Your browser is old and dusty. Try Google Chrome!

Details for slr0552

ORF slr0552
Accession NP_442801.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Reverse -154 -173 -29.8932 0.245
NP_442291.1_7 Forward -52 -38 10.1277 0.252
NP_441343.1_6 Forward -127 -108 20.944 0.0374
NP_441453.1_1 Forward -170 -152 5.1316 0.252
NP_442151.1_6 Forward -181 -167 6.6861 0.224
NP_441818.1_9 Reverse -154 -173 -10.3253 0.292
NP_441812.1_3 Reverse -171 -185 7.47274 0.272
NP_442975.1_10 Forward -185 -171 4.91554 0.234
NP_442062.1_8 Reverse -108 -118 3.71661 0.256
NP_441802.1_1 Reverse -25 -44 8.16093 0.224
NP_440304.1_4 Forward -270 -260 2.04498 0.299
NP_440908.1_2 Forward -319 -306 15.26 0.269
NP_439918.1_2 Forward -80 -61 -3.14714 0.251
NP_441200.1_8 Forward -233 -214 16.7735 0.217
NP_440307.1_10 Reverse -215 -234 14.6508 0.224
NP_442110.1_7 Reverse -154 -168 8.35772 0.093
NP_442367.1_1 Reverse -159 -178 -7.76869 0.26
NP_440856.1_4 Forward -170 -151 -4.22878 0.251
NP_441083.1_3 Reverse -38 -48 16.1058 0.106
NP_442827.1_8 Forward -311 -292 -2.36125 0.274
NP_441645.1_1 Reverse -46 -65 9.63507 0.223
NP_441713.1_1 Reverse -239 -258 -9.14533 0.168
NP_441713.1_1 Forward -169 -150 -11.2103 0.221
NP_442111.1_4 Forward -374 -360 3.63784 0.236
NP_442801.1_1 Forward -195 -176 22.7298 0.0574
NP_442801.1_5 Forward -90 -73 17.1476 0.116
NP_441854.1_8 Forward -183 -165 19.292 0.279
NP_442634.1_4 Forward -43 -29 -5.11362 0.235
NP_440842.1_10 Forward -166 -152 3.93283 0.254
NP_441695.1_4 Forward -320 -302 9.55725 0.294
NP_442848.1_4 Forward -51 -37 5.21113 0.299
NP_442848.1_9 Forward -265 -246 -0.4922 0.278
NP_443018.1_3 Forward -312 -305 8.20058 0.153
NP_441634.1_8 Reverse -370 -384 1.37622 0.198
NP_441634.1_8 Reverse -308 -322 -0.885388 0.272
NP_440376.1_1 Reverse -154 -163 4.62128 0.154
NP_442687.1_7 Forward -118 -108 9.61647 0.0994
NP_442687.1_7 Reverse -153 -163 3.71661 0.292
NP_442485.1_3 Forward -180 -161 -0.0988766 0.251
NP_442485.1_3 Forward -122 -103 -5.9004 0.296
NP_442658.1_1 Forward -119 -109 11.8776 0.0697
NP_442205.1_9 Forward -187 -171 0.746852 0.26
NP_440800.1_7 Reverse -27 -41 10.226 0.294
NP_442937.1_5 Reverse -34 -53 7.27595 0.258
NP_441958.1_5 Reverse -153 -163 -1.00328 0.227
NP_441127.1_1 Reverse -166 -180 16.2242 0.101
NP_439905.1_1 Forward -288 -275 6.90245 0.272
NP_440984.1_7 Forward -170 -156 10.226 0.126
NP_442911.1_4 Reverse -289 -308 11.0117 0.265
NP_440993.1_3 Forward -133 -114 -1.96793 0.292
NP_440827.1_3 Reverse -293 -312 10.5209 0.298
NP_441099.1_5 Forward -173 -154 -1.7705 0.113
NP_442771.1_1 Forward -134 -116 -7.84733 0.173
NP_440147.1_4 Reverse -152 -165 1.00259 0.242
NP_441916.1_10 Forward -212 -193 2.26107 0.25
NP_441725.1_4 Reverse -46 -60 5.99717 0.278
NP_439966.1_7 Forward -119 -109 4.99446 0.248
NP_439966.1_7 Forward -315 -305 4.7978 0.258
NP_439966.1_9 Forward -119 -110 0.491382 0.288
