Your browser is old and dusty. Try Google Chrome!

Details for slr0542

ORF slr0542
Accession NP_442765.1
Symbol clpP
Category Degradation of proteins, peptides, and glycopeptides
Definition ATP-dependent protease ClpP
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_7 Forward -58 -46 22.5568 0.0839
NP_441418.1_6 Forward -294 -275 -30.2865 0.267
NP_441453.1_4 Reverse -278 -286 14.8674 0.00947
NP_441453.1_4 Reverse -285 -293 14.7691 0.0119
NP_441453.1_4 Forward -294 -286 6.80426 0.121
NP_441453.1_4 Forward -287 -279 6.80426 0.121
NP_441453.1_7 Reverse -346 -353 12.9205 0.23
NP_441623.1_1 Forward -400 -382 -2.14413 0.241
NP_442838.1_7 Forward -292 -273 -11.1119 0.263
NP_441818.1_9 Reverse -3 -22 7.7676 0.116
NP_440226.1_1 Forward -294 -275 5.80098 0.145
NP_441630.1_3 Forward -302 -283 -1.08219 0.291
NP_442173.1_1 Forward -286 -278 13.8841 0.0225
NP_442173.1_1 Forward -293 -285 12.0158 0.0316
NP_442173.1_1 Reverse -286 -294 12.0158 0.0316
NP_442173.1_1 Reverse -279 -287 12.0158 0.0316
NP_442752.1_4 Forward -294 -287 13.8055 0.0199
NP_442752.1_4 Forward -287 -280 13.8055 0.0199
NP_440613.1_1 Forward -349 -330 15.5357 0.197
NP_440784.1_7 Forward -293 -286 6.23397 0.241
NP_440784.1_7 Forward -286 -279 6.23397 0.241
NP_440784.1_7 Reverse -286 -293 6.13563 0.241
NP_440784.1_7 Reverse -279 -286 6.13563 0.241
NP_442000.2_3 Reverse -68 -87 10.1275 0.294
NP_440061.1_9 Reverse -283 -297 8.65209 0.167
NP_440061.1_9 Forward -81 -67 7.86545 0.189
NP_441054.1_2 Forward -378 -359 9.3409 0.299
NP_439979.1_2 Forward -146 -127 9.63589 0.222
NP_440878.1_4 Reverse -290 -308 18.8987 0.153
NP_442062.1_8 Forward -294 -284 10.0098 0.0527
NP_442062.1_8 Forward -287 -277 7.94484 0.0848
NP_442062.1_8 Reverse -285 -295 7.84651 0.0871
NP_442062.1_8 Reverse -278 -288 7.15819 0.107
NP_440761.1_4 Reverse -65 -84 -19.7651 0.282
NP_440916.1_1 Forward -340 -326 10.226 0.21
NP_439918.1_3 Forward -290 -271 2.45773 0.294
NP_441594.1_2 Forward -20 -1 14.4541 0.181
NP_441594.1_6 Forward -350 -331 0.884433 0.279
NP_440370.1_10 Reverse -269 -288 16.4207 0.0713
NP_441082.1_10 Reverse -56 -69 9.55739 0.242
NP_441083.1_5 Reverse -285 -295 18.0729 0.00245
NP_441083.1_5 Forward -294 -284 8.82982 0.03
NP_441083.1_5 Forward -287 -277 6.96153 0.0717
NP_441083.1_5 Forward -169 -159 6.76487 0.0775
NP_441083.1_5 Reverse -278 -288 0.865012 0.218
NP_442827.1_8 Reverse -324 -343 0.195343 0.214
NP_441434.1_7 Reverse -287 -301 11.8976 0.125
NP_441434.1_7 Reverse -280 -294 11.0127 0.141
NP_441738.1_2 Reverse -287 -294 15.28 0.0102
NP_441738.1_2 Reverse -280 -287 15.28 0.0102
NP_441738.1_2 Forward -67 -60 6.52862 0.261
NP_441558.1_5 Reverse -276 -295 7.37428 0.182
NP_440209.1_1 Forward -294 -286 8.57422 0.0425
NP_440209.1_1 Forward -287 -279 8.57422 0.0425
NP_440209.1_1 Reverse -285 -293 8.47588 0.0457
NP_440655.1_2 Reverse -42 -61 1.17943 0.293
NP_442765.1_6 Forward -170 -151 17.7974 0.131
NP_442889.1_8 Reverse -282 -296 8.94708 0.107
NP_442889.1_8 Forward -172 -158 8.45543 0.12
NP_441713.1_1 Reverse -272 -291 -7.08038 0.126
NP_441770.1_10 Reverse -276 -295 10.3242 0.232
NP_440178.1_7 Forward -295 -276 -22.2233 0.258
NP_442111.1_4 Reverse -277 -291 4.22782 0.216
NP_440343.1_3 Reverse -279 -297 9.6548 0.184
NP_440906.1_5 Forward -293 -286 6.23397 0.234
NP_440906.1_5 Forward -286 -279 6.23397 0.234
NP_440906.1_5 Reverse -286 -293 6.13563 0.241
NP_440906.1_5 Reverse -279 -286 6.13563 0.241
NP_440747.1_10 Forward -297 -285 -4.28759 0.0903
NP_440747.1_10 Reverse -282 -294 -4.38592 0.0974
NP_440747.1_10 Reverse -157 -169 -4.68091 0.115
NP_440747.1_10 Reverse -275 -287 -11.7607 0.142
NP_441486.1_1 Reverse -282 -296 13.3726 0.00871
NP_441486.1_1 Forward -290 -276 11.8976 0.0137
NP_441486.1_1 Forward -297 -283 -4.81863 0.209
NP_442634.1_4 Reverse -1 -15 -5.01529 0.228
NP_440403.1_4 Forward -303 -284 -8.35868 0.254
NP_442848.1_4 Reverse -158 -172 13.5693 0.241
NP_443018.1_3 Reverse -286 -293 11.7405 0.0655
NP_443018.1_3 Reverse -279 -286 11.7405 0.0655
