Your browser is old and dusty. Try Google Chrome!

Details for slr0575

ORF slr0575
Accession NP_442427.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -101 -87 5.01447 0.142
NP_441061.1_2 Forward -95 -81 -1.77037 0.272
NP_440795.1_7 Forward -101 -94 14.6904 0.0123
NP_440795.1_7 Reverse -94 -101 14.6904 0.0123
NP_440795.1_7 Forward -308 -301 10.2655 0.154
NP_440815.1_5 Forward -102 -83 11.1109 0.211
NP_442291.1_5 Forward -103 -87 7.63002 0.0617
NP_442291.1_5 Reverse -92 -108 -4.36636 0.272
NP_442291.1_5 Reverse -69 -85 -4.46469 0.276
NP_441453.1_4 Reverse -93 -101 16.539 0.00633
NP_441453.1_4 Forward -102 -94 16.539 0.00633
NP_441453.1_4 Reverse -300 -308 4.14932 0.264
NP_441453.1_7 Reverse -82 -89 12.1338 0.295
NP_441453.1_8 Reverse -299 -316 10.3636 0.239
NP_441623.1_1 Forward -51 -33 -4.99573 0.282
NP_441960.1_3 Forward -324 -305 12.4595 0.296
NP_441960.1_4 Reverse -287 -303 15.9874 0.191
NP_442151.1_6 Reverse -93 -107 16.3225 0.0158
NP_442151.1_6 Forward -102 -88 7.76774 0.19
NP_441818.1_1 Forward -101 -90 10.1862 0.232
NP_441818.1_1 Reverse -94 -105 10.1862 0.232
NP_440226.1_1 Reverse -93 -112 12.8808 0.0399
NP_440226.1_1 Forward -102 -83 6.39097 0.129
NP_440259.1_4 Forward -38 -24 16.9268 0.117
NP_441098.1_3 Forward -293 -274 -1.62095 0.272
NP_440150.1_2 Forward -100 -81 5.89851 0.262
NP_440996.1_5 Forward -383 -374 14.7878 0.259
NP_443002.1_5 Forward -95 -77 14.5713 0.196
NP_442173.1_1 Forward -101 -93 15.4574 0.00633
NP_442173.1_1 Reverse -94 -102 15.4574 0.00633
NP_442173.1_1 Forward -308 -300 4.73931 0.258
NP_442752.1_4 Forward -102 -95 13.8055 0.0199
NP_442752.1_4 Reverse -93 -100 13.8055 0.0199
NP_442975.1_10 Reverse -89 -103 2.45727 0.274
NP_442975.1_10 Forward -106 -92 2.35894 0.276
NP_440784.1_7 Forward -101 -94 15.9687 0.0123
NP_440784.1_7 Reverse -94 -101 15.9687 0.0123
NP_442909.1_7 Forward -101 -87 9.73373 0.14
NP_442062.1_8 Forward -102 -92 17.3846 0.00193
NP_442062.1_8 Reverse -93 -103 17.3846 0.00193
NP_440761.1_4 Forward -63 -44 -20.1584 0.285
NP_441859.1_3 Forward -246 -227 7.66846 0.155
NP_441859.1_3 Reverse -92 -111 2.45694 0.258
NP_441802.1_1 Reverse -19 -38 4.42435 0.296
NP_440304.1_4 Forward -104 -94 1.84832 0.299
NP_440304.1_4 Reverse -91 -101 1.84832 0.299
NP_442242.1_4 Forward -101 -94 14.3954 0.0124
NP_442242.1_4 Reverse -94 -101 14.3954 0.0124
NP_440044.1_8 Forward -101 -82 2.94938 0.142
NP_441781.1_7 Forward -102 -83 -2.36049 0.289
NP_441581.1_5 Forward -324 -305 14.4445 0.288
NP_441620.1_3 Reverse -86 -105 12.5858 0.248
NP_441200.1_4 Reverse -17 -36 7.86593 0.263
NP_441619.1_8 Reverse -87 -101 22.615 0.0117
NP_441619.1_8 Forward -108 -94 9.24208 0.228
NP_441594.1_6 Reverse -84 -103 3.93269 0.224
NP_442742.1_9 Reverse -198 -217 -11.7019 0.269
NP_442110.1_7 Reverse -80 -94 3.34284 0.21
NP_442110.1_7 Forward -102 -88 -0.197071 0.276
NP_441082.1_10 Reverse -82 -95 8.9674 0.258
NP_440014.1_3 Forward -176 -162 16.2578 0.261
NP_440769.1_8 Forward -293 -274 11.7992 0.17
NP_441083.1_5 Forward -102 -92 20.3345 0.00053
NP_441083.1_5 Reverse -93 -103 20.3345 0.00053
NP_441434.1_3 Reverse -32 -51 -2.26216 0.262
NP_441738.1_2 Forward -100 -93 15.28 0.0102
NP_441738.1_2 Reverse -95 -102 15.28 0.0102
NP_441738.1_2 Forward -93 -86 6.52862 0.261
NP_440209.1_1 Reverse -93 -101 18.1123 0.00295
NP_440209.1_1 Forward -102 -94 18.1123 0.00295
NP_442889.1_8 Forward -105 -91 12.5853 0.0611
NP_442889.1_8 Reverse -90 -104 12.5853 0.0611
NP_441713.1_1 Forward -108 -89 -14.3569 0.259
NP_441713.1_1 Reverse -261 -280 -15.1435 0.26
NP_441713.1_3 Reverse -306 -325 2.45773 0.277
NP_441770.1_5 Reverse -85 -104 -0.295539 0.245
NP_442570.1_3 Reverse -85 -104 -9.24366 0.296
NP_442445.1_1 Reverse -88 -107 11.7992 0.271
NP_442111.1_3 Forward -208 -195 15.627 0.196
NP_441624.1_7 Forward -315 -301 9.43936 0.22
NP_441624.1_7 Reverse -75 -89 8.25939 0.24
NP_441163.1_1 Forward -103 -86 5.93797 0.267
NP_440906.1_5 Forward -101 -94 15.8704 0.0124
NP_440906.1_5 Reverse -94 -101 15.8704 0.0124
NP_441209.1_4 Forward -104 -85 12.0933 0.279
NP_440747.1_10 Forward -105 -93 14.9853 0.00221
NP_440747.1_10 Reverse -90 -102 14.9853 0.00221
NP_441486.1_1 Forward -105 -91 23.894 0.00162
