Your browser is old and dusty. Try Google Chrome!

Details for slr0527

ORF slr0527
Accession NP_442743.1
Symbol
Category transcription regulator ExsB homolog
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -241 -227 4.71948 0.145
NP_441061.1_2 Reverse -228 -242 1.67122 0.183
NP_441061.1_2 Forward -145 -131 -1.08205 0.249
NP_440557.1_1 Forward -241 -222 -1.47551 0.273
NP_440795.1_7 Forward -241 -234 14.6904 0.0123
NP_440795.1_7 Reverse -234 -241 14.6904 0.0123
NP_440795.1_7 Forward -396 -389 9.77388 0.169
NP_440795.1_7 Reverse -261 -268 7.80726 0.232
NP_440795.1_7 Reverse -386 -393 6.43063 0.265
NP_441418.1_6 Forward -242 -223 -9.63698 0.0288
NP_441418.1_6 Forward -230 -211 -29.0082 0.215
NP_443032.1_8 Forward -60 -41 -0.39387 0.245
NP_440897.1_6 Reverse -233 -252 1.76863 0.17
NP_441453.1_1 Reverse -226 -244 21.0611 0.0281
NP_441453.1_4 Reverse -233 -241 16.539 0.00633
NP_441453.1_4 Forward -242 -234 16.539 0.00633
NP_441453.1_8 Reverse -202 -219 8.29864 0.25
NP_442151.1_6 Forward -242 -228 14.2576 0.0379
NP_442151.1_6 Reverse -92 -106 9.2427 0.155
NP_442151.1_6 Reverse -233 -247 8.25939 0.178
NP_442151.1_6 Reverse -109 -123 8.25939 0.178
NP_441818.1_9 Reverse -264 -283 -9.047 0.287
NP_441818.1_9 Reverse -271 -290 -9.14533 0.287
NP_441818.1_9 Forward -113 -94 -10.1286 0.292
NP_440226.1_1 Forward -242 -223 5.70265 0.148
NP_441465.1_8 Forward -150 -132 7.78729 0.235
NP_441630.1_3 Forward -250 -231 5.89931 0.135
NP_442287.1_3 Forward -250 -233 21.0809 0.0278
NP_442287.1_3 Forward -315 -298 13.6078 0.294
NP_442655.1_10 Forward -245 -226 -19.9617 0.296
NP_442173.1_1 Forward -241 -233 15.4574 0.00633
NP_442173.1_1 Reverse -234 -242 15.4574 0.00633
NP_442173.1_6 Forward -101 -87 18.9775 0.077
NP_442752.1_4 Forward -242 -235 13.8055 0.0199
NP_442752.1_4 Reverse -233 -240 13.8055 0.0199
NP_442752.1_4 Forward -341 -334 10.5605 0.1
NP_443027.1_4 Reverse -231 -241 16.2046 0.0437
NP_443027.1_4 Forward -244 -234 13.2547 0.0521
NP_442975.1_10 Reverse -229 -243 13.077 0.0459
NP_442975.1_10 Forward -246 -232 11.5037 0.0497
NP_440784.1_7 Forward -241 -234 15.9687 0.0123
NP_440784.1_7 Reverse -234 -241 15.9687 0.0123
NP_441250.1_8 Reverse -88 -97 17.8955 0.274
NP_440061.1_9 Forward -157 -143 10.422 0.124
NP_440061.1_9 Reverse -231 -245 8.65209 0.167
NP_440061.1_9 Reverse -207 -221 7.57046 0.202
NP_440061.1_9 Forward -399 -385 6.78381 0.232
NP_440061.1_9 Forward -135 -121 5.40719 0.286
NP_440110.1_8 Forward -396 -377 7.27595 0.112
NP_441476.1_5 Reverse -222 -241 -5.01543 0.26
NP_440878.1_4 Forward -202 -184 12.3105 0.288
NP_440878.1_9 Reverse -269 -288 -0.295539 0.209
NP_440878.1_9 Reverse -223 -242 -2.95047 0.281
NP_442062.1_8 Reverse -233 -243 10.3048 0.0493
NP_442062.1_8 Forward -242 -232 10.3048 0.0493
NP_440761.1_4 Forward -247 -228 -14.0619 0.257
NP_440304.1_4 Reverse -231 -241 19.9412 0.00364
NP_440304.1_4 Forward -244 -234 10.8948 0.051
NP_440304.1_4 Reverse -151 -161 2.83163 0.299
NP_442242.1_4 Forward -241 -234 14.3954 0.0124
NP_442242.1_4 Reverse -234 -241 14.3954 0.0124
NP_440044.1_8 Forward -241 -222 2.45773 0.15
NP_441781.1_7 Forward -242 -223 13.0775 0.136
NP_439918.1_2 Forward -113 -94 -0.39387 0.231
NP_441935.1_10 Forward -302 -283 16.8141 0.287
NP_440893.1_3 Forward -156 -137 2.16195 0.273
NP_441208.1_9 Reverse -230 -244 8.35772 0.219
NP_440370.1_10 Reverse -224 -243 8.16093 0.243
NP_442276.1_2 Reverse -124 -143 2.3594 0.299
NP_440132.1_1 Forward -244 -226 14.5721 0.123
NP_442110.1_7 Forward -242 -228 21.1407 0.013
NP_441082.1_10 Forward -144 -131 7.98409 0.29
NP_442726.1_1 Forward -235 -216 7.7676 0.288
NP_442726.1_7 Reverse -340 -358 3.65739 0.215
NP_440769.1_8 Forward -208 -189 7.7676 0.25
NP_440856.1_4 Forward -249 -230 -2.0655 0.209
NP_441083.1_3 Reverse -265 -275 12.4676 0.253
NP_441083.1_5 Forward -242 -232 11.2881 0.0159
NP_441083.1_5 Reverse -233 -243 11.2881 0.0159
NP_441083.1_5 Reverse -286 -296 5.78156 0.104
NP_441738.1_2 Forward -240 -233 15.28 0.0102
NP_441738.1_2 Reverse -235 -242 15.28 0.0102
NP_441738.1_2 Reverse -180 -187 6.03696 0.295
NP_440209.1_1 Reverse -233 -241 18.1123 0.00295
NP_440209.1_1 Forward -242 -234 18.1123 0.00295
NP_442889.1_8 Forward -245 -231 7.96378 0.136
NP_441713.1_1 Reverse -227 -246 -0.295539 0.0929
NP_441770.1_4 Reverse -138 -157 -9.93197 0.263
NP_440178.1_7 Forward -243 -224 -21.0434 0.207
NP_440178.1_7 Reverse -232 -251 -22.0267 0.249
NP_442570.1_3 Forward -148 -129 -5.9004 0.25
NP_441716.1_1 Reverse -271 -285 8.25939 0.145
NP_441716.1_1 Forward -242 -228 3.53951 0.261
NP_441327.1_1 Reverse -190 -209 8.73051 0.211
NP_442111.1_4 Forward -243 -229 17.6008 0.00983
NP_442111.1_4 Reverse -285 -299 11.2093 0.0515
NP_442111.1_4 Reverse -232 -246 9.43936 0.0609
NP_441624.1_7 Forward -236 -222 10.3243 0.217
NP_440906.1_5 Forward -241 -234 15.8704 0.0124
NP_440906.1_5 Reverse -234 -241 15.8704 0.0124
NP_440747.1_10 Reverse -230 -242 7.80712 0.00223
NP_440747.1_10 Forward -245 -233 7.31547 0.00577
NP_440747.1_10 Reverse -106 -118 -12.1541 0.227
NP_441130.1_3 Forward -289 -270 17.7965 0.291
NP_442973.1_5 Forward -251 -232 9.93088 0.287
NP_441486.1_1 Reverse -283 -297 -5.21195 0.226
NP_442634.1_4 Forward -244 -230 26.3523 0.00109
NP_442634.1_4 Reverse -231 -245 -1.77037 0.149
NP_440403.1_4 Reverse -137 -156 -1.27885 0.174
NP_440403.1_10 Forward -127 -108 1.47442 0.291
NP_440842.1_10 Forward -134 -120 5.21113 0.251
NP_440842.1_10 Forward -327 -313 1.27789 0.294
NP_441695.1_8 Forward -280 -266 10.226 0.295
