Your browser is old and dusty. Try Google Chrome!

Details for slr0556

ORF slr0556
Accession NP_442806.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -251 -258 8.8889 0.188
NP_441418.1_6 Forward -93 -74 -23.01 0.19
NP_442291.1_7 Reverse -377 -391 13.2743 0.211
NP_442291.1_7 Reverse -246 -260 9.73436 0.26
NP_442291.1_7 Forward -388 -374 9.34103 0.283
NP_441453.1_4 Forward -259 -251 11.5241 0.043
NP_442151.1_10 Forward -108 -90 12.0155 0.289
NP_442744.1_8 Forward -259 -240 -6.09707 0.297
NP_442655.1_1 Forward -264 -245 -1.27885 0.261
NP_442975.1_10 Reverse -338 -352 5.01387 0.234
NP_442975.1_10 Reverse -80 -94 4.42388 0.245
NP_442062.1_8 Reverse -387 -397 7.94484 0.0848
NP_442062.1_8 Forward -259 -249 4.79825 0.198
NP_441900.1_1 Forward -397 -378 15.1231 0.156
NP_440908.1_2 Forward -349 -336 14.2767 0.269
NP_440011.1_1 Reverse -36 -55 11.5042 0.27
NP_441619.1_9 Reverse -354 -373 6.58763 0.203
NP_441955.1_8 Reverse -7 -24 6.13536 0.281
NP_442889.1_1 Forward -265 -246 -0.295539 0.145
NP_442889.1_1 Reverse -369 -388 -15.6352 0.297
NP_441025.1_6 Forward -120 -101 2.1115 0.28
NP_441716.1_1 Reverse -240 -254 3.44117 0.265
NP_441209.1_8 Forward -330 -312 8.17404 0.259
NP_440747.1_1 Reverse -166 -184 13.8838 0.183
NP_440747.1_10 Forward -262 -250 -4.68091 0.115
NP_441130.1_7 Forward -189 -175 17.9935 0.287
NP_441486.1_1 Forward -262 -248 4.12949 0.0492
NP_440944.1_2 Reverse -1 -20 19.8623 0.00978
NP_442634.1_4 Forward -272 -258 -5.9986 0.291
NP_440842.1_4 Reverse -104 -123 4.41257 0.202
NP_441014.1_5 Forward -368 -350 12.9005 0.231
NP_441014.1_5 Forward -263 -245 9.36059 0.276
NP_443018.1_3 Forward -258 -251 4.56234 0.241
NP_443018.1_3 Reverse -251 -258 4.46401 0.244
NP_442687.1_7 Reverse -360 -370 11.3864 0.0994
NP_442687.1_7 Forward -91 -81 4.10993 0.266
NP_442485.1_2 Forward -351 -332 10.2259 0.288
NP_442485.1_3 Reverse -49 -68 -6.1954 0.299
NP_440533.1_6 Forward -368 -349 10.2259 0.274
NP_441763.1_10 Forward -322 -303 6.58682 0.269
NP_440360.1_10 Reverse -342 -356 3.8345 0.227
NP_440141.1_8 Forward -357 -338 7.37428 0.24
NP_442782.1_2 Forward -270 -256 9.63603 0.198
NP_442782.1_2 Reverse -361 -375 -0.000409212 0.297
NP_442496.1_5 Reverse -45 -63 7.59063 0.256
NP_442836.1_8 Reverse -369 -384 16.1062 0.236
NP_440203.1_5 Forward -394 -384 14.5325 0.0886
NP_443001.1_7 Reverse -376 -395 2.45773 0.279
NP_440325.1_1 Forward -122 -103 12.2908 0.24
NP_442236.1_3 Reverse -333 -352 6.29264 0.292
NP_441294.1_7 Forward -299 -285 10.3065 0.197