NP_441486.1_1 Reverse -90 -104 23.894 0.00162
NP_441486.1_1 Reverse -297 -311 1.47456 0.109
NP_441014.1_8 Reverse -301 -320 -3.83545 0.243
NP_442848.1_1 Reverse -87 -101 4.62115 0.0977
NP_442848.1_1 Forward -108 -94 -1.8687 0.263
NP_442848.1_5 Reverse -293 -311 2.28076 0.276
NP_443018.1_3 Forward -101 -94 14.8871 0.0123
NP_443018.1_3 Reverse -94 -101 14.8871 0.0123
NP_443018.1_3 Forward -308 -301 4.36568 0.254
NP_443018.1_3 Reverse -301 -308 4.07068 0.299
NP_441634.1_8 Forward -104 -90 -4.52363 0.295
NP_441634.1_8 Reverse -91 -105 -4.52363 0.295
NP_440376.1_1 Forward -102 -93 19.4693 0.000692
NP_440376.1_1 Reverse -93 -102 19.4693 0.000692
NP_440376.1_1 Reverse -86 -95 -0.0986038 0.285
NP_441588.1_4 Forward -100 -90 18.1713 0.0143
NP_441588.1_4 Reverse -95 -105 18.1713 0.0143
NP_442687.1_7 Forward -103 -93 8.92815 0.0994
NP_442687.1_7 Reverse -92 -102 8.92815 0.0994
NP_440642.1_10 Forward -318 -304 7.76712 0.221
NP_440642.1_10 Forward -333 -319 4.03056 0.263
NP_440667.1_2 Forward -120 -101 -2.16383 0.232
NP_442296.1_9 Forward -101 -82 -1.37718 0.204
NP_442658.1_1 Reverse -91 -101 6.76441 0.214
NP_442658.1_1 Forward -104 -94 6.76441 0.214
NP_440141.1_8 Reverse -306 -325 7.17762 0.246
NP_442496.1_5 Reverse -28 -46 5.23069 0.288
NP_442205.1_9 Reverse -87 -103 -2.89139 0.276
NP_442544.1_2 Forward -332 -318 -0.590395 0.229
NP_441414.1_9 Reverse -93 -112 3.53937 0.0582
NP_442937.1_5 Reverse -88 -107 6.78429 0.27
NP_441958.1_5 Forward -103 -93 12.2714 0.00183
NP_441958.1_5 Reverse -92 -102 12.2714 0.00183
NP_442836.1_5 Forward -108 -89 15.1424 0.0586
NP_442836.1_5 Forward -193 -174 1.76941 0.273
NP_440984.1_7 Forward -107 -93 8.65272 0.139
NP_439990.1_5 Forward -107 -94 16.1456 0.0407
NP_442911.1_2 Forward -112 -93 3.44104 0.0436
NP_442911.1_2 Reverse -83 -102 -9.83364 0.264
NP_440153.1_8 Reverse -300 -313 6.4108 0.17
NP_442064.1_1 Forward -107 -88 -10.9153 0.259
NP_443055.1_6 Reverse -307 -325 5.1316 0.181
NP_443055.1_6 Reverse -34 -52 1.29671 0.233
NP_440934.1_2 Forward -101 -82 5.99764 0.232
NP_440827.1_3 Reverse -295 -314 12.9791 0.236
NP_441348.1_3 Forward -321 -302 12.8808 0.138
NP_442002.1_9 Reverse -33 -40 11.1505 0.185
NP_441294.1_7 Reverse -89 -103 20.6733 0.00181
NP_441294.1_7 Forward -106 -92 11.3624 0.147
NP_441294.1_7 Reverse -296 -310 9.53859 0.241
NP_441646.1_1 Reverse -86 -105 5.70265 0.176
NP_442438.1_10 Reverse -88 -102 10.4227 0.0536
NP_441000.1_6 Forward -103 -89 -4.32697 0.237
NP_440147.1_4 Forward -104 -91 11.4257 0.0326
NP_440147.1_4 Reverse -91 -104 11.4257 0.0326
NP_441550.1_8 Reverse -91 -101 14.6309 0.0132
NP_441550.1_8 Forward -104 -94 14.6309 0.0132
NP_441916.1_7 Forward -102 -92 10.3048 0.0261
NP_441916.1_7 Reverse -93 -103 10.3048 0.0261
NP_441916.1_7 Forward -309 -299 4.69992 0.163
NP_441041.1_4 Forward -95 -76 -3.24547 0.12
NP_441041.1_4 Reverse -241 -260 -7.67036 0.191
NP_441041.1_4 Forward -315 -296 -9.83364 0.223
NP_441041.1_4 Reverse -81 -100 -11.8986 0.254
NP_441041.1_7 Forward -105 -93 11.8878 0.0689
NP_441041.1_7 Reverse -90 -102 11.8878 0.0689
NP_442396.1_5 Forward -106 -93 11.7207 0.0913
NP_442396.1_5 Reverse -89 -102 10.7374 0.106
NP_441547.1_2 Reverse -161 -179 5.03403 0.231
NP_442004.1_6 Forward -102 -88 8.45605 0.14
NP_441725.1_4 Forward -246 -232 10.2254 0.129
NP_441725.1_5 Forward -101 -91 2.04498 0.115
NP_441725.1_5 Reverse -94 -104 2.04498 0.115
NP_439966.1_7 Reverse -91 -101 7.25606 0.15
NP_439966.1_7 Forward -104 -94 7.25606 0.15
NP_439966.1_9 Reverse -84 -93 3.83464 0.253
NP_442941.1_3 Forward -101 -91 11.0914 0.0116
NP_442941.1_3 Reverse -94 -104 11.0914 0.0116
NP_440289.1_2 Forward -105 -92 4.54251 0.066
NP_440289.1_2 Reverse -90 -103 4.54251 0.066
NP_440260.1_8 Reverse -84 -102 -4.60241 0.273
NP_442281.1_1 Forward -107 -93 8.84875 0.075
NP_442281.1_1 Reverse -88 -102 8.25877 0.0832
NP_442281.1_1 Forward -100 -86 2.45727 0.266
NP_442500.1_8 Reverse -26 -40 8.73228 0.288
NP_441644.1_6 Forward -102 -92 17.3841 0.00127
NP_441644.1_6 Reverse -93 -103 17.3841 0.00127
NP_441644.1_6 Forward -309 -299 5.28945 0.199
NP_441644.1_6 Reverse -300 -310 3.71617 0.267
NP_442215.1_2 Forward -104 -88 13.6282 0.0225