NP_441014.1_10 Forward -156 -137 -1.08295 0.257
NP_442848.1_1 Reverse -227 -241 -2.16369 0.263
NP_442848.1_1 Reverse -203 -217 -3.04867 0.263
NP_442848.1_4 Forward -141 -127 6.48943 0.284
NP_442848.1_5 Forward -276 -258 -2.53746 0.286
NP_441012.1_4 Reverse -229 -242 5.91914 0.286
NP_443018.1_3 Forward -241 -234 14.8871 0.0123
NP_443018.1_3 Reverse -234 -241 14.8871 0.0123
NP_441182.1_3 Reverse -378 -396 13.4905 0.242
NP_440376.1_1 Forward -242 -233 19.4693 0.000692
NP_440376.1_1 Reverse -233 -242 19.4693 0.000692
NP_440376.1_1 Reverse -315 -324 2.26134 0.228
NP_440376.1_1 Forward -396 -387 1.08137 0.258
NP_440376.1_1 Reverse -146 -155 0.196389 0.283
NP_442687.1_7 Forward -243 -233 9.02648 0.0994
NP_442687.1_7 Reverse -232 -242 9.02648 0.0994
NP_442687.1_7 Forward -296 -286 6.8632 0.151
NP_442687.1_7 Reverse -152 -162 5.78156 0.188
NP_442687.1_7 Reverse -387 -397 5.48657 0.2
NP_442687.1_7 Forward -395 -385 3.91327 0.278
NP_441846.1_10 Forward -230 -211 -21.4367 0.256
NP_440642.1_10 Forward -157 -143 2.16228 0.283
NP_441013.1_2 Forward -150 -132 4.14905 0.226
NP_441422.1_3 Forward -303 -284 16.8375 0.188
NP_441422.1_7 Forward -244 -227 -1.82945 0.194
NP_441763.1_5 Reverse -334 -353 -6.58872 0.274
NP_441763.1_10 Reverse -222 -241 11.0117 0.143
NP_442658.1_1 Forward -244 -234 14.2375 0.0237
NP_442658.1_1 Reverse -231 -241 13.0576 0.04
NP_442658.1_1 Reverse -201 -211 6.37109 0.231
NP_442658.1_10 Forward -286 -267 12.8808 0.296
NP_442198.1_7 Forward -245 -226 16.6165 0.139
NP_440141.1_4 Forward -239 -220 -12.1936 0.299
NP_440141.1_8 Forward -303 -284 14.9458 0.151
NP_442782.1_2 Forward -242 -228 11.2093 0.173
NP_442205.1_9 Reverse -227 -243 -0.236458 0.264
NP_442544.1_2 Forward -147 -133 -0.0987402 0.217
NP_441414.1_9 Reverse -233 -252 -4.32711 0.152
NP_441414.1_9 Reverse -92 -111 -9.83364 0.269
NP_441487.1_9 Reverse -262 -281 0.687771 0.219
NP_441256.1_1 Forward -149 -130 -9.63698 0.29
NP_439959.1_7 Forward -113 -97 19.5273 0.188
NP_442937.1_5 Reverse -261 -280 8.35759 0.225
NP_441165.1_5 Reverse -126 -145 11.5042 0.264
NP_441958.1_5 Forward -243 -233 21.2195 0.000805
NP_441958.1_5 Reverse -232 -242 21.2195 0.000805
NP_441958.1_5 Forward -296 -286 -1.3966 0.239
NP_441127.1_1 Forward -230 -216 12.3893 0.215
NP_440203.1_5 Forward -239 -229 14.9258 0.0886
NP_439905.1_1 Reverse -234 -247 8.27909 0.234
NP_440984.1_7 Forward -247 -233 17.9942 0.0178
NP_440984.1_7 Reverse -281 -295 7.27608 0.178
NP_439990.1_5 Reverse -228 -241 8.18076 0.18
NP_442911.1_2 Reverse -223 -242 -4.13045 0.126
NP_441580.1_6 Reverse -222 -241 13.7658 0.0472
NP_440153.1_5 Reverse -234 -248 5.01447 0.193
NP_440153.1_8 Reverse -89 -102 -2.53732 0.244
NP_442064.1_4 Forward -150 -131 8.84842 0.224
NP_442064.1_4 Forward -156 -137 6.29183 0.254
NP_440993.1_2 Forward -247 -231 3.00846 0.262
NP_440993.1_2 Reverse -228 -244 1.73016 0.279
NP_440993.1_3 Reverse -223 -242 -0.984623 0.273
NP_440827.1_3 Reverse -222 -241 19.2723 0.101
NP_441099.1_5 Reverse -223 -242 0.58944 0.0767
NP_441646.1_1 Forward -302 -283 1.76941 0.228
NP_441646.1_1 Forward -356 -337 0.392778 0.251
NP_441646.1_1 Reverse -220 -239 -1.96717 0.298
NP_442438.1_10 Reverse -228 -242 10.7177 0.0491
NP_441000.1_6 Reverse -232 -246 -3.73699 0.225
NP_440484.1_3 Forward -244 -230 11.111 0.242
NP_441674.1_10 Forward -395 -377 -1.16082 0.29
NP_440147.1_4 Reverse -231 -244 10.7374 0.0355
NP_440147.1_4 Forward -244 -231 9.65572 0.038
NP_440147.1_4 Reverse -330 -343 2.37923 0.208
NP_440147.1_4 Forward -297 -284 0.117615 0.265
NP_441550.1_8 Forward -244 -234 15.8108 0.0132
NP_441550.1_8 Reverse -231 -241 13.0576 0.0273
NP_441916.1_7 Forward -242 -232 18.9579 0.00144
NP_441916.1_7 Reverse -233 -243 18.9579 0.00144
NP_440206.1_4 Reverse -113 -132 1.76863 0.289
NP_440206.1_4 Reverse -267 -286 -0.591301 0.29
NP_441041.1_4 Forward -242 -223 11.1109 0.0268
NP_441041.1_4 Forward -356 -337 -13.0786 0.28
NP_441041.1_7 Forward -165 -153 9.06962 0.124
NP_441041.1_7 Forward -245 -233 7.22324 0.171
NP_441041.1_7 Reverse -230 -242 6.34865 0.211
NP_440569.1_10 Reverse -239 -258 14.4666 0.119
NP_441547.1_2 Reverse -222 -240 3.06741 0.291
NP_442004.1_6 Forward -242 -228 16.3225 0.0577
NP_442004.1_6 Forward -397 -383 1.76955 0.278
NP_441725.1_4 Reverse -228 -242 12.2903 0.0693
NP_441725.1_4 Forward -247 -233 2.75226 0.279
NP_441725.1_5 Forward -241 -231 11.1898 0.0247
NP_441725.1_5 Reverse -234 -244 1.94665 0.115
NP_439966.1_7 Reverse -231 -241 14.8275 0.0177
NP_439966.1_7 Forward -244 -234 14.3359 0.0203
NP_440202.1_8 Reverse -333 -352 11.9461 0.272
NP_442941.1_3 Forward -241 -231 19.9412 0.00262
NP_442941.1_3 Reverse -234 -244 19.2529 0.00262
NP_440289.1_2 Reverse -230 -243 -2.93064 0.262
NP_440289.1_2 Forward -245 -232 -3.61896 0.267
NP_440983.1_5 Reverse -124 -143 -2.26216 0.231
NP_440983.1_5 Forward -242 -223 -7.76869 0.291
NP_440260.1_8 Forward -65 -47 -1.35749 0.233
NP_440260.1_8 Reverse -218 -236 -5.09406 0.273
NP_442281.1_1 Reverse -228 -242 15.6336 0.0113
NP_442281.1_1 Reverse -327 -341 8.75042 0.0764
NP_442281.1_1 Forward -247 -233 8.16044 0.0845
NP_441334.1_7 Forward -244 -225 -10.1286 0.12
NP_442847.1_2 Reverse -48 -67 15.9291 0.278
NP_440177.1_1 Forward -302 -284 2.87075 0.295
NP_440437.1_1 Forward -124 -105 -5.60541 0.291
NP_442012.1_5 Forward -237 -218 -0.0988766 0.288
NP_442049.1_6 Forward -148 -129 5.11266 0.234
NP_441087.1_6 Reverse -108 -126 -1.16155 0.264
NP_440498.1_1 Reverse -224 -242 1.59244 0.204
NP_442982.1_3 Forward -105 -86 19.3707 0.116