NP_443018.1_3 Forward -293 -286 5.44732 0.193
NP_443018.1_3 Forward -286 -279 5.44732 0.193
NP_440376.1_1 Forward -294 -285 15.7327 0.00625
NP_440376.1_1 Reverse -285 -294 9.63616 0.0385
NP_440376.1_1 Forward -287 -278 5.89959 0.116
NP_440376.1_1 Reverse -278 -287 -0.0986038 0.285
NP_440376.1_1 Reverse -76 -85 -0.295266 0.286
NP_441588.1_4 Reverse -280 -290 16.4996 0.0369
NP_441588.1_4 Reverse -287 -297 6.96153 0.178
NP_441588.1_4 Forward -292 -282 6.76487 0.185
NP_442687.1_7 Forward -295 -285 16.303 0.0125
NP_442687.1_7 Forward -288 -278 12.5664 0.0712
NP_442687.1_7 Reverse -284 -294 5.97822 0.179
NP_442687.1_7 Reverse -88 -98 3.91327 0.278
NP_442485.1_3 Reverse -165 -184 -5.31042 0.289
NP_440642.1_10 Forward -93 -79 2.45727 0.277
NP_441013.1_2 Forward -250 -232 -4.40575 0.298
NP_442296.1_9 Forward -293 -274 -0.885524 0.197
NP_442658.1_1 Forward -278 -268 7.35439 0.214
NP_442658.1_1 Reverse -283 -293 6.27276 0.234
NP_442658.1_1 Forward -289 -279 6.17443 0.235
NP_442658.1_1 Forward -296 -286 5.09279 0.284
NP_442496.1_5 Reverse -61 -79 9.85225 0.217
NP_441414.1_9 Forward -294 -275 -5.50708 0.177
NP_442937.1_5 Reverse -132 -151 6.58763 0.275
NP_441165.1_9 Forward -165 -146 18.1898 0.249
NP_441317.1_4 Forward -177 -163 10.2279 0.29
NP_441958.1_5 Forward -295 -285 18.2696 0.00183
NP_441958.1_5 Forward -288 -278 8.73149 0.0255
NP_441958.1_5 Reverse -284 -294 2.43831 0.0422
NP_441958.1_5 Reverse -277 -287 0.963343 0.12
NP_439905.1_1 Reverse -138 -151 8.57408 0.232
NP_440984.1_7 Reverse -280 -294 8.25939 0.152
NP_442376.1_6 Forward -217 -198 -2.36049 0.295
NP_442911.1_2 Reverse -275 -294 -9.73531 0.262
NP_442911.1_2 Reverse -268 -287 -10.0303 0.268
NP_440153.1_5 Reverse -177 -191 1.57289 0.248
NP_441591.1_10 Reverse -58 -77 10.1275 0.196
NP_442002.1_9 Forward -295 -288 14.1004 0.074
NP_442002.1_9 Forward -288 -281 10.7572 0.185
NP_440809.1_9 Reverse -269 -287 -7.84733 0.225
NP_441294.1_7 Reverse -281 -295 16.9297 0.011
NP_440411.1_10 Reverse -337 -356 11.4328 0.265
NP_442438.1_10 Reverse -280 -294 1.67122 0.19
NP_442431.1_10 Reverse -6 -24 1.19912 0.259
NP_441000.1_6 Reverse -277 -291 5.21113 0.0933
NP_441000.1_6 Forward -295 -281 4.91614 0.0933
NP_440147.1_4 Forward -296 -283 10.2457 0.0355
NP_440147.1_4 Forward -289 -276 9.06573 0.0437
NP_440147.1_4 Reverse -283 -296 3.16588 0.193
NP_441550.1_8 Forward -296 -286 16.4008 0.013
NP_441550.1_8 Reverse -276 -286 9.616 0.0898
NP_441550.1_8 Reverse -283 -293 7.35439 0.164
NP_441550.1_8 Forward -289 -279 7.0594 0.178
NP_441916.1_7 Reverse -278 -288 9.51814 0.0338
NP_441916.1_7 Forward -294 -284 8.73149 0.042
NP_441916.1_7 Reverse -285 -295 7.25653 0.0718
NP_441916.1_7 Forward -287 -277 5.09324 0.146
NP_441916.1_10 Reverse -374 -393 -0.000545616 0.294
NP_441041.1_4 Forward -294 -275 -12.7836 0.274
NP_441041.1_7 Forward -290 -278 12.0821 0.0689
NP_441041.1_7 Reverse -282 -294 9.26397 0.117
NP_441041.1_7 Forward -297 -285 8.2922 0.139
NP_441725.1_5 Forward -286 -276 2.24165 0.115
NP_441725.1_5 Reverse -286 -296 1.94665 0.115
NP_441725.1_5 Reverse -118 -128 -1.10161 0.288
NP_439966.1_7 Reverse -283 -293 8.92768 0.125
NP_439966.1_7 Forward -71 -61 8.63269 0.132
NP_439966.1_9 Forward -289 -280 0.884706 0.253
NP_440736.1_3 Reverse -276 -295 0.786102 0.282
NP_442941.1_3 Forward -286 -276 -0.904945 0.274
NP_440289.1_2 Reverse -282 -295 5.62415 0.0623
NP_440289.1_2 Forward -290 -277 -3.61896 0.267
NP_440983.1_5 Forward -260 -241 -0.590531 0.228
NP_440983.1_5 Forward -257 -238 -9.24366 0.3
NP_442281.1_1 Reverse -280 -294 10.717 0.055
NP_442281.1_1 Forward -299 -285 3.73557 0.221
NP_442281.1_1 Reverse -273 -287 3.24392 0.238
NP_001035871.2_7 Reverse -58 -68 16.6963 0.14
NP_439983.1_7 Reverse -242 -260 10.7372 0.277
NP_442288.1_3 Forward -86 -69 5.44704 0.284
NP_441556.1_7 Forward -80 -61 8.4551 0.171
NP_441556.1_10 Forward -282 -268 9.44312 0.298
NP_440498.1_1 Forward -21 -3 2.28076 0.193
NP_440375.1_8 Reverse -279 -298 0.0977854 0.266