NP_442215.1_2 Reverse -91 -107 13.5299 0.023
NP_442215.1_2 Reverse -40 -56 -1.02311 0.177
NP_442215.1_2 Reverse -298 -314 -2.98973 0.207
NP_442029.1_6 Forward -314 -295 13.3725 0.141
NP_440929.1_8 Forward -102 -93 19.2726 0.000701
NP_440929.1_8 Reverse -93 -102 19.2726 0.000701
NP_442933.1_10 Forward -102 -93 17.601 0.00325
NP_442933.1_10 Reverse -93 -102 17.601 0.00325
NP_442933.1_10 Forward -309 -300 5.11294 0.204
NP_440430.1_3 Forward -207 -189 14.4738 0.263
NP_441751.2_8 Forward -101 -87 14.7492 0.0119
NP_441751.2_8 Reverse -94 -108 2.45787 0.082
NP_442554.1_8 Forward -101 -91 15.3197 0.00882
NP_442554.1_8 Reverse -94 -104 15.3197 0.00882
NP_442554.1_8 Reverse -301 -311 4.69992 0.176
NP_441762.1_7 Forward -103 -91 0.432302 0.0747
NP_441762.1_7 Reverse -92 -104 0.432302 0.0747
NP_442142.1_4 Forward -105 -92 10.9334 0.0646
NP_442142.1_4 Reverse -90 -103 10.9334 0.0646
NP_442292.1_1 Forward -101 -92 18.486 0.00229
NP_442292.1_1 Reverse -94 -103 18.486 0.00229
NP_442292.1_1 Reverse -301 -310 5.99792 0.125
NP_443009.1_2 Reverse -95 -114 -0.590531 0.226
NP_443009.1_5 Reverse -92 -103 8.90795 0.0965
NP_443009.1_5 Forward -103 -92 8.90795 0.0965
NP_441715.1_4 Reverse -94 -104 7.94484 0.107
NP_441715.1_4 Forward -101 -91 7.94484 0.107
NP_440015.1_9 Forward -102 -84 12.3105 0.0791
NP_440730.1_4 Forward -280 -261 3.44104 0.237
NP_441448.1_1 Forward -54 -35 5.89931 0.26
NP_440464.1_10 Forward -101 -91 13.0082 0.169
NP_440464.1_10 Reverse -94 -104 13.0082 0.169
NP_441468.1_1 Forward -101 -94 15.8704 0.0124
NP_441468.1_1 Reverse -94 -101 15.8704 0.0124
NP_441468.1_1 Forward -308 -301 4.46401 0.224
NP_441673.1_1 Forward -102 -93 20.8459 0.000698
NP_441673.1_1 Reverse -93 -102 20.8459 0.000698
NP_441826.1_2 Reverse -87 -101 5.40779 0.0975
NP_441826.1_2 Forward -108 -94 -4.4253 0.296
NP_442868.1_6 Forward -104 -94 9.81313 0.038
NP_442868.1_6 Reverse -91 -101 9.81313 0.038
NP_442719.1_2 Forward -331 -313 -2.04653 0.182
NP_442719.1_2 Forward -190 -172 -11.0929 0.287
NP_442719.1_2 Forward -330 -312 -11.1913 0.29
NP_441056.1_1 Forward -102 -83 -8.752 0.283
NP_441612.1_2 Reverse -93 -103 8.54929 0.21
NP_441612.1_2 Forward -102 -92 8.54929 0.21
NP_442427.1_7 Forward -348 -329 25.0739 0.00456
NP_442427.1_8 Forward -111 -92 18.6823 0.036
NP_442427.1_8 Reverse -26 -45 7.66927 0.208
NP_442808.1_1 Reverse -92 -102 8.63269 0.0481
NP_442808.1_1 Forward -103 -93 8.63269 0.0481
NP_442692.1_10 Reverse -198 -211 18.1571 0.175
NP_440145.1_3 Reverse -312 -331 -0.688862 0.143
NP_442050.1_5 Forward -104 -94 7.64939 0.243
NP_442050.1_5 Reverse -91 -101 7.64939 0.243
NP_441114.1_3 Forward -329 -320 7.86621 0.231
NP_440558.1_2 Forward -355 -336 -3.63879 0.237
NP_440558.1_2 Reverse -209 -228 -5.31042 0.256
NP_441878.1_6 Forward -103 -93 10.4031 0.0176
NP_441878.1_6 Reverse -92 -102 10.4031 0.0176
NP_441878.1_6 Reverse -73 -83 0.57002 0.14
NP_441878.1_6 Forward -310 -300 -7.29646 0.217
NP_441878.1_6 Reverse -166 -176 -7.78811 0.266
NP_441036.1_8 Forward -103 -93 8.33817 0.174
NP_441036.1_8 Reverse -92 -102 8.33817 0.174
NP_441557.1_5 Forward -102 -93 19.9609 0.000699
NP_441557.1_5 Reverse -93 -102 19.9609 0.000699
NP_441557.1_5 Forward -309 -300 -0.491928 0.193
NP_441445.1_1 Reverse -84 -103 16.4207 0.0383
NP_441445.1_1 Forward -111 -92 14.4541 0.05
NP_442066.2_9 Forward -106 -93 8.9674 0.183
NP_441458.1_10 Forward -111 -92 12.9791 0.0856
NP_441458.1_10 Reverse -84 -103 4.03102 0.236
NP_442183.1_9 Forward -312 -302 14.7297 0.206
NP_441574.1_1 Forward -309 -290 1.27776 0.179
NP_442347.1_2 Forward -101 -92 12.4878 0.056
NP_442347.1_2 Reverse -94 -103 12.4878 0.056
NP_442645.1_2 Reverse -85 -104 4.32602 0.0238
NP_442645.1_2 Forward -110 -91 -13.0786 0.145
NP_441037.1_4 Forward -104 -94 7.9999 0.237
NP_441037.1_4 Reverse -91 -101 7.9999 0.237
NP_442594.1_8 Forward -223 -204 4.03102 0.274
NP_441633.1_3 Forward -104 -91 1.19926 0.109
NP_441633.1_3 Reverse -91 -104 1.19926 0.109
NP_440136.1_2 Forward -101 -94 15.9687 0.0123
NP_440136.1_2 Reverse -94 -101 15.9687 0.0123
NP_442590.1_10 Forward -102 -83 10.0292 0.183
NP_442998.1_5 Reverse -32 -42 15.2213 0.149
NP_442998.1_5 Forward -208 -198 14.3364 0.149
