0.0333
NP_442158.1_4 Reverse -201 -211 13.2547 0.234
NP_441866.1_6 Reverse -144 -163 10.52 0.22
NP_442957.1_8 Forward -257 -238 7.37428 0.287
NP_442993.1_1 Reverse -353 -369 -9.97122 0.201
NP_442386.1_9 Reverse -352 -361 10.2257 0.136
NP_442386.1_9 Forward -326 -317 4.52254 0.297
NP_442327.1_3 Reverse -1 -20 14.7531 0.158
NP_440327.1_6 Forward -265 -246 5.70265 0.258
NP_440597.1_9 Forward -363 -349 19.8624 0.168
NP_442474.1_1 Forward -221 -202 3.14605 0.262
NP_442251.1_6 Forward -283 -276 8.20058 0.23
NP_442959.1_5 Forward -51 -32 9.3409 0.224
NP_441657.1_5 Forward -366 -347 4.03102 0.142
NP_441595.1_2 Reverse -142 -155 10.7569 0.277
NP_440210.1_8 Reverse -380 -396 10.285 0.22
NP_440267.1_2 Forward -367 -353 9.83206 0.156
NP_441689.1_5 Forward -364 -354 7.94438 0.18
NP_440344.1_10 Forward -47 -30 -13.5308 0.287
NP_440344.1_10 Reverse -379 -396 -13.6292 0.29
NP_440282.1_10 Forward -372 -353 -8.06369 0.259
NP_441060.1_4 Forward -347 -329 2.57575 0.252
NP_439926.1_7 Forward -335 -317 7.00065 0.229
NP_440937.1_5 Reverse -380 -399 8.25926 0.287
NP_443036.1_10 Forward -397 -378 4.52268 0.251
NP_440999.1_2 Forward -395 -376 14.1591 0.165
NP_440888.1_2 Forward -362 -348 16.0269 0.00832
NP_440052.1_4 Forward -52 -33 9.83255 0.239
NP_442277.1_7 Forward -27 -11 -1.04361 0.264
NP_442033.1_10 Reverse -228 -247 -9.83364 0.222
NP_441543.1_2 Forward -361 -352 5.01461 0.209
NP_442845.1_2 Reverse -347 -361 6.48943 0.209
NP_441304.1_10 Forward -43 -34 15.1427 0.164
NP_441551.1_5 Reverse -307 -323 9.10428 0.218
NP_442710.1_7 Forward -179 -160 -0.495057 0.212
NP_442315.1_2 Reverse -26 -38 9.87208 0.291
NP_441462.1_2 Reverse -353 -363 -0.216628 0.192
NP_443062.1_1 Forward -362 -344 4.45062 0.26
NP_443062.1_1 Reverse -275 -293 3.86557 0.282
NP_441785.1_1 Forward -362 -348 14.1927 0.166
NP_442428.1_5 Reverse -354 -361 4.66067 0.244
NP_442823.1_8 Forward -74 -55 11.4058 0.286
NP_441052.1_2 Forward -362 -352 6.56821 0.0877
NP_442219.1_9 Forward -361 -352 5.01461 0.193
NP_440436.1_4 Forward -361 -352 11.3073 0.0574
NP_440436.1_4 Forward -188 -179 6.78414 0.147
NP_442907.1_2 Forward -361 -343 8.08229 0.272
NP_442907.1_9 Forward -319 -300 -3.83545 0.272
NP_441719.1_2 Reverse -201 -215 14.5017 0.278
NP_441115.1_4 Forward -397 -379 12.5064 0.102
NP_440328.1_4 Forward -389 -370 3.6377 0.174
NP_440328.1_4 Forward -80 -61 -0.983855 0.295
NP_441851.1_10 Reverse -352 -362 14.238 0.0196
NP_442208.1_8 Reverse -309 -327 16.6371 0.235