NP_441644.1_6 Forward -242 -232 19.0557 0.000803
NP_441644.1_6 Reverse -233 -243 19.0557 0.000803
NP_441644.1_6 Reverse -92 -102 7.0594 0.137
NP_441644.1_6 Reverse -109 -119 5.58445 0.184
NP_442215.1_2 Reverse -128 -144 -4.75968 0.239
NP_442215.1_2 Reverse -107 -123 -6.03799 0.263
NP_442029.1_1 Reverse -135 -154 -20.0601 0.297
NP_442029.1_6 Forward -247 -228 5.01433 0.258
NP_440253.1_2 Reverse -233 -251 -2.24246 0.262
NP_440253.1_2 Forward -230 -212 -3.32411 0.291
NP_440929.1_8 Forward -242 -233 19.2726 0.000701
NP_440929.1_8 Reverse -233 -242 19.2726 0.000701
NP_442933.1_10 Forward -242 -233 17.601 0.00325
NP_442933.1_10 Reverse -233 -242 17.601 0.00325
NP_441751.2_8 Forward -241 -227 6.58777 0.0348
NP_442926.1_3 Reverse -261 -280 1.86774 0.298
NP_442554.1_8 Reverse -234 -244 17.2863 0.00543
NP_442554.1_8 Forward -241 -231 16.9913 0.0065
NP_441762.1_7 Reverse -232 -244 -6.74586 0.284
NP_441762.1_7 Forward -243 -231 -6.84419 0.284
NP_442142.1_4 Reverse -230 -243 15.4566 0.0264
NP_442142.1_4 Forward -245 -232 4.24695 0.227
NP_442142.1_4 Forward -289 -276 3.7553 0.246
NP_442292.1_1 Forward -241 -232 17.5026 0.00435
NP_442292.1_1 Reverse -234 -243 17.5026 0.00435
NP_440122.1_2 Forward -288 -269 -1.57384 0.294
NP_442476.1_6 Reverse -234 -248 4.32615 0.144
NP_443009.1_5 Reverse -232 -243 15.7911 0.0107
NP_443009.1_5 Forward -243 -232 15.7911 0.0107
NP_443009.1_5 Forward -395 -384 4.08976 0.263
NP_442408.2_1 Forward -242 -223 -1.08219 0.234
NP_442408.2_1 Forward -145 -126 -1.57384 0.241
NP_441715.1_4 Reverse -234 -244 16.7946 0.0106
NP_441715.1_4 Forward -241 -231 14.238 0.0295
NP_440279.1_2 Reverse -266 -285 8.45592 0.2
NP_441448.1_1 Forward -385 -366 9.43923 0.195
NP_440158.1_8 Forward -220 -201 8.94757 0.292
NP_440183.1_1 Forward -241 -222 6.09597 0.278
NP_441198.1_8 Reverse -231 -241 13.2713 0.108
NP_440379.1_5 Reverse -218 -237 6.98095 0.133
NP_440464.1_10 Forward -294 -284 13.4856 0.169
NP_441468.1_1 Forward -241 -234 15.8704 0.0124
NP_441468.1_1 Reverse -234 -241 15.8704 0.0124
NP_441015.1_10 Reverse -228 -247 -5.70374 0.23
NP_441015.1_10 Forward -235 -216 -9.34199 0.282
NP_441015.1_10 Reverse -261 -280 -11.1119 0.291
NP_441673.1_1 Forward -242 -233 20.8459 0.000698
NP_441673.1_1 Reverse -233 -242 20.8459 0.000698
NP_441673.1_1 Forward -397 -388 -8.06341 0.254
NP_442757.1_7 Reverse -273 -292 11.7008 0.254
NP_442253.1_5 Reverse -143 -160 0.530496 0.203
NP_441956.1_1 Reverse -311 -330 17.1666 0.225
NP_441876.1_9 Reverse -390 -400 10.501 0.292
NP_441826.1_2 Reverse -227 -241 -2.75368 0.275
NP_441330.1_1 Forward -247 -228 15.6341 0.00578
NP_442490.1_4 Forward -290 -271 15.9949 0.287
NP_442868.1_6 Forward -244 -234 10.4031 0.038
NP_442868.1_6 Reverse -386 -396 4.60159 0.171
NP_442868.1_6 Reverse -231 -241 1.06167 0.205
NP_441056.1_1 Forward -242 -223 -4.32711 0.249
NP_442361.1_3 Reverse -227 -240 8.37742 0.285
NP_442427.1_8 Reverse -297 -316 7.47261 0.214
NP_442808.1_1 Reverse -232 -242 8.73102 0.0481
NP_442808.1_1 Forward -243 -233 8.73102 0.0481
NP_440145.1_3 Forward -252 -233 -1.18052 0.148
NP_442050.1_1 Forward -125 -106 9.63589 0.247
NP_442050.1_1 Forward -270 -251 6.98095 0.28
NP_442050.1_5 Reverse -231 -241 18.0724 0.00365
NP_442050.1_5 Forward -244 -234 15.9091 0.0091
NP_440038.1_4 Forward -157 -138 -0.0988766 0.277
NP_442342.1_9 Forward -244 -228 10.3833 0.137
NP_442342.1_9 Reverse -316 -332 4.97508 0.241
NP_442342.1_9 Reverse -122 -138 3.20513 0.267
NP_440601.1_1 Forward -351 -332 18.7807 0.2
NP_441114.1_3 Reverse -342 -351 7.37455 0.239
NP_441114.1_3 Reverse -132 -141 7.37455 0.239
NP_440558.1_2 Reverse -224 -243 3.53937 0.155
NP_440558.1_2 Forward -127 -108 -6.39206 0.274
NP_440558.1_2 Forward -159 -140 -7.27704 0.291
NP_440558.1_2 Reverse -127 -146 -7.57203 0.296
NP_441878.1_6 Forward -243 -233 10.5014 0.0176
NP_441878.1_6 Reverse -232 -242 10.5014 0.0176
NP_441878.1_6 Reverse -270 -280 9.7148 0.0237
NP_441878.1_6 Reverse -122 -132 9.7148 0.0237
NP_441878.1_6 Forward -281 -271 1.06167 0.116
NP_441878.1_6 Forward -133 -123 1.06167 0.116
NP_441878.1_6 Forward -119 -109 -7.98478 0.285
NP_441036.1_8 Forward -243 -233 15.713 0.00724
NP_441036.1_8 Reverse -232 -242 15.713 0.00724
NP_441036.1_8 Reverse -55 -65 6.07655 0.242
NP_442650.1_2 Forward -242 -228 6.88276 0.13
NP_441557.1_5 Forward -242 -233 19.9609 0.000699
NP_441557.1_5 Reverse -233 -242 19.9609 0.000699
NP_441445.1_8 Forward -339 -320 -11.8003 0.277
NP_442066.2_4 Reverse -233 -252 -8.26035 0.294
NP_442066.2_9 Forward -246 -233 12.409 0.154
NP_442419.1_2 Forward -247 -228 -4.6221 0.291
NP_441308.1_3 Reverse -138 -157 9.24257 0.261
NP_441308.1_8 Reverse -231 -241 13.353 0.218
NP_440101.1_3 Forward -247 -228 2.16274 0.259
NP_440101.1_5 Forward -125 -106 2.55606 0.219
NP_441458.1_10 Reverse -218 -237 4.12936 0.236
NP_442830.1_5 Reverse -324 -338 4.42388 0.239
NP_442192.1_8 Reverse -217 -236 17.5024 0.108
NP_442183.1_1 Forward -242 -228 16.0275 0.0167
NP_441407.1_5 Forward -252 -233 5.99764 0.198
NP_440979.1_2 Forward -147 -133 18.2885 0.189
NP_441459.1_3 Forward -289 -270 10.6499 0.296
NP_441574.1_1 Forward -353 -334 -0.4922 0.206
NP_441574.1_1 Reverse -365 -384 -0.885524 0.211
NP_440058.1_6 Forward -110 -91 3.6377 0.291
NP_441549.1_9 Forward -246 -228 -3.91409 0.198
NP_442170.1_5 Reverse -233 -252 -0.0988766 0.232
NP_442347.1_2 Forward -241 -232 3.34298 0.284
NP_442347.1_2 Reverse -234 -243 3.34298 0.284
NP_442645.1_2 Forward -244 -225 -18.3884 0.272
NP_441037.1_4 Reverse -231 -241 7.31769 0.237