NP_442998.1_5 Forward -207 -197 11.3864 0.187
NP_442998.1_10 Forward -100 -93 15.5754 0.0102
NP_442998.1_10 Reverse -95 -102 15.5754 0.0102
NP_442998.1_10 Forward -56 -49 10.4622 0.0819
NP_440899.1_8 Forward -40 -21 -5.80207 0.231
NP_440299.1_1 Reverse -89 -102 10.3434 0.0573
NP_440299.1_1 Forward -106 -93 4.34528 0.209
NP_440299.1_1 Forward -313 -300 3.85363 0.228
NP_440299.1_1 Reverse -296 -309 2.67367 0.279
NP_440810.1_9 Reverse -119 -138 17.7974 0.107
NP_441799.1_1 Forward -106 -92 15.8302 0.0163
NP_441799.1_1 Reverse -89 -103 14.8469 0.0221
NP_440640.1_6 Forward -324 -305 0.491109 0.272
NP_441007.1_10 Forward -107 -94 2.87088 0.183
NP_441007.1_10 Reverse -88 -101 2.67422 0.183
NP_442334.1_2 Reverse -312 -329 -14.3175 0.3
NP_440256.1_1 Forward -105 -86 -4.22878 0.15
NP_440915.1_6 Reverse -89 -103 1.67122 0.132
NP_442158.1_4 Forward -28 -18 15.9097 0.129
NP_442158.1_4 Forward -54 -44 10.3048 0.299
NP_442855.1_3 Reverse -84 -103 11.6025 0.258
NP_440717.1_1 Reverse -301 -320 6.29264 0.265
NP_441866.1_4 Reverse -228 -241 15.871 0.261
NP_441464.1_8 Forward -102 -88 5.50613 0.253
NP_441464.1_8 Reverse -93 -107 4.62115 0.269
NP_441464.1_10 Reverse -163 -177 8.55439 0.28
NP_441939.1_4 Reverse -192 -211 17.9043 0.137
NP_442993.1_1 Forward -102 -86 -8.59459 0.17
NP_442993.1_1 Reverse -93 -109 -9.5779 0.188
NP_442993.1_1 Forward -196 -180 -11.2495 0.24
NP_442386.1_9 Reverse -92 -101 13.8639 0.0289
NP_442386.1_9 Forward -103 -94 13.8639 0.0289
NP_442386.1_9 Forward -96 -87 5.40752 0.253
NP_440570.1_5 Reverse -77 -96 13.2741 0.12
NP_441340.1_5 Forward -101 -94 15.6737 0.0124
NP_441340.1_5 Reverse -94 -101 15.6737 0.0124
NP_441340.1_5 Reverse -301 -308 3.97235 0.274
NP_442484.1_2 Forward -320 -301 0.392778 0.248
NP_442791.1_5 Reverse -85 -104 -9.44032 0.279
NP_441952.1_9 Reverse -22 -41 19.3381 0.231
NP_440327.1_6 Forward -321 -302 7.47261 0.228
NP_442714.1_7 Reverse -94 -113 -0.39387 0.263
NP_441027.1_1 Forward -46 -32 13.372 0.27
NP_441027.1_1 Forward -259 -245 13.077 0.27
NP_440586.1_1 Forward -313 -294 6.29264 0.182
NP_440586.1_8 Forward -101 -94 13.2151 0.026
NP_440586.1_8 Reverse -94 -101 13.2151 0.026
NP_442251.1_6 Forward -101 -94 15.2804 0.0124
NP_442251.1_6 Reverse -94 -101 15.2804 0.0124
NP_442959.1_5 Forward -162 -143 4.71934 0.3
NP_440684.1_9 Reverse -87 -101 16.7159 0.0687
NP_441262.1_3 Reverse -93 -100 14.7888 0.0223
NP_441262.1_3 Forward -102 -95 14.7888 0.0223
NP_440027.1_8 Forward -99 -80 5.89851 0.279
NP_440027.1_8 Forward -105 -86 4.62021 0.287
NP_443051.1_1 Reverse -92 -101 10.4228 0.00754
NP_443051.1_1 Forward -103 -94 10.4228 0.00754
NP_440372.1_2 Forward -101 -94 16.3621 0.0124
NP_440372.1_2 Reverse -94 -101 16.3621 0.0124
NP_440139.1_1 Reverse -87 -106 0.883656 0.279
NP_440267.1_2 Reverse -271 -285 9.53707 0.156
NP_442384.1_10 Forward -102 -89 9.06573 0.0574
NP_442384.1_10 Reverse -93 -106 8.18076 0.0685
NP_441604.1_4 Forward -317 -298 3.14605 0.211
NP_441604.1_4 Reverse -159 -178 -3.73712 0.218
NP_441018.1_7 Reverse -83 -102 13.1758 0.14
NP_441018.1_7 Forward -106 -87 8.16093 0.255
NP_442262.1_10 Forward -101 -94 14.1988 0.0123
NP_442262.1_10 Reverse -94 -101 14.1988 0.0123
NP_441689.1_5 Forward -104 -94 5.78111 0.197
NP_441689.1_5 Reverse -91 -101 5.78111 0.197
NP_440344.1_10 Reverse -86 -103 1.51381 0.0304
NP_440344.1_10 Forward -109 -92 1.12048 0.0317
NP_440282.1_3 Reverse -295 -314 5.01433 0.237
NP_440282.1_10 Reverse -64 -83 -6.39206 0.25
NP_440531.1_6 Forward -110 -91 2.3594 0.158
NP_440531.1_6 Reverse -85 -104 -4.03212 0.273
NP_440531.1_6 Forward -323 -304 -4.42544 0.28
NP_441965.1_10 Reverse -90 -106 2.61514 0.285
NP_442065.1_7 Reverse -84 -102 3.46073 0.215
NP_440297.1_9 Forward -101 -91 -0.118297 0.282
NP_440297.1_9 Reverse -94 -104 -0.118297 0.282
NP_442280.1_10 Forward -334 -316 7.30503 0.268
NP_440894.1_10 Forward -326 -307 5.01433 0.24
NP_440937.1_5 Forward -64 -45 7.47261 0.299
NP_440999.1_9 Forward -106 -92 1.17956 0.169
NP_440999.1_9 Reverse -296 -310 0.687908 0.177
NP_440888.1_2 Forward -102 -88 10.422 0.0946
NP_440888.1_2 Reverse -300 -314 8.25877 0.167
NP_440888.1_2 Reverse -93 -107 7.66879 0.186