NP_440983.1_5 Forward -181 -162 -6.88371 0.28
NP_440260.1_8 Reverse -145 -163 5.72234 0.154
NP_440723.1_4 Reverse -156 -175 -11.6036 0.298
NP_441071.1_3 Forward -256 -237 5.60352 0.276
NP_441762.1_7 Reverse -107 -119 5.44718 0.0387
NP_442381.1_8 Reverse -97 -116 -13.9635 0.28
NP_440015.1_9 Forward -117 -99 3.95239 0.164
NP_441876.1_9 Forward -50 -40 10.1076 0.3
NP_442719.1_2 Forward -341 -323 -10.6013 0.278
NP_441911.1_10 Forward -205 -186 13.3793 0.21
NP_442808.1_1 Forward -382 -372 2.14288 0.275
NP_442903.1_2 Forward -212 -193 4.24897 0.23
NP_440558.1_2 Forward -178 -159 -4.03212 0.241
NP_441878.1_6 Forward -49 -39 10.0098 0.0185
NP_441878.1_6 Reverse -153 -163 1.65166 0.0795
NP_441878.1_6 Reverse -38 -48 -7.88644 0.278
NP_441557.1_8 Forward -253 -243 13.0576 0.225
NP_440101.1_10 Reverse -166 -185 9.63589 0.168
NP_442183.1_1 Reverse -108 -122 5.40779 0.218
NP_442183.1_9 Reverse -307 -317 11.3864 0.206
NP_442166.1_7 Reverse -143 -157 9.34103 0.195
NP_442632.1_3 Forward -311 -292 5.50599 0.178
NP_440540.1_2 Reverse -160 -179 6.4893 0.271
NP_442347.1_2 Reverse -56 -65 4.32629 0.284
NP_442645.1_2 Forward -183 -164 -16.5201 0.235
NP_442998.1_10 Forward -161 -154 4.07068 0.276
NP_442007.1_8 Forward -173 -155 10.4414 0.258
NP_441559.1_8 Reverse -348 -362 -7.17857 0.287
NP_441270.1_5 Reverse -235 -254 11.4328 0.291
NP_440915.1_6 Reverse -241 -255 -1.8687 0.251
NP_441296.1_6 Forward -67 -48 2.26107 0.299
NP_441464.1_10 Reverse -207 -221 18.8791 0.069
NP_439985.1_10 Reverse -218 -231 18.8005 0.237
NP_442993.1_1 Reverse -117 -133 -10.8562 0.229
NP_440677.1_6 Forward -51 -32 7.17762 0.298
NP_442386.1_9 Forward -118 -109 11.8973 0.0799
NP_440570.1_5 Reverse -300 -319 -3.44213 0.289
NP_441271.1_1 Reverse -253 -271 10.4414 0.282
NP_440327.1_6 Reverse -301 -320 5.40766 0.26
NP_440327.1_6 Reverse -154 -173 2.94938 0.285
NP_440586.1_8 Forward -312 -305 9.08521 0.178
NP_442959.1_4 Reverse -160 -179 5.50599 0.25
NP_439937.1_9 Forward -255 -238 -9.40158 0.188
NP_440439.1_1 Forward -166 -153 6.70579 0.0743
NP_442239.1_8 Reverse -306 -325 5.99764 0.266
NP_440139.1_1 Reverse -102 -121 8.65176 0.109
NP_440364.1_2 Reverse -109 -128 15.7849 0.213
NP_441018.1_7 Forward -283 -264 7.57094 0.269
NP_442262.1_10 Forward -312 -305 9.38056 0.202
NP_440531.1_8 Reverse -228 -247 1.67108 0.298
NP_442917.1_2 Reverse -154 -173 4.916 0.224
NP_441060.1_1 Reverse -166 -185 13.2525 0.294
NP_440189.1_10 Forward -59 -40 2.16274 0.299
NP_441335.1_8 Reverse -287 -306 9.3409 0.228
NP_441896.1_3 Reverse -250 -269 -1.08219 0.252
NP_442129.1_6 Reverse -81 -100 13.0738 0.29
NP_442078.1_3 Reverse -78 -97 -1.37794 0.277
NP_440999.1_9 Forward -121 -107 -1.47537 0.239
NP_440888.1_2 Forward -319 -305 7.96378 0.175
NP_440060.1_2 Reverse -239 -258 19.9598 0.135
NP_441178.1_5 Reverse -160 -179 8.16093 0.3
NP_442315.1_1 Reverse -308 -326 6.01734 0.256