NP_441037.1_4 Forward -244 -234 7.22024 0.237
NP_442508.1_8 Forward -141 -124 8.7903 0.297
NP_441633.1_3 Forward -244 -231 -3.91395 0.177
NP_440136.1_2 Forward -241 -234 15.9687 0.0123
NP_440136.1_2 Reverse -234 -241 15.9687 0.0123
NP_442590.1_10 Forward -242 -223 3.83436 0.283
NP_442998.1_2 Reverse -90 -109 8.06178 0.224
NP_442998.1_10 Forward -240 -233 15.5754 0.0102
NP_442998.1_10 Reverse -235 -242 15.5754 0.0102
NP_440899.1_2 Reverse -222 -241 8.35677 0.2
NP_440299.1_1 Reverse -229 -242 13.195 0.0319
NP_440299.1_3 Forward -151 -132 10.9142 0.244
NP_441799.1_1 Forward -246 -232 13.4703 0.032
NP_441799.1_1 Reverse -229 -243 7.47213 0.141
NP_441799.1_9 Forward -395 -376 -4.03212 0.252
NP_441007.1_5 Forward -373 -354 10.9142 0.214
NP_441007.1_5 Reverse -287 -306 8.84924 0.255
NP_441007.1_10 Reverse -228 -241 3.36254 0.182
NP_441007.1_10 Forward -247 -234 1.10092 0.209
NP_442201.1_10 Forward -253 -234 -6.29373 0.184
NP_442333.2_5 Reverse -222 -241 -11.5053 0.246
NP_440256.1_1 Reverse -230 -249 22.3206 0.00281
NP_440256.1_1 Forward -245 -226 9.63589 0.0198
NP_440087.1_1 Forward -350 -331 -9.63698 0.297
NP_441559.1_8 Reverse -228 -242 1.27789 0.156
NP_441559.1_8 Forward -247 -233 -7.37523 0.291
NP_440915.1_6 Reverse -229 -243 12.8809 0.0206
NP_440915.1_6 Forward -246 -232 9.83269 0.0383
NP_440915.1_6 Reverse -119 -133 -0.0987402 0.182
NP_442855.1_3 Forward -110 -91 11.3075 0.279
NP_442866.1_1 Forward -151 -132 -5.80207 0.245
NP_442866.1_1 Forward -247 -228 -6.39206 0.255
NP_442866.1_1 Forward -346 -327 -8.94866 0.285
NP_440748.1_1 Reverse -337 -356 13.9625 0.255
NP_441494.1_6 Forward -223 -210 10.8357 0.225
NP_441494.1_6 Reverse -383 -396 8.86907 0.227
NP_441494.1_6 Reverse -228 -241 8.86907 0.227
NP_442993.1_1 Forward -242 -226 -10.7579 0.226
NP_440677.1_6 Reverse -224 -243 8.55425 0.276
NP_442386.1_9 Reverse -226 -235 8.84908 0.182
NP_442386.1_9 Reverse -340 -349 7.57079 0.219
NP_442386.1_9 Forward -243 -234 6.39082 0.219
NP_442386.1_9 Reverse -232 -241 6.39082 0.219
NP_442386.1_9 Reverse -130 -139 5.30919 0.257
NP_440570.1_5 Forward -240 -221 4.52268 0.221
NP_441340.1_5 Forward -241 -234 15.6737 0.0124
NP_441340.1_5 Reverse -234 -241 15.6737 0.0124
NP_441947.1_10 Forward -244 -226 1.39578 0.276
NP_442484.1_2 Reverse -222 -241 5.80098 0.161
NP_442484.1_2 Forward -241 -222 0.884433 0.242
NP_442791.1_5 Reverse -91 -110 -9.73531 0.279
NP_440168.1_4 Reverse -157 -176 -7.4737 0.283
NP_442240.1_2 Reverse -234 -253 -20.0601 0.295
NP_441160.1_5 Reverse -249 -268 -6.68705 0.294
NP_440586.1_8 Forward -241 -234 13.2151 0.026
NP_440586.1_8 Reverse -234 -241 13.2151 0.026
NP_442251.1_6 Forward -241 -234 15.2804 0.0124
NP_442251.1_6 Reverse -234 -241 15.2804 0.0124
NP_440684.1_9 Forward -107 -93 7.27608 0.272
NP_441262.1_3 Reverse -233 -240 14.7888 0.0223
NP_441262.1_3 Forward -242 -235 14.7888 0.0223
NP_440027.1_3 Reverse -203 -221 4.54162 0.257
NP_440027.1_3 Forward -155 -137 2.08335 0.293
NP_440027.1_8 Reverse -230 -249 4.81688 0.285
NP_443051.1_1 Reverse -232 -241 19.5676 0.00335
NP_443051.1_1 Forward -243 -234 19.5676 0.00335
NP_440451.1_10 Forward -241 -222 7.37347 0.292
NP_441232.1_10 Forward -306 -287 5.89931 0.172
NP_441232.1_10 Reverse -222 -241 1.47442 0.282
NP_439937.1_9 Forward -398 -381 -17.3663 0.298
NP_440408.1_7 Forward -242 -223 10.9142 0.239
NP_440439.1_1 Reverse -230 -243 15.9489 0.0132
NP_440439.1_1 Forward -245 -232 10.5407 0.0365
NP_440439.1_1 Forward -400 -387 2.2809 0.136
NP_439943.1_7 Reverse -228 -247 3.44104 0.29
NP_440372.1_2 Forward -241 -234 16.3621 0.0124
NP_440372.1_2 Reverse -234 -241 16.3621 0.0124
NP_441789.1_7 Reverse -376 -395 -2.95123 0.267
NP_439977.1_5 Reverse -282 -301 8.35759 0.107
NP_439977.1_5 Forward -248 -229 0.0977854 0.214
NP_440139.1_1 Forward -248 -229 6.78348 0.139
NP_440139.1_1 Forward -152 -133 3.24359 0.211
NP_441572.1_7 Reverse -227 -246 -3.04881 0.206
NP_441572.1_7 Forward -248 -229 -6.1954 0.284
NP_440267.1_2 Forward -247 -233 11.897 0.125
NP_442384.1_10 Forward -242 -229 15.4572 0.00986
NP_442384.1_10 Reverse -233 -246 10.2457 0.0465
NP_442384.1_10 Reverse -286 -299 1.88757 0.243
NP_442384.1_10 Reverse -332 -345 0.904263 0.275
NP_440693.1_8 Reverse -141 -160 11.5042 0.283
NP_441604.1_4 Forward -170 -151 -4.22878 0.224
NP_441877.1_5 Forward -221 -202 -1.27885 0.283
NP_442790.1_4 Reverse -306 -325 -12.2919 0.244
NP_442458.1_4 Forward -354 -335 18.584 0.0984
NP_442262.1_10 Forward -241 -234 14.1988 0.0123
NP_442262.1_10 Reverse -234 -241 14.1988 0.0123
NP_441689.1_5 Reverse -231 -241 17.8758 0.0158
NP_441689.1_5 Forward -244 -234 8.3377 0.132
NP_440344.1_10 Reverse -226 -243 1.51381 0.0304
NP_440075.1_2 Forward -234 -215 9.24257 0.188
NP_440282.1_1 Forward -342 -323 16.7157 0.143
NP_440282.1_10 Reverse -223 -242 -5.21209 0.25
NP_440282.1_10 Forward -384 -365 -9.93197 0.29
NP_442910.1_1 Reverse -226 -245 -5.01543 0.254
NP_440826.1_5 Forward -289 -271 14.3181 0.241
NP_441965.1_3 Reverse -378 -397 2.0644 0.215
NP_441965.1_10 Forward -245 -229 8.12167 0.134
NP_441640.1_8 Forward -144 -125 -3.93378 0.259
NP_440297.1_9 Forward -241 -231 9.22315 0.0917
NP_440297.1_9 Reverse -110 -120 0.471689 0.282
NP_440297.1_9 Reverse -234 -244 -0.216628 0.282
NP_440297.1_9 Reverse -272 -282 -0.314959 0.282
NP_442280.1_10 Forward -149 -131 7.69463 0.268
NP_442280.1_10 Reverse -217 -235 5.84403 0.281
NP_441592.1_4 Forward -280 -261 -0.787193 0.247
NP_440894.1_2 Reverse -210 -229 5.89931 0.172