NP_440803.1_8 Forward -387 -368 15.6341 0.221
NP_440600.1_4 Reverse -292 -310 -4.01242 0.249
NP_440052.1_5 Forward -320 -301 0.982764 0.171
NP_442277.1_4 Reverse -291 -310 2.55527 0.243
NP_441543.1_2 Forward -101 -92 16.9127 0.00359
NP_441543.1_2 Reverse -94 -103 16.9127 0.00359
NP_441543.1_2 Reverse -301 -310 5.11294 0.209
NP_442845.1_2 Reverse -87 -101 17.0108 0.0608
NP_442845.1_2 Forward -108 -94 4.71948 0.254
NP_440982.1_1 Forward -181 -162 4.42355 0.294
NP_441469.1_8 Reverse -69 -78 12.6844 0.0995
NP_441469.1_8 Forward -103 -94 6.48957 0.227
NP_441469.1_8 Reverse -92 -101 6.48957 0.227
NP_443064.1_6 Forward -102 -92 12.5669 0.0796
NP_443064.1_6 Reverse -93 -103 12.5669 0.0796
NP_442578.1_7 Forward -101 -94 14.5921 0.026
NP_442578.1_7 Reverse -94 -101 14.5921 0.026
NP_440071.1_1 Reverse -299 -316 9.28121 0.267
NP_440220.1_4 Forward -38 -19 -1.67294 0.264
NP_441462.1_2 Forward -102 -92 11.5831 0.00406
NP_441462.1_2 Reverse -93 -103 11.5831 0.00406
NP_441462.1_2 Forward -309 -299 0.0783647 0.168
NP_443062.1_1 Forward -102 -84 4.74314 0.25
NP_443062.1_6 Forward -110 -91 4.22769 0.221
NP_442204.1_2 Forward -225 -206 7.47261 0.276
NP_440516.1_2 Forward -108 -90 2.57575 0.169
NP_440516.1_8 Forward -102 -93 16.9127 0.00442
NP_440516.1_8 Reverse -93 -102 16.9127 0.00442
NP_442428.1_5 Forward -101 -94 15.8704 0.0124
NP_442428.1_5 Reverse -94 -101 15.8704 0.0124
NP_442428.1_5 Forward -308 -301 4.759 0.223
NP_442120.1_10 Forward -64 -45 -15.5368 0.294
NP_440673.1_3 Forward -100 -93 12.4288 0.0426
NP_440673.1_3 Reverse -95 -102 12.4288 0.0426
NP_441714.1_3 Reverse -86 -104 16.5379 0.119
NP_441714.1_3 Forward -109 -91 12.4081 0.294
NP_441052.1_2 Forward -102 -92 19.9412 0.00106
NP_441052.1_2 Reverse -93 -103 19.9412 0.00106
NP_442219.1_8 Reverse -32 -51 8.94017 0.238
NP_442219.1_9 Forward -101 -92 17.7976 0.00718
NP_442219.1_9 Reverse -94 -103 17.7976 0.00718
NP_440436.1_4 Forward -101 -92 17.2072 0.00233
NP_440436.1_4 Reverse -94 -103 17.2072 0.00233
NP_440436.1_4 Reverse -301 -310 4.7192 0.244
NP_440648.1_6 Reverse -187 -206 10.4217 0.174
NP_441086.1_3 Forward -128 -109 7.00151 0.276
NP_441719.1_4 Forward -101 -94 16.3621 0.0124
NP_441719.1_4 Reverse -94 -101 16.3621 0.0124
NP_442813.1_4 Forward -324 -305 -7.86702 0.299
NP_442366.1_3 Reverse -85 -103 2.96908 0.118
NP_442366.1_3 Reverse -92 -110 -2.63579 0.231
NP_442366.1_3 Forward -103 -85 -3.42244 0.247
NP_442366.1_5 Reverse -90 -100 14.8275 0.0375
NP_442366.1_5 Forward -105 -95 14.8275 0.0375
NP_442139.1_7 Forward -320 -301 7.27595 0.287
NP_443054.1_2 Forward -104 -90 1.76955 0.245
NP_443054.1_2 Reverse -91 -105 1.76955 0.245
NP_441851.1_10 Forward -103 -93 15.8113 0.00552
NP_441851.1_10 Reverse -92 -102 15.8113 0.00552
NP_441851.1_10 Forward -310 -300 6.07655 0.187
NP_441668.1_4 Forward -319 -300 6.39097 0.163
NP_441668.1_4 Forward -112 -93 4.81767 0.173
NP_441668.1_4 Reverse -313 -332 0.884433 0.229
NP_442515.1_1 Reverse -92 -106 4.03116 0.109
NP_442515.1_1 Reverse -180 -194 -4.4253 0.298
NP_442515.1_1 Forward -103 -89 -5.01529 0.298
NP_441683.1_7 Forward -297 -278 -5.80207 0.264
NP_440593.1_3 Forward -314 -295 4.62101 0.133
NP_440593.1_3 Reverse -295 -314 -5.11376 0.258
NP_441349.1_10 Reverse -83 -102 10.0292 0.0234
NP_441349.1_10 Forward -112 -93 -2.36049 0.118
NP_442843.1_1 Forward -51 -32 -0.000545616 0.176
NP_439960.1_3 Forward -83 -64 0.0977854 0.297
NP_440431.1_3 Reverse -299 -318 -9.44032 0.246
NP_442450.1_5 Reverse -91 -101 7.55152 0.13
NP_442450.1_5 Forward -104 -94 7.55152 0.13
NP_439950.1_1 Reverse -328 -337 15.1427 0.156
NP_442006.1_2 Reverse -306 -323 -9.79426 0.197
NP_442006.1_2 Reverse -314 -331 -19.234 0.299
NP_441570.1_1 Forward -102 -84 -7.84733 0.0968
NP_441078.1_4 Forward -102 -93 19.6659 0.0007
NP_441078.1_4 Reverse -93 -102 19.6659 0.0007
NP_441078.1_4 Forward -309 -300 -1.86856 0.272
NP_442443.1_1 Forward -51 -32 -6.78538 0.298
NP_440526.1_3 Forward -101 -90 10.2846 0.0646
NP_440526.1_3 Reverse -94 -105 10.2846 0.0646
NP_440526.1_3 Forward -338 -327 4.18809 0.267
NP_441432.1_8 Reverse -92 -101 16.8143 0.00595
NP_441432.1_8 Forward -103 -94 16.8143 0.00595
NP_441432.1_8 Forward -310 -301 4.81794 0.196