NP_441462.1_2 Reverse -154 -164 -0.806614 0.254
NP_443062.1_1 Forward -346 -328 3.47554 0.297
NP_442204.1_1 Reverse -300 -311 8.31847 0.0977
NP_440504.1_5 Reverse -24 -42 9.65558 0.162
NP_440544.1_6 Forward -36 -22 21.3367 0.0822
NP_440992.1_2 Reverse -103 -122 11.3075 0.26
NP_441004.1_1 Reverse -247 -266 -16.7168 0.287
NP_442813.1_4 Reverse -199 -218 -6.49039 0.299
NP_442366.1_3 Forward -43 -25 -5.19239 0.284
NP_442873.1_3 Forward -176 -157 6.39016 0.23
NP_440296.1_10 Reverse -242 -261 -13.4719 0.269
NP_442856.1_7 Forward -157 -138 -5.40875 0.279
NP_441668.1_4 Reverse -30 -49 -2.95047 0.299
NP_441396.1_5 Reverse -305 -314 17.2076 0.141
NP_441396.1_5 Reverse -238 -247 7.27622 0.29
NP_440940.1_7 Reverse -162 -180 2.96833 0.286
NP_440396.1_1 Reverse -150 -169 -5.60541 0.272
NP_441078.1_4 Forward -163 -154 -1.18024 0.237
NP_442348.1_2 Forward -80 -71 10.7178 0.259
NP_440526.1_3 Forward -253 -242 5.76138 0.233
NP_442540.1_3 Reverse -230 -249 17.2306 0.278
NP_440713.1_4 Forward -313 -294 5.99764 0.198
NP_440713.1_4 Forward -173 -154 5.89931 0.2
NP_440565.1_7 Reverse -149 -168 -1.37718 0.282
NP_440559.1_1 Forward -116 -107 4.71961 0.217
NP_442008.1_2 Reverse -249 -268 3.53937 0.253
NP_440335.1_9 Forward -203 -185 10.0489 0.282
NP_442346.1_5 Reverse -171 -181 4.60159 0.281
NP_442346.1_10 Reverse -137 -156 -3.73712 0.296
NP_440545.1_3 Reverse -150 -167 -4.48438 0.227
NP_441923.1_6 Reverse -161 -175 8.75105 0.278
NP_440486.1_4 Forward -367 -349 1.88744 0.226
NP_441653.1_3 Forward -73 -59 12.1926 0.279
NP_440010.1_4 Forward -185 -166 0.195343 0.25
NP_440010.1_10 Reverse -142 -161 3.14605 0.264
NP_443026.1_5 Reverse -209 -228 0.58944 0.283
NP_441044.1_4 Forward -324 -306 7.00065 0.223
NP_440772.1_6 Forward -29 -10 8.06259 0.292
NP_440951.1_10 Forward -178 -160 22.6353 0.0813
NP_442547.1_7 Reverse -29 -48 12.3637 0.228
NP_440590.1_4 Reverse -160 -173 7.00078 0.0559
NP_440567.1_1 Reverse -109 -123 6.58777 0.0816
NP_442497.1_10 Forward -116 -107 -1.18024 0.256
NP_441239.1_9 Forward -119 -107 3.87389 0.272
NP_440156.1_2 Forward -230 -211 15.8307 0.2
NP_442643.1_1 Reverse -148 -167 -11.7019 0.231
NP_442772.1_4 Forward -21 -2 -4.52377 0.249
NP_442052.1_8 Forward -50 -40 13.2547 0.253
NP_440546.1_4 Reverse -154 -164 7.62206 0.23
NP_443033.1_3 Forward -48 -29 15.5357 0.16
NP_442041.1_2 Reverse -38 -56 8.67227 0.287
NP_442039.1_4 Reverse -155 -162 6.43063 0.285
NP_442053.1_1 Forward -163 -154 5.70292 0.172
NP_441408.2_7 Forward -207 -188 0.786102 0.215
NP_441408.2_7 Forward -213 -194 -4.03212 0.279
NP_442533.1_1 Reverse -301 -320 -17.9951 0.299
NP_442533.1_6 Reverse -39 -48 11.2095 0.046
NP_442533.1_6 Reverse -40 -49 7.27622 0.0928
NP_442533.1_6 Forward -163 -154 2.94966 0.232
NP_441482.1_7 Forward -169 -155 -12.2918 0.292
NP_441527.1_4 Forward -197 -178 -11.6982 0.284
NP_441059.1_2 Reverse -126 -145 -4.91709 0.245