NP_441644.1_6 Reverse -285 -295 15.4175 0.00595
NP_441644.1_6 Reverse -278 -288 7.45273 0.124
NP_441644.1_6 Forward -169 -159 4.60114 0.233
NP_442215.1_2 Forward -296 -280 -1.90808 0.189
NP_442215.1_2 Forward -289 -273 -6.23465 0.266
NP_442029.1_6 Reverse -365 -384 5.70265 0.249
NP_442029.1_6 Reverse -55 -74 3.14605 0.283
NP_442247.1_8 Reverse -283 -297 9.5377 0.247
NP_440929.1_8 Reverse -285 -294 16.5193 0.00413
NP_440929.1_8 Forward -294 -285 9.53783 0.0296
NP_440929.1_8 Reverse -278 -287 7.17789 0.0713
NP_442933.1_10 Reverse -285 -294 8.06287 0.0885
NP_442933.1_10 Reverse -278 -287 8.06287 0.0885
NP_442933.1_10 Forward -294 -285 7.96454 0.0937
NP_442933.1_10 Forward -287 -278 7.96454 0.0937
NP_441751.2_8 Forward -286 -272 -4.52363 0.174
NP_442554.1_8 Forward -293 -283 10.8948 0.0424
NP_442554.1_8 Reverse -286 -296 4.40493 0.188
NP_442554.1_8 Reverse -279 -289 3.42162 0.226
NP_442554.1_8 Forward -286 -276 2.83163 0.253
NP_442554.1_8 Forward -145 -135 1.74999 0.298
NP_441762.1_7 Reverse -277 -289 10.6587 0.0142
NP_441762.1_7 Forward -295 -283 8.9871 0.0142
NP_441762.1_7 Reverse -284 -296 -0.354346 0.0772
NP_442142.1_4 Forward -109 -96 3.65697 0.248
NP_442142.1_4 Reverse -275 -288 2.28034 0.295
NP_442292.1_1 Forward -293 -284 -0.0986038 0.239
NP_442292.1_1 Reverse -279 -288 -0.196935 0.239
NP_442292.1_1 Reverse -286 -295 -0.295266 0.24
NP_442381.1_8 Reverse -282 -301 -14.9469 0.29
NP_443009.1_5 Forward -295 -284 10.8746 0.0717
NP_443009.1_5 Reverse -277 -288 6.94134 0.144
NP_440357.1_3 Forward -157 -138 3.73603 0.242
NP_440015.1_9 Forward -287 -269 0.412472 0.252
NP_441448.1_1 Reverse -138 -157 8.55425 0.206
NP_440379.1_5 Forward -185 -166 -11.1119 0.288
NP_441468.1_1 Forward -293 -286 6.13563 0.209
NP_441468.1_1 Forward -286 -279 6.13563 0.209
NP_441468.1_1 Reverse -286 -293 6.0373 0.223
NP_441468.1_1 Reverse -279 -286 6.0373 0.223
NP_441020.2_6 Forward -296 -279 11.3469 0.123
NP_441020.2_6 Reverse -283 -300 5.74204 0.291
NP_441673.1_1 Forward -294 -285 11.1111 0.0121
NP_441673.1_1 Reverse -285 -294 11.0128 0.018
NP_441673.1_1 Forward -287 -278 1.27803 0.155
NP_441673.1_1 Reverse -278 -287 1.27803 0.155
NP_441876.1_9 Forward -358 -348 11.8776 0.269
NP_441876.1_9 Forward -204 -194 11.4843 0.275
NP_441826.1_2 Forward -293 -279 3.24451 0.113
NP_442868.1_6 Forward -71 -61 2.92996 0.205
NP_442719.1_2 Reverse -35 -53 -8.43801 0.249
NP_442677.1_3 Forward -156 -137 5.40766 0.223
NP_442677.1_3 Forward -364 -345 -5.01543 0.287
NP_442808.1_1 Reverse -284 -294 19.0557 0.00201
NP_440145.1_3 Forward -304 -285 -3.3438 0.195
NP_440145.1_4 Forward -11 -1 16.3025 0.141
NP_442542.1_2 Forward -289 -276 8.08242 0.163
NP_442050.1_5 Reverse -276 -286 12.7626 0.0516
NP_440601.1_8 Reverse -31 -50 14.6806 0.231
NP_441518.1_3 Reverse -166 -185 -14.4552 0.276
NP_441878.1_6 Forward -295 -285 10.5014 0.0176
NP_441878.1_6 Reverse -277 -287 0.668351 0.139
NP_441878.1_6 Reverse -284 -294 0.57002 0.14
NP_441878.1_6 Forward -170 -160 -7.49312 0.231
NP_441036.1_7 Reverse -326 -336 16.7941 0.0578
NP_441036.1_8 Forward -288 -278 12.5664 0.0744
NP_441036.1_8 Reverse -284 -294 8.4365 0.174
NP_441036.1_8 Forward -295 -285 7.15819 0.208
NP_441557.1_5 Forward -294 -285 10.2261 0.0144
NP_441557.1_5 Reverse -285 -294 10.1278 0.0188
NP_441557.1_5 Forward -287 -278 8.94785 0.0289
NP_441557.1_5 Reverse -278 -287 0.688044 0.128
NP_441557.1_8 Forward -11 -1 10.796 0.275
NP_441445.1_1 Reverse -269 -288 7.37428 0.135
NP_441445.1_1 Reverse -151 -170 1.96607 0.245
NP_441433.1_8 Reverse -341 -360 -1.47551 0.258
NP_442777.1_3 Forward -19 -1 9.16315 0.158
NP_440101.1_10 Forward -293 -274 1.57275 0.288
NP_442469.1_8 Reverse -241 -255 12.291 0.291
NP_442183.1_1 Reverse -108 -122 10.3243 0.0857
NP_442166.1_1 Forward -90 -71 -7.37537 0.257
NP_441238.1_10 Reverse -243 -257 9.93102 0.292
NP_442347.1_2 Reverse -279 -288 8.94785 0.0718
NP_442645.1_2 Reverse -277 -296 -12.6852 0.144
NP_442645.1_2 Forward -302 -283 -22.3217 0.29