NP_441432.1_8 Reverse -86 -95 2.55633 0.298
NP_441432.1_9 Forward -40 -27 16.161 0.121
NP_442320.1_8 Reverse -87 -101 -2.45868 0.0894
NP_441732.1_2 Reverse -89 -105 -16.5594 0.174
NP_441732.1_2 Forward -106 -90 -16.6577 0.186
NP_441732.1_2 Reverse -296 -312 -17.5427 0.27
NP_440760.1_1 Reverse -93 -112 -6.09707 0.0549
NP_440760.1_1 Forward -102 -83 -22.125 0.249
NP_440199.1_10 Forward -105 -95 7.25653 0.231
NP_440199.1_10 Reverse -90 -100 7.25653 0.231
NP_441057.1_4 Forward -325 -307 7.78729 0.164
NP_442353.1_4 Forward -108 -89 1.76863 0.242
NP_441072.1_2 Reverse -82 -101 9.0459 0.225
NP_440713.1_4 Reverse -83 -102 0.982764 0.298
NP_442489.1_7 Forward -102 -93 20.1576 0.000695
NP_442489.1_7 Reverse -93 -102 20.1576 0.000695
NP_442489.1_7 Forward -309 -300 -1.37691 0.195
NP_440559.1_1 Forward -101 -92 17.4043 0.00658
NP_440559.1_1 Reverse -94 -103 17.4043 0.00658
NP_441659.2_8 Forward -102 -92 18.1713 0.00133
NP_441659.2_8 Reverse -93 -103 18.1713 0.00133
NP_441659.2_8 Reverse -300 -310 10.8948 0.0212
NP_442913.1_10 Forward -111 -92 4.03102 0.0942
NP_442913.1_10 Reverse -291 -310 -3.44213 0.21
NP_441040.1_2 Forward -317 -298 -10.0303 0.243
NP_442849.1_1 Reverse -320 -334 16.0275 0.201
NP_442849.1_6 Forward -36 -22 13.8643 0.242
NP_442776.1_1 Reverse -301 -320 3.44104 0.288
NP_442346.1_5 Forward -103 -93 16.6963 0.00248
NP_442346.1_5 Reverse -92 -102 16.6963 0.00248
NP_442346.1_5 Reverse -299 -309 9.12481 0.118
NP_442346.1_5 Forward -310 -300 5.97822 0.219
NP_441856.1_3 Forward -279 -260 -3.04881 0.275
NP_441629.1_3 Reverse -293 -312 0.392004 0.235
NP_441786.1_10 Reverse -84 -103 5.89931 0.287
NP_440459.1_2 Reverse -78 -95 10.4619 0.198
NP_440459.1_2 Reverse -298 -315 7.217 0.299
NP_442551.1_4 Forward -85 -70 4.1098 0.245
NP_441833.1_4 Forward -101 -94 15.9687 0.0124
NP_441833.1_4 Reverse -94 -101 15.9687 0.0124
NP_442699.1_8 Forward -214 -195 -12.2919 0.247
NP_442162.1_9 Forward -101 -94 16.2637 0.0124
NP_442162.1_9 Reverse -94 -101 16.2637 0.0124
NP_440671.1_4 Reverse -80 -94 9.5377 0.18
NP_440671.1_4 Reverse -87 -101 7.9644 0.205
NP_442140.1_3 Forward -101 -91 12.2714 0.0632
NP_442140.1_3 Reverse -94 -104 12.2714 0.0632
NP_442723.1_1 Forward -106 -87 1.86696 0.292
NP_441813.1_5 Reverse -91 -101 8.63316 0.0367
NP_441813.1_5 Forward -104 -94 8.63316 0.0367
NP_440594.1_6 Reverse -87 -106 9.43841 0.203
NP_440590.1_4 Reverse -94 -107 11.4257 0.0202
NP_440590.1_4 Forward -101 -88 9.36073 0.0365
NP_440590.1_4 Reverse -87 -100 -1.45568 0.22
NP_440590.1_4 Reverse -301 -314 -1.75067 0.228
NP_440567.1_1 Forward -101 -87 15.9292 0.0166
NP_442839.1_8 Forward -319 -300 18.1907 0.22
NP_442497.1_10 Forward -101 -92 10.4228 0.0087
NP_442497.1_10 Reverse -94 -103 10.4228 0.0087
NP_440821.1_4 Reverse -91 -101 9.41981 0.0286
NP_440821.1_4 Forward -104 -94 9.41981 0.0286
NP_441239.1_9 Forward -104 -92 3.38223 0.285
NP_441239.1_9 Reverse -91 -103 3.38223 0.285
NP_441951.1_4 Forward -315 -296 2.94938 0.283
NP_440706.1_1 Reverse -89 -108 -5.21209 0.268
NP_441892.1_1 Reverse -84 -101 7.217 0.0915
NP_441892.1_1 Reverse -291 -308 -0.944468 0.193
NP_440665.1_1 Forward -321 -302 -16.5201 0.291
NP_442193.1_8 Forward -105 -86 12.29 0.234
NP_442270.1_9 Reverse -82 -101 -6.58872 0.207
NP_442643.1_5 Reverse -318 -337 -5.99873 0.293
NP_440833.1_6 Forward -45 -31 9.53707 0.261
NP_441567.1_4 Forward -42 -23 3.24438 0.29
NP_441567.1_10 Reverse -291 -310 15.5349 0.299
NP_440546.1_4 Forward -102 -92 10.046 0.109
NP_440546.1_4 Reverse -93 -103 10.046 0.109
NP_440462.1_6 Reverse -91 -101 1.35667 0.294
NP_440462.1_6 Forward -104 -94 1.35667 0.294
NP_440868.1_4 Forward -106 -94 8.20045 0.0602
NP_440868.1_4 Reverse -89 -101 6.23383 0.0878
NP_442499.1_1 Reverse -204 -223 3.83436 0.247
NP_440341.1_1 Reverse -165 -184 5.01433 0.236
NP_442402.1_4 Forward -39 -20 -9.83437 0.293
NP_440653.1_10 Reverse -75 -94 7.86593 0.201
NP_442460.1_7 Reverse -81 -100 5.89931 0.167
NP_440696.1_3 Forward -319 -301 -1.25915 0.253
NP_442039.1_4 Forward -101 -94 15.1821 0.0124
NP_442039.1_4 Reverse -94 -101 15.1821 0.0124
NP_441811.1_8 Reverse -87 -101 6.98109 0.259
NP_442679.1_1 Reverse -20 -39 6.19431 0.147