NP_440611.1_1 Forward -77 -58 15.4374 0.195
NP_441982.1_6 Forward -163 -154 14.3952 0.274
NP_441982.1_6 Forward -184 -175 12.4854 0.275
NP_442689.1_8 Forward -167 -150 -6.64766 0.286
NP_442689.1_8 Reverse -15 -32 -8.22096 0.294
NP_440874.1_2 Reverse -160 -179 10.1721 0.288
NP_441409.1_8 Forward -211 -192 7.59493 0.279
NP_440431.1_3 Forward -169 -150 -0.590531 0.144
NP_440431.1_4 Forward -292 -273 -7.30556 0.262
NP_442168.1_5 Forward -400 -381 -4.03212 0.299
NP_441031.1_6 Reverse -295 -314 4.81767 0.172
NP_441570.1_1 Forward -255 -237 -17.6804 0.287
NP_441078.1_4 Forward -362 -353 -1.96689 0.282
NP_442348.1_2 Reverse -386 -395 9.14451 0.28
NP_440793.1_1 Reverse -279 -293 15.1419 0.26
NP_440526.1_3 Forward -361 -350 19.626 0.0152
NP_441432.1_8 Reverse -352 -361 4.32629 0.223
NP_441432.1_8 Reverse -386 -395 3.7363 0.243
NP_442320.1_8 Reverse -347 -361 -3.93365 0.136
NP_441030.1_4 Forward -38 -19 6.63627 0.277
NP_440760.1_7 Reverse -23 -42 2.26028 0.286
NP_440131.1_10 Reverse -343 -362 11.8975 0.241
NP_443011.1_1 Reverse -353 -372 23.5006 0.00765
NP_443011.1_5 Reverse -309 -328 17.6007 0.129
NP_442489.1_7 Reverse -353 -362 -1.6719 0.235
NP_441659.2_8 Forward -362 -352 4.0116 0.146
NP_441022.1_1 Forward -159 -150 13.081 0.216
NP_442913.1_10 Forward -80 -61 -3.63879 0.214
NP_442913.1_10 Reverse -344 -363 -5.01543 0.254
NP_442346.1_5 Reverse -352 -362 5.78156 0.229
NP_440352.1_5 Forward -304 -285 10.709 0.27
NP_440545.1_3 Forward -120 -103 -5.1727 0.242
NP_441653.1_2 Reverse -342 -361 5.46229 0.245
NP_440010.1_3 Reverse -375 -394 -5.40875 0.25
NP_440010.1_4 Forward -366 -347 -3.54122 0.299
NP_442027.1_4 Reverse -1 -20 16.3764 0.145
NP_441593.1_8 Reverse -14 -33 14.1591 0.232
NP_441329.1_1 Reverse -163 -182 8.45061 0.226
NP_441329.1_6 Forward -219 -200 2.43462 0.227
NP_440772.1_8 Forward -323 -304 8.06259 0.263
NP_442199.1_5 Forward -82 -63 -2.0655 0.185
NP_442199.1_7 Forward -164 -145 -0.591301 0.3
NP_441671.1_9 Reverse -306 -325 12.8808 0.193
NP_440594.1_5 Reverse -33 -52 6.29183 0.293
NP_442028.1_2 Forward -203 -190 17.3255 0.224
NP_440152.1_3 Reverse -85 -104 11.5042 0.279
NP_440590.1_4 Forward -361 -348 1.39592 0.125
NP_440590.1_4 Reverse -63 -76 -4.7006 0.265
NP_440821.1_4 Reverse -351 -361 5.09324 0.119
NP_440219.1_1 Reverse -151 -170 17.1385 0.158
NP_441541.1_1 Forward -173 -155 -4.29515 0.273
NP_442216.1_4 Reverse -33 -41 8.1805 0.255
NP_442138.1_10 Reverse -353 -372 -0.983855 0.167