NP_441037.1_4 Reverse -1 -11 12.288 0.109
NP_441037.1_4 Reverse -283 -293 10.7287 0.187
NP_441037.1_4 Forward -296 -286 8.29227 0.237
NP_442594.1_8 Reverse -59 -78 14.1591 0.146
NP_442594.1_10 Forward -93 -74 9.93006 0.28
NP_441633.1_3 Reverse -283 -296 3.06754 0.0764
NP_441633.1_3 Forward -289 -276 -6.76555 0.271
NP_440136.1_2 Forward -293 -286 6.23397 0.171
NP_440136.1_2 Forward -286 -279 6.23397 0.171
NP_440136.1_2 Reverse -286 -293 6.13563 0.193
NP_440136.1_2 Reverse -279 -286 6.13563 0.193
NP_442590.1_9 Forward -209 -190 9.0459 0.23
NP_442590.1_10 Forward -294 -275 6.78429 0.237
NP_442590.1_10 Reverse -278 -297 3.24438 0.294
NP_442998.1_5 Reverse -144 -154 7.35486 0.295
NP_442998.1_10 Reverse -287 -294 15.5754 0.0102
NP_442998.1_10 Reverse -280 -287 15.5754 0.0102
NP_442998.1_10 Forward -292 -285 5.84064 0.235
NP_440299.1_1 Reverse -274 -287 2.28034 0.292
NP_441799.1_1 Reverse -274 -288 11.9953 0.0487
NP_441799.1_1 Forward -298 -284 7.3738 0.144
NP_442333.2_5 Reverse -274 -293 -15.6352 0.299
NP_441512.1_4 Reverse -274 -293 10.4225 0.237
NP_440915.1_6 Forward -291 -277 1.86788 0.131
NP_440915.1_6 Reverse -281 -295 1.47456 0.138
NP_442866.1_1 Forward -292 -273 -8.26035 0.279
NP_441464.1_8 Reverse -285 -299 3.8345 0.287
NP_441494.1_6 Reverse -249 -262 7.88576 0.246
NP_442386.1_9 Reverse -284 -293 11.8973 0.0799
NP_442386.1_9 Forward -288 -279 5.9975 0.23
NP_442386.1_9 Forward -277 -268 5.89917 0.233
NP_442386.1_9 Forward -70 -61 5.50585 0.25
NP_441340.1_5 Forward -293 -286 13.5105 0.0314
NP_441340.1_5 Forward -286 -279 13.5105 0.0314
NP_441340.1_5 Reverse -286 -293 5.84064 0.208
NP_441340.1_5 Reverse -279 -286 5.84064 0.208
NP_442240.1_1 Forward -93 -74 8.35677 0.238
NP_440586.1_1 Forward -195 -176 -2.55715 0.254
NP_440586.1_8 Reverse -286 -293 9.47853 0.146
NP_440586.1_8 Reverse -279 -286 9.47853 0.146
NP_440586.1_8 Forward -293 -286 5.74197 0.283
NP_440586.1_8 Forward -286 -279 5.74197 0.283
NP_440192.1_4 Reverse -58 -77 8.62144 0.292
NP_442959.1_5 Forward -127 -108 6.58763 0.251
NP_441262.1_3 Forward -294 -287 14.7888 0.0223
NP_441262.1_3 Forward -287 -280 14.7888 0.0223
NP_440027.1_3 Forward -255 -237 3.26332 0.275
NP_443051.1_1 Forward -295 -286 15.1427 0.00754
NP_443051.1_1 Forward -288 -279 7.47288 0.0571
NP_443051.1_1 Reverse -284 -293 0.589713 0.143
NP_443051.1_1 Reverse -277 -286 -1.08191 0.281
NP_439937.1_8 Reverse -132 -151 0.294447 0.235
NP_439937.1_9 Forward -180 -163 -16.8747 0.289
NP_439937.1_9 Forward -288 -271 -17.268 0.296
NP_440408.1_7 Reverse -70 -89 8.35759 0.281
NP_440439.1_1 Forward -290 -277 1.78924 0.143
NP_440439.1_1 Reverse -282 -295 1.10092 0.162
NP_442239.1_8 Reverse -236 -255 4.52268 0.296
NP_439943.1_2 Forward -335 -316 17.0107 0.147
NP_440372.1_2 Forward -293 -286 13.8055 0.0214
NP_440372.1_2 Forward -286 -279 13.8055 0.0214
NP_440372.1_2 Reverse -286 -293 6.52896 0.188
NP_440372.1_2 Reverse -279 -286 6.52896 0.188
NP_440139.1_1 Forward -293 -274 14.5516 0.048
NP_440139.1_1 Forward -300 -281 1.17865 0.269
NP_441572.1_7 Forward -293 -274 3.24438 0.119
NP_441572.1_7 Reverse -272 -291 -4.81876 0.244
NP_442887.1_5 Reverse -311 -330 -11.8003 0.27
NP_442384.1_10 Reverse -285 -298 6.21414 0.108
NP_442384.1_10 Reverse -278 -291 3.75586 0.179
NP_442384.1_10 Forward -169 -156 1.00259 0.271
NP_442790.1_4 Forward -303 -284 -15.5368 0.294
NP_442262.1_10 Reverse -286 -293 13.2155 0.0213
NP_442262.1_10 Reverse -279 -286 13.2155 0.0213
NP_441689.1_5 Reverse -276 -286 8.63269 0.132
NP_442244.1_3 Reverse -281 -300 11.1109 0.148
NP_440531.1_6 Reverse -270 -289 -1.27885 0.231
NP_442910.1_1 Reverse -153 -172 2.26107 0.118
NP_440562.1_1 Forward -94 -75 12.3883 0.269
NP_440297.1_9 Forward -286 -276 0.766681 0.282
NP_440297.1_9 Reverse -286 -296 -0.216628 0.282
NP_441103.1_9 Reverse -48 -58 13.4661 0.259
NP_440894.1_7 Forward -310 -291 16.7149 0.121
NP_440894.1_10 Reverse -39 -58 3.44104 0.272
NP_440999.1_2 Forward -43 -24 13.6675 0.177