NP_440825.1_6 Forward -206 -187 15.5357 0.218
NP_440825.1_7 Reverse -94 -104 12.9096 0.152
NP_440825.1_7 Forward -101 -91 12.9096 0.152
NP_442837.1_3 Forward -101 -94 15.7721 0.0124
NP_442837.1_3 Reverse -94 -101 15.7721 0.0124
NP_442053.1_1 Forward -102 -93 18.3876 0.0007
NP_442053.1_1 Reverse -93 -102 18.3876 0.0007
NP_440505.1_3 Reverse -47 -57 9.41981 0.122
NP_440505.1_3 Forward -104 -94 9.22315 0.122
NP_440505.1_3 Reverse -91 -101 9.22315 0.122
NP_442456.1_5 Reverse -161 -179 5.72234 0.283
NP_440013.1_1 Forward -41 -22 11.995 0.209
NP_440013.1_2 Reverse -86 -100 18.3875 0.115
NP_441408.2_7 Reverse -298 -317 -0.000545616 0.228
NP_440914.1_1 Forward -102 -92 17.5935 0.000537
NP_440914.1_1 Reverse -93 -103 17.5935 0.000537
NP_440914.1_1 Reverse -212 -222 9.20065 0.186
NP_441011.1_8 Forward -101 -92 8.25953 0.144
NP_441011.1_8 Reverse -94 -103 8.25953 0.144
NP_441011.1_8 Forward -308 -299 4.91628 0.296
NP_442533.1_6 Forward -102 -93 17.2076 0.00137
NP_442533.1_6 Reverse -93 -102 17.2076 0.00137
NP_442533.1_6 Forward -309 -300 11.5045 0.0432
NP_442533.1_6 Reverse -168 -177 3.34298 0.216
NP_442533.1_6 Reverse -167 -176 1.47469 0.298
NP_442541.1_10 Reverse -256 -270 1.76896 0.279
NP_442232.1_3 Reverse -85 -104 -12.9802 0.282
NP_442322.1_4 Forward -183 -166 -0.650168 0.221
NP_442229.1_1 Forward -104 -90 8.55376 0.184
NP_442229.1_1 Reverse -91 -105 8.55376 0.184
NP_439944.1_9 Forward -101 -91 10.5014 0.0887
NP_439944.1_9 Reverse -94 -104 10.5014 0.0887
NP_441028.1_6 Reverse -200 -210 5.78111 0.243
NP_441028.1_6 Forward -186 -176 3.51951 0.292
NP_441028.1_6 Reverse -40 -50 3.51951 0.292
NP_440116.1_8 Forward -101 -82 -6.29373 0.205
NP_441527.1_4 Reverse -315 -334 -12.7486 0.293
NP_441972.1_3 Reverse -311 -330 10.7175 0.298
NP_441106.1_1 Forward -103 -94 9.63616 0.0311
NP_441106.1_1 Reverse -92 -101 9.63616 0.0311
NP_441106.1_1 Reverse -299 -308 5.01461 0.191
NP_440429.1_2 Forward -101 -82 9.24257 0.272
NP_439903.1_6 Reverse -65 -84 0.686995 0.258
NP_001035870.1_3 Reverse -82 -101 -5.50708 0.28
NP_440797.1_2 Reverse -82 -101 15.1022 0.21
NP_441286.1_1 Forward -103 -91 12.9203 0.00815
NP_441286.1_1 Reverse -92 -104 12.9203 0.00815
NP_442674.1_3 Reverse -85 -104 9.34008 0.175
NP_440670.1_8 Forward -102 -93 18.3876 0.000699
NP_440670.1_8 Reverse -93 -102 18.3876 0.000699
NP_439955.1_10 Reverse -50 -69 13.8633 0.258
NP_440886.1_7 Forward -103 -93 7.94438 0.0805
NP_440886.1_7 Reverse -92 -102 7.94438 0.0805
NP_440828.1_1 Reverse -299 -318 -0.492971 0.27
NP_440083.1_9 Forward -211 -192 10.7772 0.281
NP_442614.1_2 Reverse -93 -107 14.1593 0.104
NP_442614.1_2 Forward -102 -88 11.2093 0.206
NP_442072.1_9 Forward -103 -85 -21.122 0.206
NP_442072.1_9 Reverse -73 -91 -22.892 0.266
NP_440907.2_8 Forward -101 -91 7.64939 0.117
NP_440907.2_8 Reverse -94 -104 7.64939 0.117
NP_441021.1_1 Forward -95 -76 -10.9153 0.252
NP_441021.1_1 Forward -101 -82 -11.8986 0.275
NP_441021.1_8 Reverse -88 -106 1.78911 0.258
NP_441463.1_3 Reverse -83 -102 -5.01543 0.22
NP_441463.1_3 Forward -24 -5 -9.53865 0.28
NP_441626.1_2 Forward -101 -94 15.7721 0.0124
NP_441626.1_2 Reverse -94 -101 15.7721 0.0124
NP_442794.1_1 Forward -313 -301 7.11881 0.148
NP_442794.1_1 Reverse -89 -101 2.69391 0.286
NP_442794.1_1 Forward -106 -94 2.59558 0.287
NP_442615.1_1 Forward -111 -93 12.5072 0.0132
NP_442615.1_1 Reverse -84 -102 8.7706 0.0275
NP_442615.1_1 Forward -318 -300 -3.02911 0.154
NP_441962.1_4 Reverse -88 -107 -3.44213 0.148
NP_440387.1_1 Forward -102 -86 6.25339 0.0282
NP_440387.1_1 Reverse -93 -109 -5.84132 0.254
NP_441431.1_2 Reverse -297 -311 11.2087 0.145
NP_440814.1_4 Forward -111 -92 -10.817 0.223
NP_440114.1_10 Forward -102 -88 10.4227 0.148
NP_440114.1_10 Reverse -93 -107 7.37441 0.236
NP_442437.1_8 Reverse -82 -101 9.0459 0.223
NP_440287.1_6 Forward -111 -92 6.78429 0.16
NP_440293.1_9 Forward -314 -300 9.89475 0.285
NP_440766.1_4 Reverse -82 -96 3.24451 0.151
NP_441237.1_9 Forward -101 -91 14.828 0.0242
NP_441237.1_9 Reverse -94 -104 14.828 0.0242
NP_442635.1_5 Reverse -170 -183 18.8005 0.203
NP_440457.1_1 Reverse -89 -101 0.825626 0.25
NP_442680.1_5 Reverse -20 -39 2.22142 0.237