NP_441679.1_6 Forward -166 -147 -1.86883 0.286
NP_442067.1_4 Forward -247 -228 2.16274 0.298
NP_440999.1_9 Reverse -384 -398 1.37622 0.166
NP_440999.1_9 Reverse -229 -243 0.88457 0.174
NP_440888.1_2 Reverse -233 -247 15.9285 0.00837
NP_440888.1_2 Forward -242 -228 14.8469 0.0144
NP_440888.1_2 Forward -394 -380 11.4053 0.0681
NP_440888.1_2 Forward -218 -204 10.422 0.0946
NP_440888.1_2 Forward -155 -141 8.84875 0.145
NP_440888.1_2 Reverse -347 -361 8.06211 0.172
NP_440600.1_4 Forward -250 -232 11.2289 0.0557
NP_440179.1_6 Reverse -204 -223 4.52268 0.246
NP_440052.1_5 Reverse -222 -241 -1.7705 0.205
NP_440052.1_5 Forward -253 -234 -3.44213 0.235
NP_442948.1_2 Forward -243 -224 11.7008 0.128
NP_441543.1_2 Forward -241 -232 15.9293 0.00518
NP_441543.1_2 Reverse -234 -243 15.9293 0.00518
NP_442845.1_2 Reverse -227 -241 14.8476 0.0774
NP_442845.1_2 Forward -242 -228 6.98109 0.199
NP_442845.1_2 Forward -248 -234 3.63784 0.282
NP_441469.1_8 Reverse -91 -100 9.14451 0.227
NP_441469.1_8 Forward -243 -234 6.5879 0.227
NP_441469.1_8 Reverse -232 -241 6.5879 0.227
NP_443064.1_6 Forward -242 -232 10.8217 0.13
NP_443064.1_6 Reverse -233 -243 10.8217 0.13
NP_443064.1_6 Forward -397 -387 8.59164 0.278
NP_442337.1_6 Reverse -276 -295 13.6417 0.245
NP_442578.1_7 Forward -241 -234 14.5921 0.026
NP_442578.1_7 Reverse -234 -241 14.5921 0.026
NP_440710.1_1 Forward -250 -232 -5.97904 0.218
NP_440710.1_1 Forward -77 -59 -8.73231 0.278
NP_441462.1_2 Forward -242 -232 20.2362 0.000805
NP_441462.1_2 Reverse -233 -243 20.2362 0.000805
NP_441462.1_2 Reverse -388 -398 -0.904945 0.265
NP_441621.1_7 Forward -271 -257 2.94952 0.123
NP_441621.1_7 Forward -244 -230 -5.21195 0.248
NP_443062.1_1 Reverse -233 -251 8.05839 0.16
NP_443062.1_1 Forward -242 -224 7.18082 0.182
NP_441601.1_2 Forward -161 -142 5.50599 0.18
NP_440939.1_5 Forward -111 -95 11.2683 0.273
NP_442204.1_1 Reverse -229 -240 19.2332 0.0136
NP_442204.1_1 Forward -246 -235 1.92696 0.266
NP_442204.1_1 Reverse -294 -305 1.04198 0.281
NP_442204.1_5 Reverse -378 -397 0.786102 0.252
NP_440544.1_5 Reverse -253 -260 14.5681 0.264
NP_440516.1_6 Forward -155 -141 7.07881 0.284
NP_440516.1_8 Forward -242 -233 16.9127 0.00442
NP_440516.1_8 Reverse -233 -242 16.9127 0.00442
NP_441785.1_1 Reverse -251 -265 11.9627 0.278
NP_442428.1_5 Forward -241 -234 15.8704 0.0124
NP_442428.1_5 Reverse -234 -241 15.8704 0.0124
NP_442859.1_2 Reverse -228 -247 10.7175 0.179
NP_442120.1_10 Forward -224 -205 -12.2919 0.27
NP_442823.1_8 Forward -280 -261 12.7825 0.266
NP_441867.1_2 Forward -342 -323 -16.3235 0.291
NP_440673.1_2 Reverse -217 -236 8.92631 0.26
NP_440673.1_3 Forward -240 -233 12.4288 0.0426
NP_440673.1_3 Reverse -235 -242 12.4288 0.0426
NP_441052.1_2 Forward -242 -232 10.4031 0.0285
NP_441052.1_2 Reverse -233 -243 10.4031 0.0285
NP_441052.1_2 Reverse -92 -102 4.99491 0.135
NP_441052.1_2 Forward -295 -285 4.89658 0.14
NP_441052.1_2 Reverse -317 -327 0.57002 0.256
NP_442219.1_8 Reverse -142 -161 8.65027 0.241
NP_442219.1_9 Forward -241 -232 8.25953 0.0681
NP_442219.1_9 Reverse -234 -243 8.25953 0.0681
NP_442219.1_9 Forward -217 -208 1.76968 0.298
NP_440436.1_4 Forward -241 -232 9.24241 0.0871
NP_440436.1_4 Reverse -234 -243 9.24241 0.0871
NP_441884.1_9 Reverse -365 -384 -13.7669 0.138
NP_441884.1_9 Forward -398 -379 -23.6 0.284
NP_441884.1_9 Forward -298 -279 -25.5666 0.29
NP_442086.1_3 Reverse -234 -253 12.5858 0.166
NP_442907.1_9 Reverse -228 -247 11.7008 0.0985
NP_441719.1_4 Forward -241 -234 16.3621 0.0124
NP_441719.1_4 Reverse -234 -241 16.3621 0.0124
NP_441733.1_8 Forward -353 -334 14.4541 0.181
NP_441004.1_1 Forward -107 -88 2.65439 0.106
NP_441004.1_1 Forward -368 -349 -7.96535 0.2
NP_441004.1_1 Reverse -48 -67 -16.5201 0.286
NP_441004.1_2 Forward -305 -286 -1.27885 0.259
NP_441004.1_4 Reverse -17 -27 10.7964 0.254
NP_442813.1_4 Reverse -128 -147 -6.68705 0.299
NP_442366.1_3 Forward -243 -225 -3.42244 0.247
NP_441115.1_4 Reverse -232 -250 11.6214 0.133
NP_442206.1_1 Reverse -122 -141 -3.54046 0.175
NP_442206.1_10 Reverse -131 -146 6.46974 0.178
NP_442206.1_10 Forward -242 -227 4.69978 0.178
NP_443054.1_2 Reverse -384 -398 2.65453 0.242
NP_441966.1_7 Reverse -223 -242 11.7983 0.152
NP_441851.1_10 Forward -243 -233 8.53483 0.114
NP_441851.1_10 Reverse -232 -242 8.53483 0.114
NP_442622.1_5 Forward -244 -225 -3.3438 0.171
NP_442856.1_7 Forward -127 -108 1.47442 0.171
NP_442515.1_1 Reverse -232 -246 3.63784 0.115
NP_442515.1_1 Reverse -285 -299 -4.03198 0.298
NP_442515.1_1 Reverse -314 -328 -4.32697 0.298
NP_440593.1_3 Forward -241 -222 9.14423 0.107
NP_440593.1_3 Forward -144 -125 -4.22878 0.246
NP_440593.1_3 Reverse -204 -223 -6.78538 0.28
NP_440593.1_9 Reverse -119 -133 8.75105 0.255
NP_441349.1_10 Forward -252 -233 9.3409 0.0248
NP_441349.1_10 Reverse -223 -242 -2.26216 0.116
NP_441349.1_10 Forward -380 -361 -9.73531 0.297
NP_441409.1_6 Reverse -227 -246 11.7008 0.0232
NP_441409.1_6 Forward -248 -229 -15.5368 0.297
NP_440432.1_9 Reverse -234 -249 12.6646 0.0232
NP_442843.1_1 Reverse -204 -223 -10.9153 0.282
NP_440474.1_8 Reverse -234 -248 4.22722 0.287
NP_440726.1_2 Reverse -223 -242 4.52268 0.224
NP_441477.1_10 Forward -156 -138 1.00246 0.267
NP_442450.1_5 Reverse -231 -241 9.41981 0.115
NP_442168.1_5 Forward -241 -222 -0.295539 0.264
NP_440588.1_2 Reverse -262 -281 10.3242 0.0391
NP_440588.1_2 Reverse -224 -243 5.50599 0.0657
NP_440195.1_4 Reverse -131 -150 4.12936 0.297
NP_442006.1_2 Forward -230 -213 -14.5141 0.203
NP_442006.1_2 Forward -275 -258 -15.4975 0.227