NP_440999.1_9 Reverse -19 -33 -1.96703 0.254
NP_440888.1_2 Reverse -278 -292 7.47213 0.194
NP_440600.1_4 Forward -302 -284 -5.48739 0.28
NP_441543.1_2 Forward -293 -284 9.14451 0.0856
NP_441543.1_2 Reverse -279 -288 8.65285 0.0968
NP_441543.1_3 Forward -72 -58 13.077 0.163
NP_441543.1_3 Forward -88 -74 8.16044 0.286
NP_442845.1_2 Reverse -76 -90 6.98109 0.199
NP_442845.1_2 Forward -293 -279 6.6861 0.205
NP_441918.1_7 Forward -170 -151 -2.75381 0.297
NP_440722.1_2 Forward -90 -71 -0.295539 0.201
NP_441469.1_8 Forward -277 -268 12.5861 0.102
NP_441469.1_8 Forward -288 -279 6.39124 0.227
NP_441469.1_8 Reverse -284 -293 6.29291 0.227
NP_442637.1_7 Forward -127 -108 2.85105 0.204
NP_443064.1_6 Reverse -285 -295 11.6943 0.124
NP_443064.1_6 Forward -287 -277 9.07643 0.247
NP_442578.1_7 Forward -293 -286 6.0373 0.18
NP_442578.1_7 Forward -286 -279 6.0373 0.18
NP_441462.1_2 Forward -287 -277 17.3846 0.00406
NP_441462.1_2 Reverse -285 -295 10.3048 0.0123
NP_441462.1_2 Forward -294 -284 9.81313 0.0143
NP_441462.1_2 Reverse -160 -170 -1.29827 0.299
NP_441621.1_4 Forward -213 -200 15.8506 0.246
NP_443062.1_1 Forward -287 -269 5.71821 0.22
NP_443062.1_1 Forward -294 -276 4.74314 0.25
NP_443062.1_1 Forward -276 -258 3.76806 0.285
NP_440516.1_6 Forward -146 -132 9.83206 0.234
NP_440516.1_8 Forward -294 -285 16.9127 0.00442
NP_440516.1_8 Reverse -285 -294 14.8477 0.00685
NP_440516.1_8 Forward -287 -278 9.4395 0.0183
NP_440516.1_8 Reverse -278 -287 5.11294 0.118
NP_442428.1_5 Forward -293 -286 6.13563 0.209
NP_442428.1_5 Forward -286 -279 6.13563 0.209
NP_442428.1_5 Reverse -286 -293 6.0373 0.212
NP_442428.1_5 Reverse -279 -286 6.0373 0.212
NP_442120.1_10 Forward -347 -328 -15.7335 0.294
NP_440673.1_3 Reverse -287 -294 12.4288 0.0426
NP_440673.1_3 Reverse -280 -287 12.4288 0.0426
NP_441052.1_2 Forward -294 -284 0.963343 0.255
NP_441052.1_2 Reverse -285 -295 0.57002 0.256
NP_440436.1_4 Forward -293 -284 8.65242 0.0997
NP_440436.1_4 Reverse -279 -288 8.55409 0.0997
NP_440436.1_4 Reverse -286 -295 6.29249 0.164
NP_440436.1_4 Forward -286 -277 5.11253 0.222
NP_441884.1_9 Forward -158 -139 -24.19 0.284
NP_441719.1_4 Forward -293 -286 6.82395 0.0855
NP_441719.1_4 Forward -286 -279 6.82395 0.0855
NP_441719.1_4 Reverse -286 -293 6.52896 0.188
NP_441719.1_4 Reverse -279 -286 6.52896 0.188
NP_441733.1_10 Forward -290 -277 8.08242 0.143
NP_441733.1_10 Forward -297 -284 5.23083 0.223
NP_441004.1_1 Reverse -71 -90 -15.2418 0.273
NP_441004.1_1 Reverse -237 -256 -16.8151 0.287
NP_442366.1_3 Forward -295 -277 2.37909 0.131
NP_442366.1_3 Reverse -277 -295 -5.29072 0.286
NP_442366.1_5 Forward -297 -287 15.4175 0.0374
NP_442366.1_5 Forward -290 -280 12.7626 0.108
NP_440328.1_4 Reverse -279 -298 1.37609 0.225
NP_440094.1_8 Forward -370 -351 3.93269 0.215
NP_443054.1_2 Reverse -276 -290 11.6026 0.0761
NP_443054.1_2 Forward -296 -282 3.34284 0.24
NP_441851.1_10 Forward -295 -285 7.84651 0.13
NP_441851.1_10 Forward -288 -278 7.55152 0.137
NP_441851.1_10 Reverse -284 -294 6.17489 0.182
NP_442208.1_5 Reverse -177 -196 -9.63698 0.295
NP_442622.1_8 Reverse -285 -303 -19.0571 0.296
NP_441668.1_5 Reverse -351 -370 6.88262 0.279
NP_442515.1_1 Forward -264 -250 0.786239 0.18
NP_442515.1_1 Forward -21 -7 -0.295402 0.217
NP_442515.1_1 Reverse -284 -298 -3.63866 0.295
NP_441349.1_10 Reverse -268 -287 -7.96535 0.262
NP_440432.1_9 Reverse -286 -301 7.05973 0.0441
NP_440432.1_9 Forward -207 -192 -4.05167 0.196
NP_439960.1_10 Forward -201 -183 -4.79907 0.297
NP_440474.1_8 Reverse -177 -191 4.62054 0.271
NP_442450.1_5 Forward -296 -286 7.84651 0.13
NP_440588.1_2 Forward -296 -277 -6.68705 0.289
NP_442335.1_7 Forward -125 -111 12.2903 0.27
NP_442006.1_2 Forward -245 -228 -5.76269 0.146
NP_442006.1_2 Reverse -190 -207 -17.3657 0.274
NP_442006.1_2 Forward -355 -338 -19.1357 0.299
NP_441570.1_1 Reverse -285 -303 -15.3205 0.229
NP_441078.1_4 Forward -294 -285 9.93116 0.0203
NP_441078.1_4 Reverse -285 -294 9.83282 0.0226