NP_441646.1_1 Forward -391 -372 0.491109 0.251
NP_441292.1_2 Forward -306 -287 4.42435 0.137
NP_441674.1_10 Reverse -235 -253 1.59244 0.259
NP_440147.1_4 Reverse -248 -261 -0.0790467 0.271
NP_441916.1_7 Forward -259 -249 1.94665 0.268
NP_441041.1_4 Reverse -250 -269 -12.1936 0.26
NP_442396.1_1 Forward -339 -321 11.8189 0.223
NP_440569.1_7 Forward -318 -299 9.73422 0.286
NP_442004.1_6 Reverse -250 -264 3.53951 0.238
NP_440703.1_9 Forward -384 -371 15.1616 0.157
NP_440289.1_2 Reverse -66 -79 -3.61896 0.267
NP_441678.1_9 Forward -271 -252 0.392778 0.225
NP_441678.1_9 Forward -92 -73 -2.26216 0.257
NP_442281.1_1 Reverse -245 -259 9.34041 0.0717
NP_442575.1_8 Reverse -41 -60 9.43923 0.124
NP_442256.1_2 Forward -357 -339 -9.81395 0.292
NP_442012.1_1 Forward -265 -246 13.6675 0.058
NP_441087.1_6 Reverse -242 -260 0.510066 0.258
NP_443030.1_1 Forward -124 -107 6.72535 0.284
NP_441644.1_6 Reverse -250 -260 3.91283 0.256
NP_441644.1_6 Reverse -382 -392 3.42118 0.282
NP_442215.1_2 Forward -261 -245 8.71166 0.062
NP_442215.1_2 Reverse -373 -389 2.8118 0.108
NP_442933.1_10 Reverse -250 -259 4.42462 0.246
NP_442554.1_8 Reverse -251 -261 4.99491 0.163
NP_442554.1_8 Forward -390 -380 2.33998 0.274
NP_441762.1_7 Reverse -12 -24 -5.56589 0.217
NP_442142.1_9 Reverse -168 -187 7.96426 0.254
NP_442292.1_5 Reverse -371 -390 -2.45882 0.29
NP_442476.1_5 Reverse -150 -169 17.8957 0.166
NP_441523.1_6 Forward -303 -284 2.65439 0.286
NP_442301.1_4 Forward -63 -44 15.4366 0.291
NP_441198.1_8 Forward -203 -193 10.9275 0.232
NP_441758.1_10 Reverse -118 -137 -1.96793 0.275
NP_441468.1_1 Reverse -251 -258 3.97235 0.277
NP_441618.1_6 Reverse -376 -395 11.0125 0.3
NP_441015.1_10 Reverse -41 -60 -1.67217 0.174
NP_441015.1_10 Forward -264 -245 -2.55715 0.178
NP_441764.1_4 Forward -123 -106 12.4644 0.186
NP_442719.1_2 Reverse -262 -280 -4.2098 0.208
NP_442719.1_2 Reverse -271 -289 -6.66806 0.226
NP_442719.1_2 Forward -61 -43 -10.8963 0.284
NP_441251.1_7 Reverse -305 -318 15.3589 0.266
NP_441911.1_10 Forward -207 -188 9.90869 0.226
NP_440601.1_3 Forward -33 -14 12.0942 0.296
NP_440385.1_9 Reverse -153 -172 20.2556 0.219
NP_441114.1_3 Forward -257 -248 6.39124 0.277
NP_440558.1_2 Reverse -372 -391 -6.88371 0.283
NP_440274.1_2 Forward -60 -46 12.192 0.242
NP_441878.1_6 Reverse -249 -259 2.24165 0.0462
NP_441878.1_6 Forward -385 -375 -7.19813 0.21
NP_441557.1_5 Forward -259 -250 -0.885252 0.26
NP_441433.1_8 Reverse -298 -317 -4.03212 0.286