NP_441984.1_3 Reverse -311 -329 8.86894 0.218
NP_441984.1_3 Reverse -70 -88 7.29564 0.253
NP_441332.1_6 Forward -181 -171 12.1308 0.236
NP_441436.1_2 Reverse -315 -334 -6.98204 0.296
NP_441436.1_8 Reverse -321 -340 6.98095 0.296
NP_442509.1_9 Forward -102 -92 8.14104 0.192
NP_442509.1_9 Reverse -93 -103 8.14104 0.192
NP_442509.1_9 Forward -95 -85 5.97777 0.298
NP_442439.1_9 Forward -270 -256 22.3207 0.034
NP_442514.1_5 Forward -183 -164 1.17865 0.178
NP_441885.1_5 Forward -102 -92 20.9245 0.000538
NP_441885.1_5 Reverse -93 -103 20.9245 0.000538
NP_442341.1_7 Reverse -92 -106 14.3559 0.0299
NP_442341.1_7 Forward -103 -89 8.35772 0.0881
NP_442341.1_7 Reverse -73 -87 6.19444 0.134
NP_442341.1_9 Reverse -91 -105 8.84875 0.164
NP_442341.1_9 Forward -104 -90 8.84875 0.164
NP_442395.2_4 Forward -96 -77 14.9449 0.0507
NP_442395.2_4 Forward -181 -162 1.17865 0.249
NP_440191.1_4 Forward -39 -29 13.342 0.282
NP_443000.1_7 Forward -104 -94 10.3048 0.0345
NP_443000.1_7 Reverse -91 -101 10.3048 0.0345
NP_440076.1_5 Reverse -305 -324 17.5998 0.0977
NP_441842.1_10 Reverse -86 -100 7.17775 0.264
NP_440275.1_3 Forward -104 -94 8.04317 0.0602
NP_440275.1_3 Reverse -91 -101 8.04317 0.0602
NP_440091.1_1 Reverse -89 -101 10.7571 0.0429
NP_440091.1_1 Forward -106 -94 1.31728 0.198
NP_441307.1_4 Forward -318 -299 -1.08219 0.273
NP_443060.1_5 Reverse -85 -104 6.98015 0.235
NP_441122.1_1 Reverse -89 -104 4.40479 0.28
NP_441122.1_1 Forward -225 -210 3.42148 0.281
NP_441207.1_7 Forward -384 -370 8.09365 0.293
NP_442495.1_4 Forward -86 -76 13.943 0.183
NP_441105.1_3 Reverse -82 -101 10.4225 0.041
NP_441105.1_3 Forward -113 -94 -3.83545 0.185
NP_440216.1_1 Forward -102 -88 -0.492064 0.0284
NP_440216.1_1 Reverse -93 -107 -9.53851 0.145
NP_440216.1_9 Reverse -18 -27 15.536 0.128
NP_440172.1_1 Forward -102 -92 15.0247 0.00945
NP_440172.1_1 Reverse -93 -103 15.0247 0.00945
NP_440172.1_1 Forward -309 -299 7.64985 0.0754
NP_440249.1_2 Reverse -193 -203 15.3192 0.268
NP_442015.1_10 Reverse -89 -102 1.59258 0.204
NP_442015.1_10 Forward -106 -93 1.49425 0.204
NP_442015.1_10 Reverse -82 -95 0.0192843 0.245
NP_441226.1_7 Forward -101 -94 14.4934 0.0123
NP_441226.1_7 Reverse -94 -101 14.4934 0.0123
NP_441111.1_7 Forward -101 -93 18.7023 0.00294
NP_441111.1_7 Reverse -94 -102 18.7023 0.00294
NP_441111.1_7 Reverse -301 -309 -0.668896 0.274
NP_442379.1_10 Reverse -86 -103 -0.747806 0.223
NP_441766.1_2 Forward -102 -93 17.5026 0.00297
NP_441766.1_2 Reverse -93 -102 17.5026 0.00297
NP_441766.1_2 Forward -309 -300 4.91628 0.154
NP_442417.1_5 Reverse -300 -314 6.78443 0.207
NP_440416.1_9 Reverse -79 -98 -15.1435 0.186
NP_440416.1_9 Reverse -86 -105 -17.2085 0.234
NP_440416.1_9 Forward -316 -297 -19.2734 0.272
NP_443052.1_9 Forward -100 -81 4.03102 0.157
NP_442154.1_1 Forward -323 -305 -9.42063 0.179
NP_440261.1_5 Reverse -94 -107 -2.83231 0.0932
NP_440988.1_10 Forward -91 -77 6.64146 0.232
NP_440988.1_10 Forward -176 -162 5.4797 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTATATCCTGACCCAGAAAAGTTTGATCCAGAACGGTTTACTCCTGATGGTAGTGCAACTCATAATCCTCCCTTTGCCCATGTTCCCTTTGGCGGTGGCTTACGGGAATGTTTAGGTAAGGAATTTGCTCGGCTGGAAATGAAATTATTTGCCACCCGATTAATCCAACAATTTGATTGGACATTGTTACCGGGGCAAAATTTAGAGTTGGTTGTTACCCCTAGTCCCCGGCCCAAAGATAATTTGCGAGTAAAGCTACATTCACTCATGTAATTATTTGGTAGTGAAATTATTATTGGCGATCGCCAATCCCAGTGGCTAGGGACCTCAGTTTTGGTAGATACTATTGCCGTGGGACAATTTGCCCATTTTTTTTCCTTGGTAAGGATATTGACTTAA

CDS

ATGCTTCCTAAAATTTCTTTGGCCGCAGTGGGGTTAACGGTGGGGGGAATCCTCACCATTACAGGCTTTGTGGCCTACGCCCTCGACTATGCCACCCTCAATCTGGCTGGCTTTTTCTATGGCATTCCCTTAGTGTTAGGGGGCTTGGCCCTTAAGGCGGCGGAGTTGAAACCTATTCCATTTAGTCAACCGACCTCAGAAAAAATTATCGCCCTGCGAAACCAACTGGCCACCCCCACCCAAAATCAAATTCGCAAAGATGTGACCCGTTACCGTTACGGCCAGGAAGCCCATCTGGACGAATCCCTAGAGCGCCTAGGTTTGAGTCCCACGGATGAAGAAAGACCAGTACTCACTAGTCTTTTGGAACAGGATTGGGAGGGAAAATACGTGCTTACCCTAACCTTTACCTCCCCCTTCATCAGCCTGGAAACTTGGCAGGAAAAGCAGGAAAAAATTGCCAAATTCTTCGGCCCAGACCTGGAAGTTACCGTCGCTGAGCCGGAAGAAAAAGTGGTGACAGTGAATCTAATTTCCCAATTAGCCCTCCCGTAA

Protein

MLPKISLAAVGLTVGGILTITGFVAYALDYATLNLAGFFYGIPLVLGGLALKAAELKPIPFSQPTSEKIIALRNQLATPTQNQIRKDVTRYRYGQEAHLDESLERLGLSPTDEERPVLTSLLEQDWEGKYVLTLTFTSPFISLETWQEKQEKIAKFFGPDLEVTVAEPEEKVVTVNLISQLALP