NP_441078.1_4 Reverse -278 -287 0.0980582 0.205
NP_441078.1_4 Forward -287 -278 0.0980582 0.205
NP_441078.1_4 Reverse -160 -169 -1.47524 0.266
NP_442729.1_5 Reverse -2 -12 8.82982 0.244
NP_441432.1_8 Forward -295 -286 5.60459 0.147
NP_441432.1_8 Forward -288 -279 5.50626 0.151
NP_441432.1_8 Reverse -159 -168 2.94966 0.28
NP_442344.1_7 Reverse -279 -298 -5.60541 0.168
NP_442540.1_5 Reverse -231 -250 11.6017 0.233
NP_440760.1_1 Reverse -285 -304 -22.2233 0.252
NP_442797.1_7 Reverse -277 -295 0.412472 0.274
NP_441805.1_6 Reverse -132 -151 11.4058 0.194
NP_442489.1_7 Reverse -285 -294 10.5211 0.0102
NP_442489.1_7 Forward -294 -285 10.4228 0.0151
NP_442489.1_7 Reverse -278 -287 0.786375 0.152
NP_442489.1_7 Forward -287 -278 0.589713 0.17
NP_440559.1_1 Forward -286 -277 14.651 0.0144
NP_440559.1_1 Reverse -286 -295 7.66954 0.0999
NP_440559.1_1 Forward -293 -284 5.99792 0.135
NP_441659.2_8 Reverse -285 -295 16.2046 0.0035
NP_441659.2_8 Reverse -278 -288 6.56821 0.0714
NP_441659.2_8 Forward -294 -284 2.43831 0.2
NP_441659.2_8 Forward -287 -277 0.176696 0.271
NP_440708.1_6 Reverse -25 -44 -10.817 0.291
NP_440779.1_5 Forward -208 -191 -14.8091 0.274
NP_442346.1_5 Forward -295 -285 8.82982 0.124
NP_442346.1_5 Reverse -277 -287 5.97822 0.219
NP_440352.1_5 Reverse -194 -213 10.417 0.275
NP_441856.1_3 Forward -290 -271 -3.73712 0.299
NP_440459.1_2 Reverse -276 -293 9.97027 0.212
NP_440010.1_10 Forward -306 -287 6.09597 0.226
NP_442603.1_7 Forward -287 -273 5.80051 0.273
NP_441948.1_4 Forward -301 -283 -2.43913 0.166
NP_441358.1_2 Reverse -71 -90 13.5691 0.244
NP_441833.1_4 Reverse -286 -293 6.52896 0.0924
NP_441833.1_4 Reverse -279 -286 6.52896 0.0924
NP_441833.1_4 Forward -293 -286 6.23397 0.163
NP_441833.1_4 Forward -286 -279 6.23397 0.163
NP_442162.1_9 Forward -293 -286 12.9205 0.0282
NP_442162.1_9 Forward -286 -279 12.9205 0.0282
NP_442162.1_9 Reverse -286 -293 12.9205 0.0282
NP_442162.1_9 Reverse -279 -286 12.9205 0.0282
NP_440671.1_4 Reverse -272 -286 11.6026 0.129
NP_440671.1_4 Forward -293 -279 7.07942 0.227
NP_442140.1_3 Reverse -279 -289 14.1397 0.0501
NP_442140.1_3 Reverse -286 -296 11.4848 0.0757
NP_442140.1_3 Reverse -138 -148 10.8948 0.0893
NP_442140.1_3 Forward -293 -283 6.96153 0.156
NP_440875.1_9 Reverse -238 -248 8.66404 0.233
NP_440875.1_9 Reverse -280 -290 8.46937 0.233
NP_442547.1_7 Reverse -264 -283 11.4877 0.255
NP_441813.1_5 Reverse -276 -286 12.1731 0.0198
NP_441813.1_5 Reverse -283 -293 6.76487 0.0792
NP_441813.1_5 Forward -289 -279 0.176696 0.215
NP_440590.1_4 Forward -293 -280 9.65572 0.0341
NP_440590.1_4 Reverse -279 -292 0.412608 0.157
NP_440567.1_1 Forward -293 -279 7.37441 0.0726
NP_440567.1_1 Reverse -279 -293 6.48943 0.0831
NP_440567.1_1 Forward -286 -272 0.392915 0.246
NP_440035.1_10 Forward -92 -74 16.1937 0.229
NP_442497.1_10 Reverse -286 -295 10.0295 0.0222
NP_442497.1_10 Forward -286 -277 8.25953 0.047
NP_442497.1_10 Forward -293 -284 0.688044 0.141
NP_442497.1_10 Reverse -279 -288 0.589713 0.153
NP_440821.1_4 Reverse -276 -286 1.25834 0.139
NP_440821.1_4 Forward -296 -286 1.25834 0.139
NP_440821.1_4 Forward -289 -279 0.471689 0.174
NP_440821.1_4 Reverse -283 -293 0.373358 0.18
NP_442810.1_1 Forward -48 -29 24.3855 0.0156
NP_441239.1_9 Reverse -283 -295 14.592 0.0271
NP_441239.1_9 Reverse -276 -288 11.4454 0.0607
NP_441239.1_9 Forward -81 -69 9.38042 0.108
NP_441239.1_9 Forward -296 -284 3.57889 0.283
NP_441892.1_1 Reverse -190 -207 -1.23946 0.201
NP_441892.1_1 Forward -303 -286 -3.10775 0.233
NP_440665.1_1 Forward -260 -241 -16.9135 0.295
NP_440665.1_2 Reverse -345 -364 -5.80207 0.247
NP_442643.1_3 Forward -250 -231 -8.55534 0.295
NP_440412.1_5 Forward -114 -95 11.7776 0.287
NP_441782.1_10 Forward -330 -316 14.5896 0.295
NP_440546.1_4 Forward -287 -277 15.4756 0.0459
NP_440546.1_4 Forward -294 -284 12.8578 0.0572
NP_440546.1_4 Reverse -285 -295 10.2399 0.109
NP_440546.1_4 Reverse -278 -288 10.046 0.109
NP_440546.1_6 Forward -60 -41 10.7175 0.245