NP_442006.1_2 Forward -236 -219 -15.5958 0.228
NP_442006.1_3 Reverse -109 -127 -7.749 0.298
NP_441003.1_9 Reverse -218 -237 5.89931 0.255
NP_441570.1_1 Forward -242 -224 10.4422 0.00901
NP_441570.1_1 Reverse -371 -389 -11.5839 0.198
NP_441570.1_1 Reverse -233 -251 -16.4021 0.245
NP_441078.1_4 Forward -242 -233 19.6659 0.0007
NP_441078.1_4 Reverse -233 -242 19.6659 0.0007
NP_441078.1_4 Forward -295 -286 -1.47524 0.266
NP_442388.1_3 Reverse -134 -153 5.70265 0.282
NP_441432.1_8 Reverse -232 -241 16.8143 0.00595
NP_441432.1_8 Forward -243 -234 16.8143 0.00595
NP_441432.1_8 Forward -140 -131 9.53783 0.0755
NP_441432.1_8 Reverse -208 -217 5.3096 0.17
NP_441432.1_8 Reverse -145 -154 2.55633 0.298
NP_442320.1_8 Reverse -227 -241 7.27608 0.0204
NP_442320.1_8 Forward -248 -234 5.60446 0.0334
NP_441732.1_2 Reverse -229 -245 2.02515 0.0253
NP_440313.1_5 Reverse -332 -350 14.178 0.214
NP_440497.1_2 Forward -241 -222 6.58763 0.249
NP_440629.1_4 Forward -269 -250 7.66927 0.287
NP_440760.1_1 Forward -242 -223 -13.0786 0.0976
NP_440760.1_1 Forward -397 -378 -21.0434 0.228
NP_440760.1_1 Reverse -92 -111 -23.4033 0.297
NP_442797.1_7 Forward -64 -46 2.18243 0.245
NP_441131.1_5 Forward -140 -121 5.01433 0.251
NP_441057.1_3 Forward -116 -97 -13.0786 0.269
NP_440913.1_1 Forward -244 -226 11.1305 0.168
NP_442751.1_2 Forward -147 -128 4.22689 0.261
NP_441072.1_2 Forward -360 -341 5.50599 0.296
NP_440713.1_4 Reverse -223 -242 20.8456 0.015
NP_442489.1_7 Forward -242 -233 20.1576 0.000695
NP_442489.1_7 Reverse -233 -242 20.1576 0.000695
NP_441830.1_2 Forward -349 -330 -2.36049 0.275
NP_440757.1_7 Reverse -261 -279 -4.79907 0.296
NP_442079.1_6 Reverse -225 -244 16.9124 0.244
NP_442079.1_7 Forward -241 -222 7.07928 0.145
NP_440559.1_1 Reverse -234 -243 8.65285 0.0586
NP_440559.1_1 Forward -241 -232 8.65285 0.0586
NP_441659.2_8 Forward -242 -232 20.9245 0.000805
NP_441659.2_8 Reverse -233 -243 20.9245 0.000805
NP_440860.1_8 Forward -220 -201 15.5357 0.24
NP_442913.1_10 Forward -127 -108 5.40766 0.0732
NP_439956.1_7 Forward -151 -132 5.50599 0.257
NP_442008.1_2 Reverse -230 -249 3.73603 0.249
NP_440708.1_6 Forward -240 -221 -8.26035 0.258
NP_441800.1_3 Forward -241 -223 3.06741 0.298
NP_441800.1_7 Reverse -213 -231 -1.75081 0.251
NP_441800.1_10 Reverse -146 -165 0.884433 0.283
NP_442776.1_1 Reverse -222 -241 15.7324 0.0822
NP_442346.1_5 Forward -243 -233 16.303 0.00248
NP_442346.1_5 Reverse -232 -242 16.303 0.00248
NP_442346.1_5 Reverse -364 -374 5.5849 0.238
NP_440545.1_3 Forward -246 -229 5.44704 0.0616
NP_440545.1_3 Reverse -229 -246 -1.82945 0.175
NP_441856.1_3 Forward -245 -226 -1.08219 0.232
NP_441856.1_7 Forward -350 -331 11.5042 0.246
NP_441856.1_7 Forward -113 -94 8.84924 0.292
NP_441923.1_6 Forward -235 -221 13.7659 0.194
NP_440459.1_2 Reverse -138 -155 8.29864 0.266
NP_440459.1_2 Forward -148 -131 7.80699 0.278
NP_440459.1_2 Reverse -128 -145 7.61033 0.285
NP_440010.1_4 Reverse -105 -124 5.89851 0.199
NP_440847.1_3 Forward -153 -139 19.5668 0.0556
NP_441233.1_2 Forward -358 -339 17.7974 0.124
NP_440449.1_6 Forward -232 -214 13.4108 0.105
NP_440449.1_6 Reverse -380 -398 8.3531 0.201
NP_441833.1_4 Forward -241 -234 15.9687 0.0124
NP_441833.1_4 Reverse -234 -241 15.9687 0.0124
NP_441895.1_2 Reverse -131 -150 -26.7466 0.247
NP_441112.1_6 Forward -252 -233 -3.93378 0.296
NP_442162.1_9 Forward -241 -234 16.2637 0.0124
NP_442162.1_9 Reverse -234 -241 16.2637 0.0124
NP_442796.1_10 Forward -236 -217 10.4225 0.249
NP_440671.1_4 Reverse -227 -241 19.2725 0.00971
NP_440224.1_1 Forward -253 -234 1.67108 0.132
NP_440224.1_1 Reverse -222 -241 0.687771 0.132
NP_442073.1_6 Reverse -224 -243 -1.7705 0.283
NP_442199.1_5 Forward -250 -231 -0.885524 0.177
NP_442140.1_3 Reverse -234 -244 4.69992 0.238
NP_440875.1_9 Forward -240 -230 8.27469 0.233
NP_440875.1_9 Reverse -235 -245 7.69067 0.255
NP_441813.1_5 Forward -244 -234 18.1713 0.00743
NP_441813.1_5 Reverse -231 -241 15.9097 0.01
NP_440594.1_6 Reverse -86 -105 5.70185 0.28
NP_440590.1_4 Reverse -234 -247 1.29759 0.127
NP_440590.1_4 Forward -241 -228 -4.20895 0.258
NP_440567.1_1 Forward -241 -227 15.6342 0.017
NP_440567.1_1 Reverse -234 -248 0.687908 0.236
NP_442497.1_10 Forward -241 -232 17.601 0.00813
NP_442497.1_10 Reverse -234 -243 17.601 0.00813
NP_440821.1_4 Reverse -231 -241 11.0914 0.0146
NP_440821.1_4 Forward -244 -234 2.24165 0.131
NP_441239.1_9 Forward -244 -232 13.0187 0.0389
NP_441239.1_9 Reverse -231 -243 12.1337 0.0494
NP_441239.1_9 Reverse -121 -133 7.31547 0.165
NP_441239.1_9 Reverse -269 -281 5.64384 0.213
NP_441239.1_9 Reverse -323 -335 4.26721 0.256
NP_441009.1_4 Forward -242 -223 14.9458 0.167
NP_441727.1_3 Forward -249 -230 4.22769 0.268
NP_441892.1_1 Reverse -323 -340 2.49712 0.14
NP_441892.1_1 Reverse -224 -241 2.00546 0.145
NP_440604.1_6 Forward -242 -223 -2.45882 0.221
NP_442643.1_3 Forward -68 -49 -8.94866 0.297
NP_441017.1_6 Reverse -133 -147 12.6836 0.217
NP_440949.1_7 Reverse -333 -352 11.405 0.233
NP_442052.1_8 Reverse -151 -161 14.1397 0.253
NP_442052.1_8 Forward -164 -154 13.0581 0.253
NP_440546.1_4 Reverse -233 -243 13.5365 0.0459
NP_440546.1_4 Forward -242 -232 13.5365 0.0459
NP_441230.1_5 Forward -247 -228 23.9922 0.00426
NP_441230.1_5 Forward -67 -48 4.71934 0.185
NP_440675.1_3 Reverse -286 -305 10.6192 0.186
NP_440462.1_6 Forward -244 -234 18.7612 0.00454
NP_440462.1_6 Reverse -231 -241 16.893 0.00853
NP_442611.1_1 Forward -242 -223 1.37609 0.238
NP_440868.1_4 Forward -246 -234 7.70879 0.0648