NP_441433.1_8 Reverse -40 -59 -4.72043 0.294
NP_442830.1_5 Reverse -269 -283 3.04726 0.25
NP_441564.1_10 Forward -198 -179 2.16274 0.287
NP_442192.1_4 Forward -20 -1 11.7 0.274
NP_441549.1_9 Reverse -371 -389 -10.6006 0.281
NP_442645.1_2 Forward -267 -248 -6.88371 0.0969
NP_441037.1_4 Forward -386 -376 10.8262 0.178
NP_442594.1_8 Reverse -44 -63 10.1275 0.184
NP_442998.1_10 Forward -368 -361 4.16902 0.259
NP_442998.1_10 Reverse -252 -259 4.16902 0.259
NP_440299.1_1 Forward -263 -250 8.57349 0.09
NP_440299.1_1 Reverse -357 -370 7.88518 0.103
NP_440640.1_9 Forward -348 -329 12.7825 0.281
NP_442334.1_2 Reverse -43 -60 -14.2191 0.297
NP_440709.1_1 Reverse -102 -121 16.9115 0.0302
NP_441559.1_8 Reverse -266 -280 -2.55701 0.192
NP_442860.1_7 Forward -321 -303 13.5383 0.22
NP_440717.1_1 Forward -300 -281 9.53756 0.24
NP_442452.1_3 Reverse -343 -362 5.89931 0.229
NP_440748.1_5 Forward -199 -180 -3.44213 0.297
NP_440026.1_4 Reverse -41 -60 11.8975 0.239
NP_441199.1_6 Reverse -77 -96 1.27776 0.223
NP_441199.1_7 Forward -342 -323 5.40766 0.231
NP_440570.1_5 Forward -290 -271 0.687771 0.254
NP_440570.1_5 Reverse -246 -265 0.196116 0.257
NP_441340.1_5 Forward -258 -251 11.0522 0.0749
NP_440327.1_6 Reverse -222 -241 5.70265 0.258
NP_440684.1_9 Forward -174 -160 8.94771 0.221
NP_441167.1_1 Forward -124 -105 12.2908 0.109
NP_441789.1_7 Forward -62 -43 -4.81951 0.288
NP_441803.1_2 Forward -264 -245 10.8159 0.0809
NP_442887.1_5 Reverse -347 -366 -14.3569 0.294
NP_442384.1_10 Reverse -250 -263 4.44418 0.157
NP_442384.1_10 Forward -370 -357 2.77255 0.213
NP_441018.1_7 Reverse -177 -196 8.55425 0.242
NP_442262.1_10 Forward -258 -251 7.90559 0.266
NP_441335.1_8 Reverse -239 -258 9.63589 0.228
NP_442556.1_10 Reverse -358 -377 8.06688 0.299
NP_442280.1_10 Forward -269 -251 6.81803 0.268
NP_440894.1_2 Reverse -260 -279 -0.590531 0.277
NP_440888.1_2 Forward -301 -287 9.83206 0.113
NP_442033.1_10 Reverse -269 -288 -9.63698 0.22
NP_441949.1_5 Forward -123 -104 11.8368 0.25
NP_441543.1_2 Reverse -251 -260 5.80125 0.174
NP_443064.1_6 Reverse -290 -300 10.9186 0.13
NP_441462.1_2 Forward -259 -249 -0.41329 0.225
NP_441410.1_3 Forward -50 -31 5.80098 0.23
NP_442204.1_1 Reverse -350 -361 -0.137991 0.286
NP_442780.1_1 Forward -119 -100 8.75091 0.25
NP_442537.1_3 Reverse -330 -349 12.9791 0.239
NP_440516.1_6 Forward -62 -48 14.1586 0.188
NP_442428.1_5 Reverse -251 -258 4.36568 0.271
NP_440783.1_3 Reverse -268 -287 14.1591 0.0536
NP_441867.1_2 Forward -287 -268 -5.50708 0.189