NP_440546.1_7 Reverse -137 -147 16.1063 0.234
NP_440546.1_8 Reverse -321 -335 18.4858 0.267
NP_440462.1_6 Reverse -283 -293 6.07655 0.129
NP_440462.1_6 Reverse -276 -286 4.20827 0.213
NP_440868.1_4 Forward -291 -279 6.23383 0.0878
NP_440868.1_4 Reverse -281 -293 -0.551008 0.274
NP_440401.1_5 Forward -266 -252 18.3875 0.16
NP_442402.1_2 Forward -392 -378 11.5037 0.272
NP_442039.1_4 Forward -293 -286 11.6422 0.0747
NP_442039.1_4 Forward -286 -279 11.6422 0.0747
NP_441811.1_1 Forward -363 -344 6.68596 0.28
NP_442837.1_3 Forward -293 -286 6.0373 0.25
NP_442837.1_3 Forward -286 -279 6.0373 0.25
NP_442837.1_3 Reverse -286 -293 6.0373 0.25
NP_442837.1_3 Reverse -279 -286 6.0373 0.25
NP_442053.1_1 Reverse -285 -294 16.6177 0.00257
NP_442053.1_1 Forward -294 -285 8.65285 0.0741
NP_442053.1_1 Reverse -278 -287 7.17789 0.104
NP_440505.1_3 Reverse -249 -259 10.0098 0.12
NP_440505.1_3 Forward -289 -279 5.19158 0.241
NP_440914.1_1 Reverse -285 -295 6.56569 0.273
NP_441011.1_8 Forward -293 -284 13.3727 0.0328
NP_441011.1_8 Forward -286 -277 12.0944 0.0517
NP_441011.1_8 Reverse -279 -288 7.07956 0.179
NP_441011.1_8 Reverse -161 -170 5.3096 0.271
NP_442533.1_6 Reverse -285 -294 14.2577 0.0132
NP_442533.1_6 Forward -294 -285 7.47288 0.0898
NP_442533.1_6 Forward -287 -278 5.40793 0.14
NP_442533.1_6 Reverse -278 -287 4.52295 0.179
NP_442533.1_6 Forward -169 -160 2.55633 0.25
NP_442322.1_4 Forward -87 -70 -4.68172 0.26
NP_442322.1_4 Reverse -228 -245 -4.78005 0.262
NP_442229.1_1 Reverse -283 -297 8.16044 0.184
NP_441482.1_7 Forward -300 -286 -3.34366 0.118
NP_441482.1_7 Reverse -272 -286 -11.0135 0.229
NP_439944.1_9 Forward -286 -276 6.37155 0.184
NP_441028.1_6 Forward -359 -349 15.2208 0.152
NP_440116.1_8 Forward -286 -267 -8.26035 0.25
NP_440116.1_8 Forward -293 -274 -8.94866 0.264
NP_440116.1_8 Reverse -118 -137 -10.1286 0.299
NP_441527.1_4 Reverse -192 -211 -6.63711 0.222
NP_439965.1_7 Forward -82 -63 11.001 0.294
NP_441106.1_1 Reverse -284 -293 8.55452 0.0538
NP_441106.1_1 Forward -288 -279 8.45619 0.0548
NP_001035870.1_3 Reverse -149 -168 -5.21209 0.278
NP_441286.1_1 Reverse -284 -296 -3.89426 0.147
NP_441286.1_1 Forward -288 -276 -4.28759 0.154
NP_440670.1_8 Forward -294 -285 18.0926 0.00136
NP_440670.1_8 Reverse -285 -294 15.831 0.00494
NP_440670.1_8 Forward -287 -278 8.65285 0.0627
NP_440670.1_8 Reverse -278 -287 6.29291 0.124
NP_440886.1_7 Reverse -284 -294 16.4991 0.0104
NP_440886.1_7 Forward -255 -245 4.20782 0.249
NP_442614.1_2 Forward -287 -273 16.7159 0.0675
NP_442072.1_9 Forward -295 -277 5.91901 0.0153
NP_442072.1_9 Reverse -277 -295 -13.0589 0.098
NP_442022.1_4 Forward -140 -121 5.80098 0.279
NP_440907.2_8 Reverse -286 -296 14.4342 0.0312
NP_440907.2_8 Reverse -279 -289 12.4676 0.0624
NP_440907.2_8 Forward -293 -283 4.69947 0.25
NP_441021.1_1 Forward -97 -78 -9.73531 0.219
NP_441021.1_8 Forward -299 -281 4.6407 0.222
NP_442842.1_10 Forward -211 -192 6.19299 0.207
NP_441626.1_2 Forward -293 -286 12.2322 0.0511
NP_441626.1_2 Forward -286 -279 12.2322 0.0511
NP_441626.1_2 Reverse -286 -293 5.93897 0.231
NP_441626.1_2 Reverse -279 -286 5.93897 0.231
NP_442615.1_1 Forward -296 -278 0.117479 0.107
NP_441962.1_4 Reverse -103 -122 -3.24547 0.143
NP_440387.1_1 Forward -294 -278 -2.39974 0.147
NP_441431.1_2 Reverse -282 -296 12.9786 0.102
NP_441431.1_2 Reverse -275 -289 8.45543 0.216
NP_441836.1_2 Forward -152 -133 -6.09707 0.291
NP_441993.1_1 Reverse -237 -256 5.94244 0.192
NP_442084.1_6 Reverse -367 -385 6.90232 0.221
NP_442352.1_1 Forward -152 -139 17.2149 0.166
NP_440114.1_10 Forward -294 -280 13.8643 0.0481
NP_440114.1_10 Reverse -278 -292 10.0294 0.155
NP_440114.1_10 Reverse -285 -299 9.5377 0.169
NP_442323.1_7 Forward -90 -71 11.3067 0.141
NP_440287.1_6 Reverse -276 -295 2.0644 0.254
NP_442087.1_2 Reverse -160 -179 18.6334 0.117
NP_440766.1_4 Forward -291 -277 0.88457 0.263
NP_440643.1_2 Reverse -251 -270 1.37609 0.298
NP_439910.1_2 Reverse -270 -287 -13.0392 0.127