NP_440868.1_4 Reverse -229 -241 6.1355 0.0878
NP_442402.1_4 Reverse -5 -24 -1.08295 0.189
NP_442402.1_4 Forward -214 -195 -6.19614 0.253
NP_442402.1_10 Reverse -371 -381 12.8609 0.204
NP_440036.1_10 Reverse -308 -320 21.3768 0.214
NP_440653.1_10 Reverse -222 -241 3.83436 0.261
NP_442039.1_4 Forward -241 -234 15.1821 0.0124
NP_442039.1_4 Reverse -234 -241 15.1821 0.0124
NP_442039.1_7 Reverse -205 -215 14.0414 0.211
NP_442039.1_7 Forward -234 -224 7.25653 0.277
NP_441811.1_1 Forward -155 -136 13.1758 0.257
NP_441811.1_8 Forward -224 -210 10.0294 0.22
NP_441811.1_8 Forward -107 -93 6.09611 0.287
NP_441926.1_3 Reverse -233 -249 5.07341 0.174
NP_442837.1_3 Forward -241 -234 15.7721 0.0124
NP_442837.1_3 Reverse -234 -241 15.7721 0.0124
NP_440160.1_2 Forward -281 -262 3.24438 0.217
NP_440160.1_9 Reverse -233 -252 7.7676 0.277
NP_439994.1_1 Forward -341 -322 10.4225 0.195
NP_442053.1_1 Forward -242 -233 18.3876 0.0007
NP_442053.1_1 Reverse -233 -242 18.3876 0.0007
NP_440505.1_3 Forward -244 -234 17.188 0.00332
NP_440505.1_3 Reverse -231 -241 15.123 0.014
NP_441203.1_1 Forward -241 -222 -2.36049 0.0647
NP_441408.2_7 Forward -244 -225 -2.26216 0.265
NP_440914.1_1 Forward -242 -232 16.3248 0.00196
NP_440914.1_1 Reverse -233 -243 16.3248 0.00196
NP_440914.1_1 Reverse -203 -213 9.39583 0.186
NP_440914.1_1 Reverse -341 -351 7.15123 0.249
NP_440914.1_1 Reverse -131 -141 7.15123 0.249
NP_440914.1_1 Reverse -146 -156 6.07773 0.297
NP_441011.1_8 Forward -241 -232 16.6177 0.00602
NP_441011.1_8 Reverse -234 -243 16.6177 0.00602
NP_441011.1_8 Forward -340 -331 5.80125 0.227
NP_442101.1_10 Forward -250 -231 4.42435 0.0629
NP_442533.1_6 Forward -242 -233 17.2076 0.00137
NP_442533.1_6 Reverse -233 -242 17.2076 0.00137
NP_442533.1_6 Forward -280 -271 11.3078 0.0442
NP_442533.1_6 Reverse -123 -132 6.48957 0.109
NP_442533.1_6 Forward -155 -146 4.62128 0.179
NP_442533.1_6 Forward -132 -123 4.12963 0.191
NP_442533.1_6 Reverse -109 -118 2.94966 0.232
NP_442533.1_6 Reverse -286 -295 2.55633 0.25
NP_442533.1_6 Reverse -92 -101 2.458 0.255
NP_442533.1_6 Reverse -332 -341 2.26134 0.266
NP_442533.1_6 Reverse -266 -275 2.26134 0.266
NP_442533.1_6 Forward -397 -388 2.26134 0.266
NP_442533.1_6 Reverse -124 -133 1.86802 0.284
NP_442533.1_6 Forward -131 -122 1.67135 0.293
NP_442541.1_10 Forward -156 -142 1.76896 0.279
NP_442541.1_10 Forward -280 -266 1.5723 0.283
NP_442232.1_3 Reverse -45 -64 -15.0452 0.288
NP_442322.1_4 Reverse -115 -132 -6.74666 0.277
NP_441482.1_7 Reverse -227 -241 17.6008 0.00517
NP_441482.1_7 Forward -248 -234 -4.7203 0.156
NP_439944.1_9 Forward -241 -231 17.6796 0.00347
NP_439944.1_9 Reverse -234 -244 9.12481 0.1
NP_440116.1_8 Forward -287 -268 -6.98204 0.22
NP_440115.1_6 Reverse -230 -240 7.45319 0.147
NP_440115.1_6 Forward -245 -235 4.79825 0.282
NP_440007.1_9 Reverse -229 -243 12.586 0.163
NP_442728.1_7 Reverse -130 -144 15.0442 0.219
NP_439965.1_1 Reverse -224 -243 -2.16383 0.177
NP_443045.1_9 Reverse -110 -128 6.31156 0.3
NP_441972.1_5 Forward -241 -222 8.16093 0.0748
NP_441972.1_5 Reverse -330 -349 -6.49039 0.231
NP_441106.1_1 Reverse -232 -241 18.486 0.0028
NP_441106.1_1 Forward -243 -234 18.486 0.0028
NP_439903.1_6 Forward -245 -226 16.7149 0.0621
NP_442588.1_6 Forward -115 -96 7.47261 0.173
NP_441286.1_1 Forward -243 -231 4.95553 0.027
NP_441286.1_1 Reverse -232 -244 -3.50094 0.145
NP_442674.1_1 Reverse -200 -219 16.8715 0.133
NP_440670.1_8 Forward -242 -233 18.3876 0.000699
NP_440670.1_8 Reverse -233 -242 18.3876 0.000699
NP_440886.1_7 Forward -243 -233 8.04271 0.0805
NP_440886.1_7 Reverse -232 -242 8.04271 0.0805
NP_440886.1_7 Reverse -91 -101 7.45273 0.093
NP_440886.1_7 Forward -270 -260 5.48612 0.181
NP_440886.1_7 Reverse -346 -356 3.51951 0.279
NP_442401.1_2 Forward -289 -270 8.16011 0.25
NP_442022.1_4 Forward -353 -334 7.86593 0.268
NP_440907.2_8 Reverse -234 -244 9.616 0.103
NP_440907.2_8 Forward -241 -231 9.51767 0.103
NP_442264.1_5 Forward -242 -228 12.1926 0.253
NP_441021.1_1 Reverse -210 -229 -9.24366 0.212
NP_440841.1_4 Reverse -231 -250 2.75272 0.0964
NP_441463.1_3 Forward -252 -233 -1.96717 0.147
NP_441463.1_3 Reverse -223 -242 -3.14714 0.17
NP_441626.1_2 Forward -241 -234 15.7721 0.0124
NP_441626.1_2 Reverse -234 -241 15.7721 0.0124
NP_442211.1_3 Forward -151 -132 7.86106 0.275
NP_442794.1_1 Reverse -229 -241 10.2654 0.0721
NP_442615.1_1 Forward -251 -233 4.44404 0.0465
NP_442615.1_1 Reverse -224 -242 -7.25734 0.283
NP_441962.1_4 Forward -223 -204 -8.65367 0.203
NP_441962.1_4 Forward -241 -222 -12.5869 0.26
NP_440387.1_1 Forward -242 -226 6.35172 0.0282
NP_440855.1_3 Forward -168 -149 7.96345 0.23
NP_441431.1_2 Forward -272 -258 12.9786 0.102
NP_441431.1_2 Reverse -127 -141 6.58715 0.266
NP_442647.1_7 Reverse -126 -139 15.2606 0.169
NP_441193.1_3 Forward -92 -78 20.0591 0.258
NP_441993.1_1 Reverse -227 -246 12.9594 0.0899
NP_441993.1_1 Reverse -260 -279 10.9128 0.122
NP_441993.1_1 Reverse -54 -73 3.21363 0.239
NP_441993.1_1 Reverse -147 -166 2.33652 0.26
NP_441993.1_1 Forward -397 -378 1.4594 0.276
NP_440114.1_10 Reverse -233 -247 15.6342 0.0243
NP_440737.1_1 Reverse -54 -73 6.4893 0.251
NP_442323.1_7 Forward -247 -228 10.7167 0.147
NP_441272.1_7 Forward -107 -97 14.0414 0.257
NP_440293.1_3 Reverse -264 -283 5.211 0.192
NP_440293.1_3 Forward -238 -219 -4.32711 0.262
NP_440293.1_10 Forward -365 -346 2.94938 0.219
NP_440766.1_4 Reverse -229 -243 6.88276 0.097
NP_441237.1_6 Forward -236 -219 6.13536 0.204