NP_440077.1_5 Forward -364 -345 16.4207 0.143
NP_441052.1_2 Reverse -271 -281 5.87989 0.0998
NP_441052.1_2 Reverse -250 -260 5.09324 0.132
NP_442219.1_9 Reverse -272 -281 2.06468 0.289
NP_441004.1_1 Forward -96 -77 -6.1954 0.183
NP_441004.1_1 Reverse -47 -66 -17.9951 0.296
NP_442206.1_10 Reverse -382 -397 -0.413427 0.292
NP_441668.1_4 Forward -269 -250 -1.86883 0.283
NP_442515.1_1 Forward -379 -365 -1.96703 0.268
NP_441396.1_5 Reverse -144 -153 7.47288 0.252
NP_440593.1_3 Forward -395 -376 -6.78538 0.28
NP_441046.1_2 Forward -270 -251 5.30933 0.227
NP_442843.1_1 Forward -369 -350 -11.9969 0.296
NP_442843.1_1 Forward -115 -96 -11.9969 0.296
NP_441078.1_4 Reverse -250 -259 6.09625 0.0863
NP_441078.1_4 Forward -259 -250 -2.06522 0.295
NP_442443.1_1 Reverse -346 -365 1.37609 0.205
NP_441333.1_1 Reverse -223 -233 17.2143 0.153
NP_441732.1_2 Forward -43 -27 -8.49626 0.144
NP_441732.1_2 Forward -388 -372 -16.1661 0.165
NP_442343.1_1 Reverse -165 -184 15.7324 0.271
NP_440313.1_5 Reverse -89 -107 15.948 0.214
NP_440760.1_1 Reverse -250 -269 -15.8318 0.157
NP_440199.1_10 Reverse -10 -20 7.05986 0.242
NP_441945.1_6 Reverse -105 -124 8.16093 0.296
NP_441057.1_4 Reverse -276 -294 0.609134 0.253
NP_442489.1_7 Reverse -250 -259 -1.6719 0.235
NP_442913.1_10 Reverse -241 -260 -3.3438 0.207
NP_441800.1_3 Reverse -376 -394 3.95239 0.289
NP_442776.1_1 Reverse -376 -395 7.57094 0.206
NP_442346.1_5 Reverse -249 -259 11.2881 0.0706
NP_442346.1_5 Forward -260 -250 5.97822 0.219
NP_442346.1_5 Reverse -360 -370 5.87989 0.225
NP_440545.1_3 Reverse -287 -304 -5.46769 0.25
NP_440545.1_3 Forward -388 -371 -5.95935 0.265
NP_441943.1_8 Forward -393 -374 -12.6852 0.261
NP_440847.1_3 Reverse -279 -293 11.9953 0.254
NP_440847.1_3 Forward -53 -39 11.7003 0.261
NP_440847.1_3 Forward -52 -38 10.5204 0.291
NP_442828.1_7 Reverse -50 -69 -0.295539 0.276
NP_441585.1_5 Reverse -91 -110 0.490334 0.291
NP_440449.1_6 Reverse -374 -392 9.1312 0.187
NP_441047.1_2 Forward -294 -275 -2.95047 0.284
NP_442799.1_4 Forward -198 -179 11.0125 0.184
NP_442699.1_8 Forward -392 -373 -12.7836 0.257
NP_440671.1_4 Forward -196 -182 8.45605 0.198
NP_442404.1_9 Forward -318 -304 15.7319 0.236
NP_442140.1_3 Forward -258 -248 5.87989 0.194
NP_442723.1_1 Reverse -260 -279 4.42355 0.276
NP_440875.1_9 Forward -394 -384 8.5667 0.233
NP_442547.1_7 Forward -191 -172 11.4877 0.255
NP_440227.1_2 Reverse -153 -169 7.82668 0.29
NP_440665.1_2 Forward -392 -373 -1.08219 0.208
NP_442270.1_9 Reverse -245 -264 -5.31042 0.205