NP_440546.1_4 Reverse -353 -363 11.3065 0.0872
NP_441474.1_1 Reverse -292 -311 -3.34455 0.298
NP_442402.1_10 Reverse -231 -241 12.0743 0.224
NP_442882.1_7 Reverse -233 -247 11.9953 0.261
NP_442923.1_6 Forward -21 -7 19.683 0.0914
NP_441811.1_8 Forward -77 -63 7.76774 0.241
NP_442679.1_1 Forward -211 -192 4.916 0.147
NP_442679.1_1 Forward -313 -294 -1.27885 0.228
NP_440825.1_6 Reverse -4 -23 7.66927 0.285
NP_440505.1_3 Reverse -351 -361 6.76487 0.169
NP_440505.1_3 Forward -251 -241 4.79825 0.266
NP_440914.1_1 Forward -362 -352 6.27291 0.288
NP_442533.1_6 Forward -362 -353 7.07956 0.0964
NP_442533.1_6 Reverse -353 -362 4.42462 0.179
NP_442541.1_10 Forward -396 -382 3.04726 0.254
NP_441028.1_6 Reverse -288 -298 14.6309 0.158
NP_441527.1_4 Forward -220 -201 3.19856 0.119
NP_441527.1_4 Forward -219 -200 -5.20473 0.197
NP_441527.1_4 Forward -221 -202 -10.5523 0.272
NP_441527.1_4 Forward -299 -280 -10.7433 0.274
NP_441527.1_4 Forward -233 -214 -11.6982 0.284
NP_440608.1_1 Forward -35 -16 7.37386 0.223
NP_440828.1_1 Forward -394 -375 3.73524 0.219
NP_441753.1_10 Reverse -338 -357 12.2908 0.106
NP_441753.1_10 Forward -371 -352 5.50599 0.186
NP_441021.1_1 Forward -361 -342 -9.73531 0.219
NP_441463.1_2 Reverse -201 -219 6.13724 0.145
NP_441463.1_3 Forward -372 -353 -10.0303 0.288
NP_441463.1_6 Forward -397 -383 6.99573 0.265
NP_441463.1_6 Forward -364 -350 5.64286 0.287
NP_442842.1_10 Reverse -288 -307 -0.408261 0.285
NP_441836.1_2 Forward -251 -232 -6.1954 0.292
NP_440634.1_10 Forward -323 -304 6.78348 0.261
NP_440082.1_5 Reverse -202 -221 15.8971 0.256
NP_440467.1_8 Forward -332 -313 16.4207 0.0986
NP_440114.1_10 Reverse -353 -367 10.521 0.146
NP_441510.2_6 Forward -362 -343 17.2065 0.11
NP_440287.1_6 Reverse -63 -82 2.94938 0.226
NP_442867.1_8 Reverse -258 -277 4.12936 0.291
NP_440457.1_1 Reverse -349 -361 0.23564 0.25
NP_442297.1_10 Forward -303 -284 15.0441 0.183
NP_441984.1_1 Forward -77 -59 6.01734 0.288
NP_441489.1_2 Forward -362 -343 18.5853 0.142
NP_441489.1_3 Forward -153 -139 7.55548 0.261
NP_441885.1_5 Forward -362 -352 -0.314959 0.195
NP_441662.1_8 Forward -210 -191 8.06259 0.244
NP_441190.1_2 Forward -338 -319 6.68596 0.17
NP_441207.1_7 Forward -290 -276 9.35221 0.282
NP_442495.1_3 Reverse -309 -327 11.6222 0.259
NP_441730.1_2 Reverse -150 -168 7.4923 0.283
NP_440172.1_1 Reverse -353 -363 7.35486 0.0819
NP_441718.1_7 Forward -332 -313 6.68596 0.271
NP_441226.1_7 Forward -361 -354 11.2485 0.0971