NP_442867.1_8 Forward -206 -187 6.68596 0.257
NP_440457.1_1 Forward -298 -286 3.38223 0.196
NP_440457.1_1 Forward -291 -279 3.08724 0.203
NP_440457.1_1 Reverse -274 -286 1.31728 0.241
NP_440798.1_6 Forward -293 -280 13.589 0.0445
NP_440798.1_6 Reverse -279 -292 13.589 0.0445
NP_440798.1_6 Reverse -286 -299 2.96921 0.158
NP_441436.1_2 Reverse -238 -257 -6.78538 0.296
NP_442509.1_9 Reverse -285 -295 14.6309 0.0263
NP_442509.1_9 Forward -294 -284 13.4509 0.0553
NP_441440.1_8 Reverse -242 -255 16.7355 0.299
NP_440554.1_4 Reverse -279 -289 4.40493 0.19
NP_441885.1_5 Forward -294 -284 9.22315 0.0223
NP_441885.1_5 Forward -287 -277 7.84651 0.0419
NP_441885.1_5 Reverse -285 -295 1.55333 0.109
NP_440478.1_9 Reverse -164 -183 10.9142 0.255
NP_442703.1_4 Reverse -278 -297 10.6184 0.167
NP_442341.1_7 Reverse -284 -298 6.3911 0.127
NP_442341.1_7 Forward -295 -281 4.32615 0.194
NP_442341.1_9 Forward -289 -275 9.83206 0.144
NP_442341.1_9 Reverse -73 -87 8.3571 0.171
NP_442341.1_9 Reverse -283 -297 5.89884 0.252
NP_442395.2_2 Forward -333 -314 10.2251 0.275
NP_440423.1_3 Reverse -240 -259 13.7658 0.201
NP_440423.1_6 Forward -302 -283 -2.75381 0.126
NP_440275.1_3 Forward -296 -286 7.35486 0.0755
NP_440275.1_3 Forward -289 -279 5.78156 0.131
NP_440091.1_1 Reverse -281 -293 3.18557 0.166
NP_440091.1_1 Forward -291 -279 2.89058 0.181
NP_443010.1_10 Forward -290 -273 6.24961 0.192
NP_441122.1_1 Reverse -156 -171 3.42148 0.281
NP_441105.1_3 Reverse -263 -282 -9.047 0.283
NP_440216.1_1 Forward -294 -280 7.76774 0.00849
NP_440216.1_1 Reverse -278 -292 5.50613 0.0196
NP_440216.1_1 Reverse -285 -299 3.14618 0.0284
NP_440216.1_1 Forward -287 -273 -12.5868 0.288
NP_440172.1_1 Reverse -285 -295 13.353 0.0211
NP_440172.1_1 Forward -287 -277 8.82982 0.0586
NP_442015.1_10 Reverse -274 -287 0.510939 0.224
NP_442015.1_10 Reverse -281 -294 -0.669033 0.277
NP_441226.1_7 Forward -293 -286 12.7234 0.0312
NP_441226.1_7 Forward -286 -279 12.7234 0.0312
NP_441226.1_7 Reverse -286 -293 11.5435 0.0757
NP_441226.1_7 Reverse -279 -286 11.5435 0.0757
NP_441111.1_7 Forward -293 -285 8.96754 0.0463
NP_441111.1_7 Reverse -286 -294 8.86921 0.0589
NP_441111.1_7 Reverse -279 -287 8.86921 0.0589
NP_442379.1_10 Reverse -278 -295 -0.846137 0.223
NP_441766.1_2 Reverse -285 -294 13.9627 0.0114
NP_441766.1_2 Forward -287 -278 8.1612 0.0645
NP_441766.1_2 Forward -294 -285 7.76787 0.0714
NP_441766.1_2 Reverse -278 -287 5.89959 0.103
NP_440416.1_1 Reverse -3 -22 -13.5702 0.281
NP_440416.1_9 Forward -294 -275 -12.6852 0.159
NP_440416.1_9 Reverse -278 -297 -17.0118 0.229
NP_442154.1_1 Reverse -237 -255 -14.9272 0.218
NP_442154.1_1 Reverse -243 -261 -18.0738 0.276
NP_440988.1_10 Reverse -374 -388 7.99683 0.209
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCAGCCTTGAAGTTTTCCACTGGCACGGTGAAACCTTTGATTTACCCCCAGGGGCAGAGTTAATTGCCTCCAGCCAAGCTTGTCAGCATCAGGCTTTCCAAATTGGGCGATCGGCGATCGGTCTGCAATGCCATTTGGAAACTACCCCCACAGCGGCCCAGGCTTTAGTAGACAATTGTGCTGATGAATTGATCCTTGGCCCCTTTGTGCAGGATGCCACCACTATTTTGGCCGATAACCAAGCTAGATTTGCCACCATGGGCGCAGTTCTAGTCCAATTGCTGGAATATCTACACCATCAAGTTATTACCCCTGCCTAATCCCCTGGCTCCCAATCCCTAGAAGCGGAGAATATGGCACAATCTAGGGAGAATACTACGGTAACAACACCATCTCCCC

CDS

ATGATTCCAACCGTCATTGAAACGTCTGGGCGTGGCGATCGCGCCTTTGATATTTATTCCCGCCTACTCCGGGAGCGGATTGTCTTCCTGGGGCAAGAAGTCCGGGATGAGAACGCCAATTTAGTTGTTGCCCAACTGCTGTTTTTGGAAGCGGAAGATCCGGAAAAAGACATTTATCTTTACATCAACTCCCCCGGAGGCTCGGTGTCGGCAGGACTAGGAATTTTCGACACCATGAACCAGATCCGCCCCGATGTGTGTACCATCTGCATCGGTTTAGCGGCCAGCATGGGGGCTTTTCTCCTTAGTGCTGGAGCCAAAGGTAAGCGCATGAGTTTGCCCAACTCCCGCATCATGATTCACCAACCCCTAGGGGGAGCCCAGGGCCAAGCCACGGATATTGAAATTCAAGCCAAAGAGATTCTTTATCTTAAAGCACTACTTAACCAACATTTGGCCAACCACACTGGCAAATCCCTAGAGGAAATTACCGCCGATACGGAACGGGATTTCTTTATGTCCGCTGAGGAATCGAAGGAATATGGCTTGATTGACCAGGTAATTAACCGTCGTCCTTCCGCCAGTGACCCTATTTAA

Protein

MIPTVIETSGRGDRAFDIYSRLLRERIVFLGQEVRDENANLVVAQLLFLEAEDPEKDIYLYINSPGGSVSAGLGIFDTMNQIRPDVCTICIGLAASMGAFLLSAGAKGKRMSLPNSRIMIHQPLGGAQGQATDIEIQAKEILYLKALLNQHLANHTGKSLEEITADTERDFFMSAEESKEYGLIDQVINRRPSASDPI