NP_440354.1_7 Reverse -333 -351 6.50899 0.282
NP_440546.1_4 Forward -259 -249 10.046 0.109
NP_440546.1_4 Reverse -361 -371 8.6886 0.176
NP_440546.1_4 Reverse -250 -260 7.04032 0.264
NP_442041.1_2 Forward -391 -373 9.36059 0.283
NP_440868.1_4 Forward -26 -14 -0.649339 0.28
NP_440401.1_9 Forward -314 -307 14.5917 0.287
NP_441879.1_8 Reverse -213 -232 15.7316 0.176
NP_442402.1_10 Reverse -272 -282 16.0075 0.118
NP_441084.1_6 Forward -204 -190 9.63499 0.273
NP_440653.1_10 Reverse -376 -395 25.6638 0.0037
NP_442039.1_7 Forward -284 -274 7.74818 0.271
NP_440160.1_2 Forward -271 -252 -7.67036 0.286
NP_439994.1_4 Forward -261 -242 11.3075 0.239
NP_440505.1_3 Reverse -96 -106 7.84651 0.147
NP_442360.1_5 Forward -390 -380 12.6647 0.298
NP_441252.1_6 Forward -282 -275 11.6422 0.288
NP_441203.1_1 Forward -258 -239 -5.40875 0.0985
NP_441408.2_7 Forward -267 -248 -3.14714 0.272
NP_440914.1_1 Forward -201 -191 6.17532 0.293
NP_442533.1_1 Forward -96 -77 -1.67217 0.14
NP_442533.1_6 Forward -259 -250 6.29291 0.113
NP_442533.1_6 Reverse -256 -265 2.65466 0.246
NP_442533.1_6 Reverse -382 -391 1.57302 0.294
NP_442229.1_1 Forward -261 -247 5.99717 0.242
NP_443016.1_1 Reverse -280 -299 -1.7705 0.223
NP_439944.1_9 Reverse -251 -261 5.28991 0.262
NP_442203.1_1 Forward -234 -220 16.1498 0.22
NP_441028.1_6 Forward -59 -49 8.04271 0.217
NP_441028.1_6 Forward -58 -48 8.04271 0.217
NP_441527.1_4 Forward -345 -326 -12.6531 0.292
NP_441527.1_7 Reverse -266 -285 9.93006 0.282
NP_441527.1_8 Reverse -54 -73 1.47442 0.279
NP_440007.1_9 Forward -187 -173 1.96621 0.281
NP_441106.1_3 Forward -124 -105 14.5524 0.158
NP_439903.1_6 Forward -268 -249 1.6703 0.241
NP_442674.1_3 Forward -392 -373 5.11187 0.276
NP_441705.1_3 Forward -294 -275 -1.7705 0.281
NP_440886.1_7 Reverse -270 -280 4.99446 0.205
NP_442264.1_5 Reverse -250 -264 15.2409 0.222
NP_440176.1_3 Forward -60 -46 18.4851 0.219
NP_442842.1_10 Reverse -328 -347 2.40698 0.254
NP_442615.1_1 Reverse -241 -259 -6.37237 0.244
NP_442615.1_1 Forward -268 -250 -7.25734 0.283
NP_440387.1_5 Forward -400 -381 11.5187 0.271
NP_441521.1_8 Reverse -144 -163 14.5524 0.299
NP_441193.1_1 Forward -376 -357 10.0284 0.277
NP_442224.1_1 Forward -297 -278 -1.47551 0.233
NP_442805.1_1 Reverse -106 -123 27.8665 0.00116
NP_442805.1_2 Reverse -66 -85 29.0071 0.0000859
NP_442805.1_3 Reverse -86 -105 20.3196 0.142
NP_442805.1_4 Reverse -7 -25 19.6853 0.112
NP_442698.1_10 Forward -388 -369 -0.787193 0.297