NP_440416.1_9 Forward -357 -338 -15.7335 0.198
NP_440416.1_9 Forward -256 -237 -20.7484 0.288
NP_440416.1_9 Forward -123 -104 -21.1417 0.291
NP_443052.1_8 Forward -372 -353 -12.1936 0.249
NP_442116.1_6 Reverse -152 -169 9.69683 0.227
NP_442116.1_6 Reverse -151 -168 6.16362 0.286
NP_442154.1_1 Reverse -309 -327 -19.2537 0.294
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTAATGCCAATGCCGCCGGTAATTACATAGAGCAAGAAAGCCATCCCCACTGCTTTCCAACTGAAAAACTGGGGCAGGAAAGCCAACAGGGCCACCAAATGAATGGAGGTAAAAAAGAAGATCACAGTCCAAGCTGGAGTCAACTTGGGCTTGGAATCGTTGGGAAGAGCAGCAGTCATGAAAAAAAACCTAACGAAAAAACGGAATAATTGGCGCTTGTTAAAAACGATTAAACTATTGTCAAAAAGTTTGCTTAAATATAGGTATTCAATGTTTAATGGGTTTAACATCGCCGGGATTTACCAACCATCCAAGAAAATCGAATCGGTGATGATCTCGAAGATTGAAAGATAGTTTAAGGGGAATTCCCAAATAACATCAAAAGTTAAATAATGTCTTA

CDS

ATGAAATATTCCAGCTTCCTTAAACAAGCAGAAGAAAACCTAGTCCCAATCTTTTCGGAAATCGACGCAAAGGTCAAGGAAAATCTGTACAAAGTCATAGAGGCATTTCGGCACCATCGGGTAGGGGTACAGCACTTCGCCGGGGTGAGTGGTTATGGCCATGATGACCTAGGCAGAGATACTCTGGACGGGGTTTTTGCTCAGGTGATGGGGGCAGAGTCGGCCGCTGTACGGGTACAGTTTGTGTCCGGAACCCATGCGATCGCCTGTGCGTTGTACGGCATTTTGCGACCGGGGGATGAACTACTGTCGGCGGTGGGCTCTCCCTACGACACCCTCGAAGAAGTGATTGGTCTTAGGGGAAGTTGTCAAGGCTCCCTCGCTGACTTTAACATTTCTTATCGTCAATTGCCCCTCACGGCGGCCGGCACGGTGGATTGGCAAGGGCTAGAAACTGCAGTGCGTCCGGAAACTCGCTTAGTTTTAATCCAACGTTCCTGTGGTTACAGTTGGCGCCCCAGTTTGGCGATCGCCGACATTGCCAGAATTATCGAAATTGTTAAAGCCCAAAATCCTCGCACCCTTTGTTTTGTGGACAATTGCTACGGGGAATTCATTGAGACAGTGGAACCGACGGCGATCGGAGTGGATCTGATGGCTGGGTCTTTGATTAAAAATCCTGGGGGCACCATTGTTACGGCAGGGGGTTACCTAGCCGGGAAAGAGGAATGGGTGGAAGCGGGGGCCTATAGATTGACTGCCCCAGGCATTGGCCGGGAAGGGGGAGCCACTTTTGACCAAAATCGTCTGTTATTCCAAGGCCTCTTCCTTGCCCCCCAAATGGTGGGGGAAGCGATGAAATGTAACCATCTGCTGGCCCATGTGTTTGACCAATTGGGTTACCCGGTTAATCCTGCGCCCCTATCTCCCCGCCGGGATGTGATCCAAGCCATTCAGTTGGGCAGTCCAGAAAAATTATTGGCTTTTTGCCGGGCTCTACAAGGAGCTTCCCCCATTAGTTCCTATCTTCAACCCGTACCCGCCGCTATGCCTGGTTACGCCAGTGAAGTGGTGATGGCTGGGGGCACATTTATTGACGGCAGTACTTCCGAGTTGTCCGCCGACGGACCATTGCGGGAACCCTACACCGTTTTTTGCCAAGGAGGCACCCACTGGACCCATATGGCGATCGCCTTGGAGGAAATTTTGGCCGCCTTTGAGGAGTTGGAGGACGGGAAAAAAGCCTAG

Protein

MKYSSFLKQAEENLVPIFSEIDAKVKENLYKVIEAFRHHRVGVQHFAGVSGYGHDDLGRDTLDGVFAQVMGAESAAVRVQFVSGTHAIACALYGILRPGDELLSAVGSPYDTLEEVIGLRGSCQGSLADFNISYRQLPLTAAGTVDWQGLETAVRPETRLVLIQRSCGYSWRPSLAIADIARIIEIVKAQNPRTLCFVDNCYGEFIETVEPTAIGVDLMAGSLIKNPGGTIVTAGGYLAGKEEWVEAGAYRLTAPGIGREGGATFDQNRLLFQGLFLAPQMVGEAMKCNHLLAHVFDQLGYPVNPAPLSPRRDVIQAIQLGSPEKLLAFCRALQGASPISSYLQPVPAAMPGYASEVVMAGGTFIDGSTSELSADGPLREPYTVFCQGGTHWTHMAIALEEILAAFEELEDGKKA