NP_442743.1_5 Forward -241 -222 30.2854 0.0000309
NP_442743.1_7 Forward -106 -88 18.6029 0.274
NP_442743.1_9 Forward -277 -258 25.8605 0.00123
NP_441531.1_6 Forward -389 -376 10.1474 0.254
NP_442103.1_1 Reverse -95 -109 21.9274 0.0884
NP_442867.1_8 Reverse -348 -367 4.916 0.277
NP_440457.1_1 Reverse -229 -241 8.39711 0.101
NP_440457.1_1 Forward -246 -234 -0.551008 0.268
NP_440798.1_6 Reverse -234 -247 3.36254 0.151
NP_440801.1_10 Forward -144 -125 5.50599 0.289
NP_442297.1_4 Reverse -294 -313 14.0859 0.214
NP_441984.1_3 Forward -246 -228 4.83737 0.3
NP_441332.1_6 Reverse -91 -101 14.5511 0.144
NP_441436.1_8 Forward -133 -114 10.1275 0.262
NP_441436.1_8 Reverse -232 -251 6.88262 0.296
NP_442509.1_9 Reverse -233 -243 8.04271 0.192
NP_442509.1_9 Forward -242 -232 8.04271 0.192
NP_441496.1_1 Reverse -245 -259 14.0489 0.271
NP_440524.1_2 Forward -240 -221 -1.47551 0.27
NP_440524.1_2 Forward -144 -125 -3.83545 0.271
NP_442514.1_5 Forward -303 -284 3.24359 0.159
NP_440554.1_4 Reverse -234 -244 17.9746 0.0131
NP_440554.1_4 Forward -241 -231 16.1063 0.0189
NP_441761.1_1 Forward -241 -222 7.17762 0.252
NP_441885.1_5 Forward -242 -232 11.3864 0.00668
NP_441885.1_5 Reverse -233 -243 11.3864 0.00668
NP_441885.1_5 Forward -295 -285 7.55152 0.0511
NP_441275.1_6 Forward -293 -280 18.5055 0.156
NP_440478.1_10 Reverse -258 -272 6.88276 0.286
NP_442341.1_7 Reverse -346 -360 4.32615 0.194
NP_442341.1_7 Reverse -285 -299 1.76955 0.281
NP_442341.1_9 Forward -244 -230 19.4684 0.00949
NP_441756.1_5 Reverse -268 -287 7.57094 0.157
NP_442395.2_4 Forward -243 -224 8.35677 0.125
NP_440686.1_7 Reverse -241 -260 19.2266 0.292
NP_443000.1_7 Forward -244 -234 20.3345 0.00223
NP_443000.1_7 Reverse -231 -241 17.4829 0.00719
NP_442513.1_5 Forward -112 -93 8.25844 0.274
NP_441842.1_10 Reverse -226 -240 6.58777 0.283
NP_440275.1_3 Forward -244 -234 16.1063 0.0155
NP_440275.1_3 Reverse -231 -241 9.12481 0.055
NP_441902.1_4 Forward -228 -209 3.34271 0.28
NP_440679.1_10 Forward -240 -221 -15.9302 0.25
NP_439962.1_4 Reverse -45 -64 -4.32711 0.269
NP_439962.1_4 Reverse -123 -142 -7.76869 0.29
NP_439962.1_4 Forward -280 -261 -8.752 0.298
NP_440149.1_8 Forward -242 -223 9.93088 0.0507
NP_441105.1_3 Forward -253 -234 -1.47551 0.15
NP_441105.1_3 Reverse -222 -241 -5.9004 0.225
NP_441105.1_3 Forward -247 -228 -8.06369 0.265
NP_440216.1_1 Reverse -233 -247 24.6807 0.000529
NP_440216.1_1 Forward -242 -228 -2.55701 0.0521
NP_440216.1_9 Reverse -205 -214 7.17789 0.286
NP_440172.1_1 Forward -242 -232 17.5813 0.00421
NP_440172.1_1 Reverse -233 -243 17.5813 0.00421
NP_440172.1_1 Reverse -209 -219 3.02829 0.251
NP_440172.1_1 Reverse -153 -163 2.7333 0.268
NP_442015.1_10 Reverse -229 -242 11.229 0.0372
NP_442015.1_10 Forward -122 -109 7.59077 0.0819
NP_441226.1_7 Forward -241 -234 14.4934 0.0123
NP_441226.1_7 Reverse -234 -241 14.4934 0.0123
NP_441111.1_7 Forward -241 -233 18.7023 0.00294
NP_441111.1_7 Reverse -234 -242 18.7023 0.00294
NP_442379.1_10 Reverse -226 -243 -4.38605 0.297
NP_441766.1_2 Forward -242 -233 17.5026 0.00297
NP_441766.1_2 Reverse -233 -242 17.5026 0.00297
NP_442417.1_5 Forward -242 -228 9.63603 0.128
NP_442417.1_5 Reverse -233 -247 5.60446 0.255
NP_442179.1_5 Forward -281 -262 15.4374 0.264
NP_440416.1_1 Reverse -233 -252 -4.42544 0.128
NP_440416.1_9 Reverse -129 -148 -11.3086 0.149
NP_440416.1_9 Reverse -226 -245 -12.2919 0.156
NP_440416.1_9 Forward -156 -137 -19.8634 0.279
NP_443052.1_8 Reverse -375 -394 -9.93197 0.198
NP_443052.1_9 Forward -67 -48 -5.70374 0.273
NP_443052.1_9 Reverse -325 -344 -7.17871 0.294
NP_441940.1_4 Forward -244 -225 15.1424 0.266
NP_442154.1_1 Forward -343 -325 -8.04399 0.155
NP_442154.1_1 Forward -112 -94 -17.1888 0.249
NP_442226.1_8 Reverse -65 -75 13.0581 0.274
NP_440261.1_5 Reverse -234 -247 -2.73398 0.0924
NP_440261.1_5 Forward -241 -228 -10.6005 0.201
NP_440988.1_10 Forward -157 -143 7.31914 0.216
NP_440988.1_10 Reverse -144 -158 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAAGGGGGTCACCCCCGCATGGTGGAAACCGTAGCTCGACTAACGGAGGTGGGCATTCCGGTGATGGGTCATGTGGGCTTAACGCCCCAATCAGTCCATCAGTTGGGTTATCGGCAACAGGGCCAGGACCCGGCCACAGCGGAGAAAATTCTTCATCAGGCGATCGCCTTGGCAGAGGCGGGAGTGTTTGCCATTGTTTTAGAACATATTCCTAGCGAACTAGCGGCTAGTATCACTGAGCAGTTGCCCATTCCCACCATTGGCATTGGGGCAGGGCCCCAGTGTGACGGCCAGGTTTTGGTGACGGCGGATTTACTCGGTTTGACAGTCAAACAACCGCCCTTTGCTCCGGCCTATCTGAATTTACGACATACCATTACGGAAACAGTGCATAAATTCA

CDS

GTGGAGAAGTGCGACAAAGACAATTTCCCCGGCGGGGTTAGGGAACAAACTAAAACTTTGCCAACAGGCTGCCCAGGCTCCAGCAATGACCATAACCGATTGACTGCCGAAAAATCTATGACCAAAACTGCTGTTGTTTTACTATCCGGAGGGTTAGATTCCGCCACCGTAGCGGCGATCGCCAAAAGGGAAGGGTACCGAGTTATTGCCCTTTCCTTTAACTACGGTCAACGCCATGACCGGGAATTGCGAGCGGCGGCAGACATCGTCCAAGCTCTGGGGATCCCAGAACATTTCAGCATCAACCTAGACCTGGCCCAGTGGGGAGGCTCTTCCCTGACCGATCGCCAACAAACCTTGCCCCAGACAGGGGTAGAACCAGATATTATTCCTTCCACCTATGTGCCGGGGCGTAACACCGTATTTATTGCCCTCGGTTTATCCCTAGCTGAAGCAAAGGGAGCCGAAGCGGTATTTTTGGGCATCAATGCCATCGACTATTCCGGCTATCCTGATTGCCGCCCCGAATATTTAGCAACCTATCAACAATTAGCAGCCCTGTCTTCCAAAGTCGGGGTAGAAGGAAGACCCATTCAATTGCTGGCTCCCCTGATTGAATTGAGCAAAGTTGACATTGTCCATAAAGCTTTGGAATTGGGAGTCCCCATTGCCCAAACCTGGTCTTGCTACGCCGGGGGGGAAGAACCCTGTGGTCGCTGTGACTCCTGCCGTTTGCGGGATCAGGCTTTAATTGAGGCAGGGCATCCAGAACTGGCCAGTGCCAAGGGCCGTCTTTGGAGGGAAAAAGTTGACTGA

Protein

MEKCDKDNFPGGVREQTKTLPTGCPGSSNDHNRLTAEKSMTKTAVVLLSGGLDSATVAAIAKREGYRVIALSFNYGQRHDRELRAAADIVQALGIPEHFSINLDLAQWGGSSLTDRQQTLPQTGVEPDIIPSTYVPGRNTVFIALGLSLAEAKGAEAVFLGINAIDYSGYPDCRPEYLATYQQLAALSSKVGVEGRPIQLLAPLIELSKVDIVHKALELGVPIAQTWSCYAGGEEPCGRCDSCRLRDQALIEAGHPELASAKGRLWREKVD