NP_440293.1_3 Forward -392 -373 -0.0988766 0.228
NP_442867.1_8 Reverse -38 -57 4.71934 0.277
NP_440213.1_5 Forward -270 -251 7.57094 0.284
NP_440473.1_1 Forward -373 -354 12.7035 0.213
NP_442862.1_3 Reverse -251 -268 6.03703 0.267
NP_441885.1_5 Reverse -250 -260 0.176696 0.177
NP_442703.1_6 Forward -127 -108 16.1855 0.233
NP_442341.1_7 Forward -94 -80 1.08123 0.299
NP_441173.1_9 Reverse -274 -282 12.507 0.206
NP_441173.1_9 Forward -58 -50 11.3271 0.226
NP_441173.1_9 Forward -57 -49 11.3271 0.226
NP_440076.1_9 Forward -161 -148 17.4232 0.192
NP_443060.1_1 Forward -389 -370 11.7983 0.178
NP_442495.1_4 Forward -392 -382 14.9263 0.156
NP_440149.1_8 Reverse -250 -269 -4.22878 0.203
NP_440149.1_8 Forward -265 -246 -4.6221 0.211
NP_442015.1_3 Reverse -83 -102 10.7167 0.296
NP_442015.1_10 Reverse -246 -259 1.39592 0.204
NP_441226.1_7 Forward -183 -176 8.59356 0.197
NP_441757.1_4 Reverse -6 -25 10.8159 0.263
NP_440416.1_1 Reverse -52 -71 -6.49039 0.172
NP_440416.1_9 Forward -266 -247 -20.7484 0.288
NP_443052.1_8 Reverse -359 -378 -13.5702 0.29
NP_442154.1_1 Forward -288 -270 -17.8771 0.272
NP_440261.1_5 Reverse -251 -264 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAACTTCAATGCCCTGGGCTAAGGCAACCAAACTATGGCCCAACTCGTGGGCGACAACGGAAGCAAAGAGGAGTAAAGCTGTAATTAACCCCAAAATCCAGGGTGTGCCACCGGAAAGTTGGGGAAAGCGGGCTAAGTCTTGGCCATAGCTCAGGGTCACCAATCCTAAAATTAAAAACCAGGATGGGTTGACGTAAAAAGGAATGCCAAACAGACTGCCGACGCGGATATTGTTGTTCATAAACTGCCCCCCTAAACTGAGGCTTAACATGAATTAATTGTAACGAGATGTTAAGAATTGCCTGAGTGGGATAACCGTCGGGGTTAGTTCGGTTAAGCACCTTTCCCCCAATCCACCGTAGGATCTAGTCAACAGGCCTCGATTTCCGTTAACTTGCCC

CDS

ATGTTTTCCCCCAGCGTTTACTCAGAAATTATCGCTACCCTCCCCCCCAGTGTACGGTTGGTGGCGGTAACCAAAACCAAGGCGATCGCCGACATCGAAGCGGCCTACGGAGCGGGCATCCGGGATTTTGCCGAAAGTCGCATCCAAGAAGCTTTACCAAAAATCGAAGCTTTAGCAAATTACCAAGATATTAACTGGCATTTTATCGGACGTTTACAGAGTAACAAGGCCCGCAAAGTGGTGGAAAATTTTACCTATATCCATTCCGTTGATAATTTGGCGATCGCCGTCAAACTAGACCGCATTGCTGAGGAGTTGAACAAATTTCCCCAGGGATTATTACAAATCAAGTTACTGCCGGACGAGAATAAATCCGGTTGGACAAGGGAAGAATTAAAGCTGGATTTGCCCCAACTGGAGCTATTAAAAAATCTAAAAATTTGTGGCTTAATGACTATTTTACCCCTGGGTCTTTCCCCTGGCGATCGCCAACTAACCTTTGGGGAACTAAAAAATCTGGCCACAGCCATCAACCAACAATCTAGCCTGTCATTAACGGAACTATCCATGGGCATGTCCGGAGATTACCCAGAAGCCATTGCCGCCGGAGCTACCATGATCCGCTTGGGTACCATTCTCTTTGGCGATCGACTCTAA

Protein

MFSPSVYSEIIATLPPSVRLVAVTKTKAIADIEAAYGAGIRDFAESRIQEALPKIEALANYQDINWHFIGRLQSNKARKVVENFTYIHSVDNLAIAVKLDRIAEELNKFPQGLLQIKLLPDENKSGWTREELKLDLPQLELLKNLKICGLMTILPLGLSPGDRQLTFGELKNLATAINQQSSLSLTELSMGMSGDYPEAIAAGATMIRLGTILFGDRL