NP_441059.1_2 Reverse -333 -352 -6.88371 0.268
NP_441961.1_4 Reverse -100 -119 9.0459 0.259
NP_441972.1_5 Forward -180 -161 -1.86883 0.178
NP_441972.1_5 Reverse -155 -174 -7.4737 0.249
NP_440886.1_4 Reverse -154 -173 21.5339 0.0874
NP_440886.1_7 Reverse -116 -126 4.60114 0.227
NP_440886.1_7 Forward -320 -310 4.10949 0.253
NP_442717.1_4 Forward -76 -57 10.9142 0.186
NP_442072.1_9 Reverse -153 -171 -14.6322 0.153
NP_442213.1_5 Reverse -234 -253 5.211 0.231
NP_442615.1_1 Reverse -145 -163 -1.45582 0.128
NP_441962.1_4 Reverse -155 -174 -11.9969 0.25
NP_441836.1_1 Forward -32 -13 12.5707 0.254
NP_441425.1_6 Forward -17 -7 16.893 0.143
NP_442323.1_7 Forward -313 -294 11.0117 0.144
NP_440766.1_4 Reverse -300 -314 10.0294 0.0871
NP_440473.1_1 Forward -252 -233 10.7754 0.293
NP_442514.1_5 Forward -171 -152 -9.63771 0.297
NP_440554.1_4 Forward -312 -302 1.74999 0.29
NP_442703.1_8 Reverse -185 -203 12.8014 0.265
NP_442395.2_4 Forward -118 -99 -0.492971 0.295
NP_443000.1_7 Forward -183 -173 1.84832 0.228
NP_441902.1_3 Reverse -85 -95 12.6902 0.236
NP_442495.1_4 Reverse -303 -313 13.648 0.187
NP_442495.1_4 Reverse -36 -46 13.0581 0.198
NP_440172.1_1 Forward -41 -31 8.73149 0.0586
NP_440416.1_9 Forward -176 -157 -15.8318 0.201
NP_441579.1_6 Forward -198 -179 10.5209 0.288
NP_442564.1_10 Forward -249 -235 14.0609 0.244
NP_440988.1_10 Forward -125 -111 12.6438 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAAAGAATTGGAGTCTAGCTTGCAACGCCTGATCAAACGGGAATTACAGAGTAGCCCCATGGTTTTACTGATGTTGCAAACCGACACCCCCATCGAATTGGATCAGGTTCCCCAGAATGTAAGCACTGTCAGTGCGACTTCTGCTACACCAGCCCCCCGCAAAAAAGTGGTCCTGACTAAAACCCCAGAACCAAAAGTGAAAGCTAAACCAGAAAAGAAAGTGGTCACCACTGCCGAGCCTAGCGCCCAACCGGTCAGTACCACTAAGGTTTACCGTCGTAGCCGCAAACGCTCTACCACTTCTGTTTCTTCCTAAGATCCGGTATTGTTTTGGCTGGGGTTCTATCTATTGGGCCCCGGCCAATTTCTTTGTCAGTCCGGTAATTGTTGAGCAAAATTA

CDS

ATGTCCACTGTAATTCCTACCTCCCAAGAACCTGTCACCCTTCCCAATGAAATTCTAGAAATTTCCATCAGCATTGCAGTCAAGGAGTTAGACCCAACCCTAGTCAATGAACAGTTTTTGAAGTTCAGTGGCATTGTGTCCAACGAATGGGAATTGAACCAACAGCCAGTGGTAAGTAAAGCTGGTTCCCAATTGGTGTTTAAAAATGGGCTCAGCATTGTGGCCCAGCCCCGCTCCCTAACGTTTTTAGAAGGGATGAATGATAAAACGGCGGAAGTGGTAACCGTGGGCAAGGTCGCCAGTGCCTTTGTGGAAAAATTACCCAATGCCCAATACAACGGCGTGGTAGTAACCCCCAAATGTTTAATTCCCCTACCGGATCAAAACGATGGGGCTCGGAAGTTCATCACCGGTACTTTGCTGGCATCCGGTGCCTGGCAAGATTTGGGCAAGGCCCCCGTACAAGCGGCGGTGGAATTCACCTATCTTTTGGAAGGCTGTCAATTTAACCTCAAAGTTAACCAGGCAACTTTGCAGATTCCCGATCGCCAGGCAGTGAGTGCGTTGTTATTTGCGGGTAACTTCAATTACAGCTTGAATAATCCCAATCCCCAGGAACGGGTCAGCGTGGCCAAACAGTACATTGAAGCGTGGCAATCCGACTTGGATACTTTCCGGGGCATTGTCCACGAAAAATTCTTGGCGGAGCAACAACCCCAAACGGTGTTTGGTTAA

Protein

MSTVIPTSQEPVTLPNEILEISISIAVKELDPTLVNEQFLKFSGIVSNEWELNQQPVVSKAGSQLVFKNGLSIVAQPRSLTFLEGMNDKTAEVVTVGKVASAFVEKLPNAQYNGVVVTPKCLIPLPDQNDGARKFITGTLLASGAWQDLGKAPVQAAVEFTYLLEGCQFNLKVNQATLQIPDRQAVSALLFAGNFNYSLNNPNPQERVSVAKQYIEAWQSDLDTFRGIVHEKFLAEQQPQTVFG